SimulationCraft 1015-01

for World of Warcraft 10.2.0.52095 PTR (hotfix 2023-11-09/52095, git build e1ec9bc853)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
Adjust bear thrash periodic damage spell level requirement
Thrash spell_level 11.00 18.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-05-16 Base value of Frost aura's effect 191124 is truncated.
Frost Mage (effect#5) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191122 is truncated.
Frost Mage (effect#3) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191121 is truncated.
Frost Mage (effect#2) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 179703 is truncated.
Frost Mage (effect#1) base_value 9.00 9.20
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-01-08 Manually set secondary Malefic Rapture level requirement
Malefic Rapture spell_level 11.00 43.00

Table of Contents

Raid Summary

Created with Highcharts 4.2.3 Damage per Second(Click title for burst)771,809753,285723,645714,050712,052702,661674,968470 T31 4p460 T31 4p447+470 2p+2p447+460 2p+2p470 T31 2p460 T31 2p447 T30 4p
Created with Highcharts 4.2.3 Priority Target/Boss Damage 140,845137,274131,838130,326130,192128,418121,365470 T31 4p460 T31 4p447+470 2p+2p470 T31 2p447+460 2p+2p460 T31 2p447 T30 4p
Created with Highcharts 4.2.3 Damage Taken per Second(Click title for burst)3,8913,8793,8493,8323,7923,7303,708470 T31 2p470 T31 4p460 T31 2p447+470 2p+2p460 T31 4p447+460 2p+2p447 T30 4p

Additional Raid Information

447 T30 4p : 674968 dps, 121365 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
674967.6 674967.6 657.8 / 0.097% 53332.1 / 7.9% 49148.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.7 13.9 Astral Power 0.00% 53.9 100.2% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
447 T30 4p 674968
Astral Smolder 77668 11.5% 340.2 0.95s 68538 0 Periodic 701.4 33251 0 33251 0.0% 77.8%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 340.21 0.00 701.41 701.41 243.69 0.0000 2.0000 23317188.73 23317188.73 0.00% 16621.74 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 701.41 522 887 33250.82 3321 123430 33283.59 29855 37755 23317189 23317189 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Fury of Elune 19852 2.9% 5.1 65.54s 1157879 1178671 Direct 754.2 4943 10684 7903 51.5%

Stats Details: Fury Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.15 754.17 0.00 0.00 0.00 0.9825 0.0000 5958183.62 5958183.62 0.00% 1178671.34 1178671.34
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.47% 365.52 229 516 4942.81 2643 15758 4948.18 4336 5641 1806464 1806464 0.00%
crit 51.53% 388.65 263 539 10683.56 5392 32145 10693.42 9806 11990 4151720 4151720 0.00%

Action Details: Fury Of Elune

  • id:202770
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:astral_power
  • energize_amount:3.0

Spelldata

  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r

Action Details: Fury Of Elune Tick

  • id:211545
  • school:astral
  • range:105.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.149000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:211545
  • name:Fury of Elune
  • school:astral
  • tooltip:
  • description:{$@spelldesc202770=Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r}

Action Priority List

    aoe
    [O]:5.14
  • if_expr:target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Hungering Shadowflame 2860 0.4% 16.8 17.21s 51198 0 Direct 16.8 39910 81680 51215 27.0%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.82 16.82 0.00 0.00 0.00 0.0000 0.0000 861362.26 861362.26 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.97% 12.28 3 24 39909.79 26959 154597 39693.63 26959 85416 489738 489738 0.00%
crit 27.03% 4.55 0 15 81679.55 54997 315378 80650.58 0 278345 371625 371625 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24191.79
  • base_dd_max:24191.79
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 5484 0.8% 33.4 8.79s 49297 0 Direct 33.4 38600 78680 49417 27.0%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.44 33.35 0.00 0.00 0.00 0.0000 0.0000 1648429.52 1648429.52 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.99% 24.34 9 44 38599.77 38162 43768 38600.55 38162 39890 939694 939694 0.00%
crit 27.01% 9.01 1 21 78680.16 77851 89287 78687.02 77851 84840 708736 708736 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:34245.43
  • base_dd_max:34245.43
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 69185 10.3% 3.0 1.08s 6931118 7407679 Direct 6.0 6874 14025 10337 48.4%
Periodic 1795.7 8081 16722 11546 40.1% 99.3%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.00 6.00 1795.65 1795.65 0.00 0.9358 0.9966 20793353.78 20793353.78 0.00% 11601.36 7407678.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 51.62% 3.10 0 6 6874.19 6810 7811 6784.65 0 7811 21290 21290 0.00%
crit 48.38% 2.90 0 6 14025.15 13893 15934 13742.13 0 15934 40717 40717 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 59.90% 1075.68 813 1362 8080.69 6535 13234 8079.69 7884 8273 8691995 8691995 0.00%
crit 40.10% 719.97 527 916 16722.10 13331 26996 16723.34 16311 17204 12039351 12039351 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.39

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.39
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    aoe
    [J]:3.00
  • if_expr:!fight_style.dungeonroute
  • target_if_expr:refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (82024) 0.0% (12.2%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 13680 2.0% 183.1 1.83s 22450 0 Direct 182.6 14288 30669 22506 50.2%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 183.10 182.64 0.00 0.00 0.00 0.0000 0.0000 4110564.16 4110564.16 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.82% 90.99 53 134 14287.90 10689 26016 14291.62 13160 15379 1300159 1300159 0.00%
crit 50.18% 91.64 53 132 30668.68 21806 53072 30684.77 28781 32741 2810405 2810405 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 13776 2.0% 184.9 1.83s 22386 0 Direct 184.5 14246 30594 22439 50.1%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 184.92 184.47 0.00 0.00 0.00 0.0000 0.0000 4139676.58 4139676.58 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.88% 92.00 58 135 14245.83 9692 26016 14248.21 13428 15368 1310629 1310629 0.00%
crit 50.12% 92.46 59 132 30594.05 19771 53072 30614.51 28735 33084 2829048 2829048 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy3
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 29027 4.3% 15.3 19.84s 568921 0 Direct 91.8 60561 129744 95070 49.9%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.34 91.75 0.00 0.00 0.00 0.0000 0.0000 8724527.98 8724527.98 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 50.11% 45.98 22 71 60560.94 33293 218914 60577.32 49098 75444 2784457 2784457 0.00%
crit 49.89% 45.77 25 79 129743.78 67918 440471 129850.35 105691 155157 5940071 5940071 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Crashing Star 25542 3.8% 92.0 3.33s 83515 0 Direct 91.8 53310 114254 83699 49.9%

Stats Details: Crashing Star

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 91.96 91.76 0.00 0.00 0.00 0.0000 0.0000 7680129.20 7680129.20 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 50.13% 46.00 24 75 53310.31 36166 97084 53315.47 49080 59472 2451810 2451810 0.00%
crit 49.87% 45.76 20 73 114253.58 73779 198050 114323.92 104863 126727 5228319 5228319 0.00%

Action Details: Crashing Star

  • id:408310
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:5.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Spelldata

  • id:408310
  • name:Crashing Star
  • school:astral
  • tooltip:
  • description:{$@spelldesc405511=Shooting Stars has a {$s1=20}% chance to instead call down a Crashing Star, dealing {$408310s1=0} Astral damage to the target and generating {$=}{{$408310m2=50}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfall 222100 32.9% 105.1 2.84s 634858 618064 Direct 1774.4 24978 53967 37597 43.5%

Stats Details: Starfall

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 105.07 1774.45 0.00 0.00 0.00 1.0272 0.0000 66705845.34 66705845.34 0.00% 618064.48 618064.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.47% 1001.96 715 1264 24977.99 6036 85539 25020.69 23132 27233 25023961 25023961 0.00%
crit 43.53% 772.49 588 1005 53966.75 12314 175521 54036.37 50830 58986 41681884 41681884 0.00%

Action Details: Starfall

  • id:191034
  • school:astral
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:45.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]

Action Details: Starfall Damage

  • id:191037
  • school:astral
  • range:200.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy3
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.114000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.41

Spelldata

  • id:191037
  • name:Starfall
  • school:astral
  • tooltip:
  • description:{$@spelldesc191034=Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]}

Action Priority List

    aoe
    [L]:71.77
  • if_expr:variable.starfall_condition1
    aoe
    [P]:33.31
  • if_expr:variable.starfall_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountLunar Shrapnel4151691PCT0.200
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 129443 19.2% 106.8 2.76s 364094 247435 Direct 646.8 38723 80673 60130 51.0%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 106.80 646.83 0.00 0.00 0.00 1.4715 0.0000 38886842.00 38886842.00 0.00% 247434.73 247434.73
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.98% 316.80 221 421 38722.68 6105 95006 38719.39 35878 43101 12266393 12266393 0.00%
crit 51.02% 330.03 237 414 80673.42 12455 197527 80666.73 75070 87155 26620449 26620449 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    aoe
    [Q]:107.30
  • if_expr:spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Solar)4851710.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Sunfire16481550.283Mastery
Sunfire 59040 8.7% 1.0 0.00s 17734289 18786323 Direct 1.0 5415 11043 6955 27.3%
Periodic 1808.7 6956 14762 9801 36.5% 100.0%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 1808.66 1808.66 0.00 0.9445 0.9962 17734289.26 17734289.26 0.00% 9837.27 18786323.36
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.66% 0.73 0 1 5415.06 5384 5450 3934.50 0 5450 3935 3935 0.00%
crit 27.34% 0.27 0 1 11043.41 10983 11117 3019.23 0 11117 3019 3019 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 63.54% 1149.31 867 1436 6955.56 5401 12030 6957.05 6782 7155 7993879 7993879 0.00%
crit 36.46% 659.36 499 839 14761.83 11017 24542 14767.67 14350 15310 9733457 9733457 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.26
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    aoe
    [I]:1.00
  • target_if_expr:refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (5265) 0.0% (0.8%) 8.3 33.39s 191095 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.28 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 2750 0.4% 8.3 33.39s 99803 0 Direct 49.7 12999 26496 16632 26.9%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.28 49.71 0.00 0.00 0.00 0.0000 0.0000 826839.22 826839.22 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.07% 36.32 7 82 12998.83 12846 14733 12996.71 12846 14156 472148 472148 0.00%
crit 26.93% 13.39 0 35 26495.82 26205 30055 26483.55 0 30055 354691 354691 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:39522.22
  • base_dd_max:39522.22
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 2515 0.4% 15.9 16.33s 47475 0 Direct 95.6 6183 12603 7913 26.9%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.93 95.59 0.00 0.00 0.00 0.0000 0.0000 756336.51 756336.51 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.07% 69.85 20 153 6183.50 6112 7010 6183.29 6112 6749 431913 431913 0.00%
crit 26.93% 25.74 1 58 12602.84 12469 14301 12603.57 12469 13385 324423 324423 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18805.57
  • base_dd_max:18805.57
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 2045 0.3% 26.4 10.43s 23444 23272 Direct 26.2 16819 34180 23589 39.0%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.37 26.21 0.00 0.00 0.00 1.0074 0.0000 618104.29 618104.29 0.00% 23272.00 23272.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.04% 16.00 6 26 16818.76 12439 27178 16794.09 15540 18432 269077 269077 0.00%
crit 38.96% 10.21 2 23 34180.04 25375 52817 34123.87 29432 39667 349027 349027 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    aoe
    [N]:24.48
  • if_expr:!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.800Spell Data
Eclipse (Solar)4851710.150Current Value
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Lunar)4851810.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
447 T30 4p
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447 T30 4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447 T30 4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447 T30 4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 180.83s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    aoe
    [M]:2.00
  • if_expr:variable.cd_condition_aoe

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.2 165.00s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.21 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447 T30 4p
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:57075.72
  • base_dd_max:57075.72
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.42s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447 T30 4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.74
Elemental Potion of Ultimate Power 1.5 306.70s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.46 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.45
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 16.5 6.9 18.8s 13.5s 9.8s 53.69% 55.73% 6.9 (26.4) 15.9

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 48.9s
  • trigger_min/max:0.0s / 38.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.3s
  • uptime_min/max:50.08% / 57.31%

Stack Uptimes

  • balance_of_all_things_arcane_1:5.40%
  • balance_of_all_things_arcane_2:5.74%
  • balance_of_all_things_arcane_3:6.17%
  • balance_of_all_things_arcane_4:6.70%
  • balance_of_all_things_arcane_5:7.05%
  • balance_of_all_things_arcane_6:7.41%
  • balance_of_all_things_arcane_7:7.56%
  • balance_of_all_things_arcane_8:7.66%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 10.3 0.0 29.9s 29.9s 7.9s 27.14% 30.34% 0.0 (0.0) 10.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 47.5s
  • trigger_min/max:4.7s / 47.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:24.84% / 29.93%

Stack Uptimes

  • balance_of_all_things_nature_1:3.36%
  • balance_of_all_things_nature_2:3.37%
  • balance_of_all_things_nature_3:3.38%
  • balance_of_all_things_nature_4:3.39%
  • balance_of_all_things_nature_5:3.40%
  • balance_of_all_things_nature_6:3.41%
  • balance_of_all_things_nature_7:3.41%
  • balance_of_all_things_nature_8:3.42%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Best Friends with Aerwynn 2.8 0.0 70.1s 70.1s 10.8s 10.20% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 322.1s
  • trigger_min/max:12.0s / 322.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 32.47%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.91%
  • best_friends_with_aerwynn_2:0.91%
  • best_friends_with_aerwynn_3:0.92%
  • best_friends_with_aerwynn_4:0.92%
  • best_friends_with_aerwynn_5:0.92%
  • best_friends_with_aerwynn_6:0.93%
  • best_friends_with_aerwynn_7:0.93%
  • best_friends_with_aerwynn_8:0.93%
  • best_friends_with_aerwynn_9:0.94%
  • best_friends_with_aerwynn_10:0.94%
  • best_friends_with_aerwynn_11:0.94%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 1.0 112.6s 70.1s 46.0s 33.92% 0.00% 70.5 (70.5) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 327.0s
  • trigger_min/max:12.0s / 322.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 277.5s
  • uptime_min/max:0.00% / 95.16%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.92%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.6s 70.6s 10.8s 10.09% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 319.0s
  • trigger_min/max:12.0s / 319.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 39.16%

Stack Uptimes

  • best_friends_with_pip_1:0.90%
  • best_friends_with_pip_2:0.90%
  • best_friends_with_pip_3:0.91%
  • best_friends_with_pip_4:0.91%
  • best_friends_with_pip_5:0.92%
  • best_friends_with_pip_6:0.92%
  • best_friends_with_pip_7:0.92%
  • best_friends_with_pip_8:0.92%
  • best_friends_with_pip_9:0.93%
  • best_friends_with_pip_10:0.93%
  • best_friends_with_pip_11:0.93%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 115.5s 70.6s 45.8s 33.43% 0.00% 69.2 (69.2) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:17.5s / 354.0s
  • trigger_min/max:12.0s / 319.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 302.4s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.43%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 68.6s 68.6s 10.8s 10.10% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 311.9s
  • trigger_min/max:12.0s / 311.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 30.25%

Stack Uptimes

  • best_friends_with_urctos_1:0.90%
  • best_friends_with_urctos_2:0.91%
  • best_friends_with_urctos_3:0.91%
  • best_friends_with_urctos_4:0.91%
  • best_friends_with_urctos_5:0.92%
  • best_friends_with_urctos_6:0.92%
  • best_friends_with_urctos_7:0.92%
  • best_friends_with_urctos_8:0.93%
  • best_friends_with_urctos_9:0.93%
  • best_friends_with_urctos_10:0.93%
  • best_friends_with_urctos_11:0.93%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 1.0 112.4s 68.6s 44.9s 32.65% 0.00% 67.8 (67.8) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:15.0s / 333.1s
  • trigger_min/max:12.0s / 311.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 271.4s
  • uptime_min/max:0.00% / 82.87%

Stack Uptimes

  • best_friends_with_urctos_static_1:32.65%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.66%

Stack Uptimes

  • bloodlust_1:13.48%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 62.3s 59.0s 49.9s 80.13% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 335.0s
  • trigger_min/max:15.0s / 288.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 358.6s
  • uptime_min/max:52.89% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.13%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 13.2 8.1 23.8s 14.9s 20.5s 90.33% 91.49% 8.1 (8.1) 12.4

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.7s / 71.9s
  • trigger_min/max:0.0s / 58.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 68.3s
  • uptime_min/max:86.71% / 93.74%

Stack Uptimes

  • eclipse_lunar_1:90.33%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 8.2 0.0 38.3s 38.3s 19.1s 52.62% 54.80% 0.0 (0.0) 7.9

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 83.7s
  • trigger_min/max:12.0s / 83.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:47.42% / 59.72%

Stack Uptimes

  • eclipse_solar_1:52.62%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 306.7s 306.7s 27.6s 13.11% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 326.3s
  • trigger_min/max:300.0s / 326.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.79% / 17.88%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.11%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Fury of Elune 5.1 0.0 65.2s 65.2s 7.9s 13.55% 0.00% 76.3 (76.3) 5.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:60.0s / 87.8s
  • trigger_min/max:60.0s / 87.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s
  • uptime_min/max:10.87% / 15.67%

Stack Uptimes

  • fury_of_elune_1:13.55%

Spelldata

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 8.2 0.0 38.3s 38.3s 19.1s 52.62% 55.45% 0.0 (0.0) 7.9

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 83.7s
  • trigger_min/max:12.0s / 83.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:47.42% / 59.72%

Stack Uptimes

  • incarnation_chosen_of_elune_1:52.62%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.7 0.0 91.0s 91.0s 19.6s 23.98% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:55.09

Trigger Details

  • interval_min/max:90.0s / 120.9s
  • trigger_min/max:90.0s / 120.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:21.38% / 27.04%

Stack Uptimes

  • kindled_soul_5:1.17%
  • kindled_soul_10:1.17%
  • kindled_soul_15:1.18%
  • kindled_soul_20:1.18%
  • kindled_soul_25:1.18%
  • kindled_soul_30:1.19%
  • kindled_soul_35:1.19%
  • kindled_soul_40:1.19%
  • kindled_soul_45:1.20%
  • kindled_soul_50:1.20%
  • kindled_soul_55:1.20%
  • kindled_soul_60:1.20%
  • kindled_soul_65:1.21%
  • kindled_soul_70:1.21%
  • kindled_soul_75:1.21%
  • kindled_soul_80:1.22%
  • kindled_soul_85:1.22%
  • kindled_soul_90:1.22%
  • kindled_soul_95:1.22%
  • kindled_soul_100:1.23%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Vigil 3.7 0.0 90.4s 90.4s 14.8s 18.36% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.5s
  • trigger_min/max:90.0s / 91.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.55% / 20.99%

Stack Uptimes

  • natures_vigil_1:18.36%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.0 70.6s 69.9s 1.0s 0.86% 1.27% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 316.5s
  • trigger_min/max:0.1s / 316.5s
  • trigger_pct:14.74%
  • duration_min/max:0.0s / 6.7s
  • uptime_min/max:0.00% / 5.62%

Stack Uptimes

  • owlkin_frenzy_1:0.86%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 9.2 96.8 34.0s 34.0s 30.0s 91.59% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.9s / 45.5s
  • trigger_min/max:20.9s / 45.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 43.5s
  • uptime_min/max:88.29% / 94.44%

Stack Uptimes

  • primordial_arcanic_pulsar_5:6.88%
  • primordial_arcanic_pulsar_10:6.74%
  • primordial_arcanic_pulsar_15:7.39%
  • primordial_arcanic_pulsar_20:8.66%
  • primordial_arcanic_pulsar_25:8.79%
  • primordial_arcanic_pulsar_30:8.05%
  • primordial_arcanic_pulsar_35:8.51%
  • primordial_arcanic_pulsar_40:9.16%
  • primordial_arcanic_pulsar_45:9.79%
  • primordial_arcanic_pulsar_50:9.19%
  • primordial_arcanic_pulsar_55:8.43%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 18.0 5.3 17.2s 13.5s 7.1s 42.56% 41.75% 5.3 (5.3) 17.6

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 43.5s
  • trigger_min/max:0.0s / 38.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:38.76% / 45.95%

Stack Uptimes

  • solstice_1:42.56%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starfall 105.1 0.0 141.1s 2.8s 283.6s 98.88% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_starfall
  • max_stacks:20
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:asynchronous
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.9s / 356.9s
  • trigger_min/max:0.7s / 8.6s
  • trigger_pct:99.99%
  • duration_min/max:1.1s / 357.8s
  • uptime_min/max:98.32% / 99.47%

Stack Uptimes

  • starfall_1:5.23%
  • starfall_2:32.83%
  • starfall_3:41.72%
  • starfall_4:15.53%
  • starfall_5:3.22%
  • starfall_6:0.36%
  • starfall_7:0.00%

Spelldata

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]
  • max_stacks:20
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Starlord 21.0 84.1 14.5s 2.8s 14.0s 97.37% 0.00% 42.8 (42.8) 6.8

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 18.6s
  • trigger_min/max:0.8s / 8.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:95.17% / 99.05%

Stack Uptimes

  • starlord_1:13.20%
  • starlord_2:17.48%
  • starlord_3:66.69%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Umbral Embrace 22.5 3.0 13.0s 11.5s 1.9s 13.97% 0.00% 3.0 (3.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_umbral_embrace
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 50.9s
  • trigger_min/max:0.0s / 50.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.9s
  • uptime_min/max:5.77% / 24.66%

Stack Uptimes

  • umbral_embrace_1:13.97%

Spelldata

  • id:393763
  • name:Umbral Embrace
  • tooltip:Your next Wrath or Starfire cast during an Eclipse deals Astral damage and deals {$=}w1% additional damage.
  • description:{$@spelldesc393760=Dealing Astral damage has a chance to cause your next Wrath or Starfire cast during an Eclipse to become Astral and deal {$s1=25}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Wafting Devotion 4.3 1.2 61.3s 45.6s 16.5s 23.38% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 193.5s
  • trigger_min/max:0.0s / 193.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 73.6s
  • uptime_min/max:4.56% / 54.97%

Stack Uptimes

  • wafting_devotion_1:23.38%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Primordial Arcanic Pulsar 8.3 6.0 10.0 35.2s 23.5s 47.5s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.08% 0.00% 0.68% 0.0s 0.0s 1.1s
Astral Smolder 71.10% 61.19% 80.39% 4.0s 0.0s 40.0s
Incarnation (Total) 52.62% 47.42% 59.72% 19.1s 0.0s 54.0s
Incarnation (Pulsar) 32.40% 29.76% 35.68% 11.8s 0.0s 12.0s
Lunar Eclipse Only 37.70% 30.21% 43.92% 8.7s 0.0s 15.0s
No Eclipse 9.61% 5.99% 13.29% 2.4s 0.0s 5.2s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Fury of Elune5.1400.00027.81626.4045.58171.571

Eclipse Utilization

NoneSolarLunarBoth
Wrath24.37100.0%0.000.0%0.000.0%0.000.0%
Starfire2.292.1%0.000.0%42.3839.3%63.1358.6%
Starfall29.6110.0%0.000.0%110.0237.0%157.4053.0%
Fury of Elune28.553.8%0.000.0%121.5216.1%604.1080.1%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
447 T30 4p
Crashing StarAstral Power91.99459.4510.99%4.990.480.10%
Fury of EluneAstral Power81.28243.465.82%3.000.370.15%
MoonfireAstral Power3.0018.000.43%6.000.000.00%
Orbit BreakerAstral Power15.33457.0710.93%29.812.980.65%
Shooting Stars (Moonfire)Astral Power183.07365.828.75%2.000.320.09%
Shooting Stars (Sunfire)Astral Power184.92369.528.84%2.000.320.09%
StarfireAstral Power107.801996.9847.78%18.5356.222.74%
SunfireAstral Power1.006.000.14%6.000.000.00%
WrathAstral Power26.37263.676.31%10.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
447 T30 4p
StarfallAstral Power 106.984200.47100.00%39.2639.9815880.59
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 679760.0 3197.16 3707.78 2966370.2 526152.3 58767.9 679760.0
Astral Power 20.0 13.90 13.71 60.8 54.5 0.0 100.0

Statistics & Data Analysis

Fight Length
447 T30 4p Fight Length
Count 1763
Mean 300.83
Minimum 240.15
Maximum 359.95
Spread ( max - min ) 119.79
Range [ ( max - min ) / 2 * 100% ] 19.91%
Standard Deviation 35.0336
5th Percentile 246.31
95th Percentile 354.62
( 95th Percentile - 5th Percentile ) 108.30
Mean Distribution
Standard Deviation 0.8344
95.00% Confidence Interval ( 299.19 - 302.46 )
Normalized 95.00% Confidence Interval ( 99.46% - 100.54% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 521
0.1% Error 52100
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1048
DPS
447 T30 4p Damage Per Second
Count 1763
Mean 674967.55
Minimum 634157.94
Maximum 730284.24
Spread ( max - min ) 96126.30
Range [ ( max - min ) / 2 * 100% ] 7.12%
Standard Deviation 14091.2032
5th Percentile 652985.68
95th Percentile 699676.51
( 95th Percentile - 5th Percentile ) 46690.83
Mean Distribution
Standard Deviation 335.6000
95.00% Confidence Interval ( 674309.79 - 675625.32 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1675
0.1 Scale Factor Error with Delta=300 1695040
0.05 Scale Factor Error with Delta=300 6780159
0.01 Scale Factor Error with Delta=300 169503951
Priority Target DPS
447 T30 4p Priority Target Damage Per Second
Count 1763
Mean 121364.68
Minimum 109782.18
Maximum 134990.15
Spread ( max - min ) 25207.97
Range [ ( max - min ) / 2 * 100% ] 10.39%
Standard Deviation 3619.0277
5th Percentile 115639.13
95th Percentile 127548.78
( 95th Percentile - 5th Percentile ) 11909.65
Mean Distribution
Standard Deviation 86.1918
95.00% Confidence Interval ( 121195.74 - 121533.61 )
Normalized 95.00% Confidence Interval ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 35
0.1% Error 3416
0.1 Scale Factor Error with Delta=300 111807
0.05 Scale Factor Error with Delta=300 447227
0.01 Scale Factor Error with Delta=300 11180662
DPS(e)
447 T30 4p Damage Per Second (Effective)
Count 1763
Mean 674967.55
Minimum 634157.94
Maximum 730284.24
Spread ( max - min ) 96126.30
Range [ ( max - min ) / 2 * 100% ] 7.12%
Damage
447 T30 4p Damage
Count 1763
Mean 202761672.44
Minimum 161661938.28
Maximum 245487094.22
Spread ( max - min ) 83825155.94
Range [ ( max - min ) / 2 * 100% ] 20.67%
DTPS
447 T30 4p Damage Taken Per Second
Count 1763
Mean 3707.83
Minimum 1120.18
Maximum 7116.24
Spread ( max - min ) 5996.06
Range [ ( max - min ) / 2 * 100% ] 80.86%
HPS
447 T30 4p Healing Per Second
Count 1763
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
447 T30 4p Healing Per Second (Effective)
Count 1763
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
447 T30 4p Heal
Count 1763
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
447 T30 4p Healing Taken Per Second
Count 1763
Mean 3189.16
Minimum 872.71
Maximum 6231.46
Spread ( max - min ) 5358.75
Range [ ( max - min ) / 2 * 100% ] 84.02%
TMI
447 T30 4p Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
447 T30 4pTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
447 T30 4p Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.45 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.70 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.74 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.aoe
# count action,conditions
0.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
0.00 variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
I 1.00 sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
J 3.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
0.00 variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
K 13.17 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
L 71.77 starfall,if=variable.starfall_condition1
0.00 starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
0.00 celestial_alignment,if=variable.cd_condition_aoe
M 2.00 incarnation,if=variable.cd_condition_aoe
0.00 warrior_of_elune
0.00 variable,name=enter_solar,value=spell_targets.starfire<3
0.00 starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
N 24.48 wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
0.00 wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
O 5.14 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
P 33.31 starfall,if=variable.starfall_condition2
0.00 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+50
0.00 convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 new_moon,if=astral_power.deficit>variable.passive_asp+10
0.00 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
Q 107.30 starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
0.00 wrath
R 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFIJJJLMDEOPQLQLQLQLQLQQKLPQPQQQLLQLQLQLQKLPQPQQLQQLQLQNKLNPQQPQLQLQKLPQNNLOQLQLKLPQQPNNQQLQFKLPQPEQLQQLNNQLPQPQQQQLNNPQLPQQQLOQKLPPQQLQLNLNQQLPQQPQQLQNNQLLPQQQLQLQLFNNPQLMEQPQQLOQLQKLPPQQQLLQLQQKLPQPQQQLQQLQLNNLQPQLQLQQLPQPNNQQLOQKLLQLQLNNQLQFKLQPQPEQQLQLQNLNPQQPQQLQQLNDL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask 447 T30 4p 0.0/100: 0% astral_power
Pre precombat 1 food 447 T30 4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 2 augmentation 447 T30 4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 4 no_cd_talent 447 T30 4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 5 on_use_trinket 447 T30 4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 6 on_use_trinket 447 T30 4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 7 on_use_trinket 447 T30 4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 10.0/100: 10% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil 447 T30 4p 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 aoe I sunfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.943 aoe J moonfire Fluffy_Pillow 47.2/100: 47% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:01.887 aoe J moonfire enemy2 55.2/100: 55% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, corrupting_rage
0:02.833 aoe J moonfire enemy3 65.2/100: 65% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, corrupting_rage
0:03.779 aoe L starfall Fluffy_Pillow 77.2/100: 77% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, solstice, corrupting_rage
0:04.723 aoe M incarnation_chosen_of_elune Fluffy_Pillow 36.2/100: 36% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, umbral_embrace, corrupting_rage
0:04.723 default D potion Fluffy_Pillow 36.2/100: 36% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, umbral_embrace, corrupting_rage
0:04.723 default E use_items Fluffy_Pillow 36.2/100: 36% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, umbral_embrace, corrupting_rage, elemental_potion_of_ultimate_power
0:04.723 aoe O fury_of_elune Fluffy_Pillow 36.2/100: 36% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, umbral_embrace, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:05.550 aoe P starfall Fluffy_Pillow 43.2/100: 43% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall, starlord, umbral_embrace, best_friends_with_aerwynn(11), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:06.378 aoe Q starfire Fluffy_Pillow 20.2/100: 20% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), umbral_embrace, best_friends_with_aerwynn(10), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:07.571 aoe L starfall Fluffy_Pillow 83.4/100: 83% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), best_friends_with_aerwynn(9), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:08.367 aoe Q starfire Fluffy_Pillow 64.4/100: 64% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), best_friends_with_aerwynn(8), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:09.516 aoe L starfall Fluffy_Pillow 96.6/100: 97% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), best_friends_with_aerwynn(7), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
0:10.283 aoe Q starfire Fluffy_Pillow 71.6/100: 72% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), best_friends_with_aerwynn(6), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:11.433 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), starfall(4), starlord(3), best_friends_with_aerwynn(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
0:12.200 aoe Q starfire Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), starfall(4), starlord(3), umbral_embrace, best_friends_with_aerwynn(4), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:13.349 aoe L starfall Fluffy_Pillow 97.2/100: 97% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), best_friends_with_aerwynn(3), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:14.103 aoe Q starfire Fluffy_Pillow 62.2/100: 62% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), best_friends_with_aerwynn(2), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:15.168 aoe L starfall Fluffy_Pillow 85.4/100: 85% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), best_friends_with_aerwynn, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:15.922 aoe Q starfire Fluffy_Pillow 52.4/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:16.985 aoe Q starfire Fluffy_Pillow 76.6/100: 77% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:18.048 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:18.048 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:18.845 aoe P starfall Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:19.610 aoe Q starfire Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord(2), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:20.713 aoe P starfall Fluffy_Pillow 51.2/100: 51% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord(2), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:21.468 aoe Q starfire Fluffy_Pillow 16.2/100: 16% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:22.531 aoe Q starfire Fluffy_Pillow 42.4/100: 42% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:23.597 aoe Q starfire Fluffy_Pillow 61.6/100: 62% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(3), starlord(3), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:24.660 aoe L starfall Fluffy_Pillow 88.8/100: 89% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(3), starlord(3), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:25.416 aoe L starfall Fluffy_Pillow 58.8/100: 59% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(4), starlord(3), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:26.170 aoe Q starfire Fluffy_Pillow 59.8/100: 60% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(4), starlord(3), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:27.233 aoe L starfall Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:27.987 aoe Q starfire Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(4), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:29.137 aoe L starfall Fluffy_Pillow 85.2/100: 85% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:29.890 aoe Q starfire Fluffy_Pillow 61.2/100: 61% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:30.954 aoe L starfall Fluffy_Pillow 93.4/100: 93% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:31.709 aoe Q starfire Fluffy_Pillow 62.4/100: 62% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(5), starlord(3), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:32.774 aoe K cancel_buff Fluffy_Pillow 83.6/100: 84% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:32.774 aoe L starfall Fluffy_Pillow 83.6/100: 84% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:33.568 aoe P starfall Fluffy_Pillow 50.6/100: 51% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:34.335 aoe Q starfire Fluffy_Pillow 15.6/100: 16% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(5), starlord(2), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:35.437 aoe P starfall Fluffy_Pillow 36.8/100: 37% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(2), wafting_devotion, corrupting_rage
0:36.191 aoe Q starfire Fluffy_Pillow 3.8/100: 4% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(5), starlord(3), wafting_devotion, corrupting_rage
0:37.253 aoe Q starfire Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), wafting_devotion, corrupting_rage
0:38.317 aoe L starfall Fluffy_Pillow 47.2/100: 47% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), wafting_devotion, corrupting_rage
0:39.071 aoe Q starfire Fluffy_Pillow 12.2/100: 12% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), wafting_devotion, corrupting_rage
0:40.134 aoe Q starfire Fluffy_Pillow 65.4/100: 65% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), wafting_devotion, corrupting_rage
0:41.515 aoe L starfall Fluffy_Pillow 88.6/100: 89% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), wafting_devotion, corrupting_rage
0:42.437 aoe Q starfire Fluffy_Pillow 55.6/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), wafting_devotion, corrupting_rage
0:43.820 aoe L starfall Fluffy_Pillow 78.8/100: 79% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), corrupting_rage
0:44.818 aoe Q starfire Fluffy_Pillow 45.8/100: 46% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), corrupting_rage
0:46.312 aoe N wrath Fluffy_Pillow 67.0/100: 67% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), corrupting_rage
0:47.308 aoe K cancel_buff Fluffy_Pillow 82.0/100: 82% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(3), corrupting_rage
0:47.308 aoe L starfall Fluffy_Pillow 82.0/100: 82% astral_power primordial_arcanic_pulsar(45), starfall(2), corrupting_rage
0:48.536 aoe N wrath Fluffy_Pillow 41.0/100: 41% astral_power primordial_arcanic_pulsar(50), starfall(3), starlord, corrupting_rage
0:49.717 aoe P starfall Fluffy_Pillow 51.0/100: 51% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, corrupting_rage
0:50.896 aoe Q starfire Fluffy_Pillow 10.0/100: 10% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), corrupting_rage
0:52.599 aoe Q starfire Fluffy_Pillow 42.2/100: 42% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(2)
0:54.301 aoe P starfall Fluffy_Pillow 69.4/100: 69% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(2)
0:55.437 aoe Q starfire Fluffy_Pillow 31.4/100: 31% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3)
0:56.930 aoe L starfall Fluffy_Pillow 60.6/100: 61% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3)
0:57.925 aoe Q starfire Fluffy_Pillow 61.6/100: 62% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3)
0:59.418 aoe L starfall Fluffy_Pillow 89.8/100: 90% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3)
1:00.416 aoe Q starfire Fluffy_Pillow 61.8/100: 62% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3)
1:01.909 aoe K cancel_buff Fluffy_Pillow 88.0/100: 88% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3)
1:01.909 aoe L starfall Fluffy_Pillow 88.0/100: 88% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3)
1:03.025 aoe P starfall Fluffy_Pillow 55.0/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord
1:04.097 aoe Q starfire Fluffy_Pillow 22.0/100: 22% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2)
1:05.644 aoe N wrath Fluffy_Pillow 52.2/100: 52% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(2)
1:06.678 aoe N wrath Fluffy_Pillow 62.2/100: 62% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(2), corrupting_rage
1:07.815 aoe L starfall Fluffy_Pillow 74.2/100: 74% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(2), corrupting_rage
1:08.953 aoe O fury_of_elune Fluffy_Pillow 38.2/100: 38% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), corrupting_rage
1:10.048 aoe Q starfire Fluffy_Pillow 51.2/100: 51% astral_power balance_of_all_things_arcane(6), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), corrupting_rage
1:11.690 aoe L starfall Fluffy_Pillow 88.4/100: 88% astral_power balance_of_all_things_arcane(5), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall, starlord(3), corrupting_rage
1:12.786 aoe Q starfire Fluffy_Pillow 56.4/100: 56% astral_power balance_of_all_things_arcane(4), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3)
1:14.429 aoe L starfall Fluffy_Pillow 95.6/100: 96% astral_power balance_of_all_things_arcane(2), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(2), starlord(3)
1:15.525 aoe K cancel_buff Fluffy_Pillow 91.6/100: 92% astral_power balance_of_all_things_arcane, eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(35), starfall(3), starlord(3)
1:15.525 aoe L starfall Fluffy_Pillow 91.6/100: 92% astral_power balance_of_all_things_arcane, eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(35), starfall(3)
1:16.753 aoe P starfall Fluffy_Pillow 52.6/100: 53% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(40), starfall(3), starlord
1:17.934 aoe Q starfire Fluffy_Pillow 10.6/100: 11% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(4), starlord(2)
1:19.636 aoe Q starfire Fluffy_Pillow 29.8/100: 30% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(4), starlord(2)
1:21.336 aoe P starfall Fluffy_Pillow 51.0/100: 51% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(3), starlord(2)
1:22.473 aoe N wrath Fluffy_Pillow 8.0/100: 8% astral_power eclipse_lunar, primordial_arcanic_pulsar(50), starfall(3), starlord(3)
1:23.570 aoe N wrath Fluffy_Pillow 23.0/100: 23% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord(3)
1:24.666 aoe Q starfire Fluffy_Pillow 33.0/100: 33% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3)
1:26.308 aoe Q starfire Fluffy_Pillow 59.2/100: 59% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), best_friends_with_aerwynn(10)
1:27.951 aoe L starfall Fluffy_Pillow 99.4/100: 99% astral_power balance_of_all_things_arcane(5), eclipse_lunar, owlkin_frenzy, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), best_friends_with_aerwynn(9)
1:29.046 aoe Q starfire Fluffy_Pillow 58.4/100: 58% astral_power balance_of_all_things_arcane(4), eclipse_lunar, owlkin_frenzy, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), best_friends_with_aerwynn(7)
1:30.143 default F natures_vigil 447 T30 4p 84.6/100: 85% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall, starlord(3), best_friends_with_aerwynn(6)
1:30.143 aoe K cancel_buff Fluffy_Pillow 84.6/100: 85% astral_power natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall, starlord(3), best_friends_with_aerwynn(6)
1:30.143 aoe L starfall Fluffy_Pillow 84.6/100: 85% astral_power natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall, best_friends_with_aerwynn(6)
1:31.369 aoe P starfall Fluffy_Pillow 45.6/100: 46% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord, best_friends_with_aerwynn(5)
1:32.443 aoe Q starfire Fluffy_Pillow 17.6/100: 18% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), umbral_embrace, best_friends_with_aerwynn(4)
1:33.991 aoe P starfall Fluffy_Pillow 45.8/100: 46% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), best_friends_with_aerwynn(3)
1:35.025 default E use_items Fluffy_Pillow 17.8/100: 18% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), best_friends_with_aerwynn
1:35.025 aoe Q starfire Fluffy_Pillow 17.8/100: 18% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), best_friends_with_aerwynn, kindled_soul(100)
1:36.518 aoe L starfall Fluffy_Pillow 45.0/100: 45% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), kindled_soul(95)
1:37.515 aoe Q starfire Fluffy_Pillow 10.0/100: 10% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), kindled_soul(90)
1:39.008 aoe Q starfire Fluffy_Pillow 29.2/100: 29% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), kindled_soul(85)
1:40.502 aoe L starfall Fluffy_Pillow 80.4/100: 80% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), kindled_soul(75)
1:41.499 aoe N wrath Fluffy_Pillow 47.4/100: 47% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), kindled_soul(70)
1:42.494 aoe N wrath Fluffy_Pillow 57.4/100: 57% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(2), starlord(3), corrupting_rage, kindled_soul(65)
1:43.591 aoe Q starfire Fluffy_Pillow 71.4/100: 71% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), corrupting_rage, kindled_soul(60)
1:45.235 aoe L starfall Fluffy_Pillow 98.6/100: 99% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall, best_friends_with_aerwynn(10), corrupting_rage, kindled_soul(50)
1:46.463 aoe P starfall Fluffy_Pillow 67.6/100: 68% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord, best_friends_with_aerwynn(9), corrupting_rage, kindled_soul(45)
1:47.643 aoe Q starfire Fluffy_Pillow 26.6/100: 27% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(2), best_friends_with_aerwynn(8), corrupting_rage, kindled_soul(40)
1:49.345 aoe P starfall Fluffy_Pillow 49.8/100: 50% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(2), best_friends_with_aerwynn(6), corrupting_rage, kindled_soul(30)
1:50.482 aoe Q starfire Fluffy_Pillow 4.8/100: 5% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), best_friends_with_aerwynn(5), corrupting_rage, kindled_soul(25)
1:52.125 aoe Q starfire Fluffy_Pillow 24.0/100: 24% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), best_friends_with_aerwynn(3), corrupting_rage, kindled_soul(15)
1:53.767 aoe Q starfire Fluffy_Pillow 45.2/100: 45% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_aerwynn(2), corrupting_rage, kindled_soul(10)
1:55.411 aoe Q starfire Fluffy_Pillow 64.4/100: 64% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, starlord(3), corrupting_rage
1:57.054 aoe L starfall Fluffy_Pillow 90.6/100: 91% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, starlord(3), corrupting_rage
1:58.150 aoe N wrath Fluffy_Pillow 45.6/100: 46% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), corrupting_rage
1:59.247 aoe N wrath Fluffy_Pillow 57.6/100: 58% astral_power primordial_arcanic_pulsar(40), starfall, starlord(3), corrupting_rage
2:00.342 aoe P starfall Fluffy_Pillow 69.6/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(40), solstice, starfall, corrupting_rage
2:01.569 aoe Q starfire Fluffy_Pillow 28.6/100: 29% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord, corrupting_rage
2:03.338 aoe L starfall Fluffy_Pillow 64.8/100: 65% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord, corrupting_rage
2:04.520 aoe P starfall Fluffy_Pillow 55.8/100: 56% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(2), corrupting_rage
2:05.658 aoe Q starfire Fluffy_Pillow 19.8/100: 20% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), corrupting_rage
2:07.299 aoe Q starfire Fluffy_Pillow 41.0/100: 41% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(3), starlord(3), corrupting_rage
2:08.942 aoe Q starfire Fluffy_Pillow 65.2/100: 65% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), corrupting_rage
2:10.583 aoe L starfall Fluffy_Pillow 89.4/100: 89% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), corrupting_rage
2:11.679 aoe O fury_of_elune Fluffy_Pillow 48.4/100: 48% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), corrupting_rage
2:12.675 aoe Q starfire Fluffy_Pillow 57.4/100: 57% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall, starlord(3), corrupting_rage
2:14.168 aoe K cancel_buff Fluffy_Pillow 99.6/100: 100% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall, starlord(3), corrupting_rage
2:14.168 aoe L starfall Fluffy_Pillow 99.6/100: 100% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall, corrupting_rage
2:15.284 aoe P starfall Fluffy_Pillow 79.6/100: 80% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord, corrupting_rage
2:16.360 aoe P starfall Fluffy_Pillow 58.6/100: 59% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(2), corrupting_rage
2:17.394 aoe Q starfire Fluffy_Pillow 31.6/100: 32% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(4), starlord(3), corrupting_rage
2:18.888 aoe Q starfire Fluffy_Pillow 59.8/100: 60% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(3), corrupting_rage
2:20.380 aoe L starfall Fluffy_Pillow 95.0/100: 95% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), corrupting_rage
2:21.377 aoe Q starfire Fluffy_Pillow 60.0/100: 60% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), corrupting_rage
2:22.873 aoe L starfall Fluffy_Pillow 77.0/100: 77% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(3), umbral_embrace, corrupting_rage
2:23.970 aoe N wrath Fluffy_Pillow 68.0/100: 68% astral_power primordial_arcanic_pulsar(25), starfall(3), starlord(3), umbral_embrace, wafting_devotion, corrupting_rage
2:24.985 aoe L starfall Fluffy_Pillow 78.0/100: 78% astral_power primordial_arcanic_pulsar(25), starfall(2), starlord(3), umbral_embrace, wafting_devotion, corrupting_rage
2:25.999 aoe N wrath Fluffy_Pillow 35.0/100: 35% astral_power primordial_arcanic_pulsar(30), starfall(3), starlord(3), umbral_embrace, wafting_devotion, corrupting_rage
2:27.014 aoe Q starfire Fluffy_Pillow 45.0/100: 45% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), umbral_embrace, wafting_devotion, corrupting_rage
2:28.535 aoe Q starfire Fluffy_Pillow 70.2/100: 70% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), wafting_devotion, corrupting_rage
2:30.054 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), wafting_devotion, corrupting_rage
2:31.190 aoe P starfall Fluffy_Pillow 66.0/100: 66% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(2), starlord, wafting_devotion, corrupting_rage
2:32.282 aoe Q starfire Fluffy_Pillow 25.0/100: 25% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(40), solstice, starfall(3), starlord(2), wafting_devotion, corrupting_rage
2:33.857 aoe Q starfire Fluffy_Pillow 44.2/100: 44% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), wafting_devotion, corrupting_rage
2:35.433 aoe P starfall Fluffy_Pillow 65.4/100: 65% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), wafting_devotion, corrupting_rage
2:36.484 aoe Q starfire Fluffy_Pillow 27.4/100: 27% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), wafting_devotion, corrupting_rage
2:38.003 aoe Q starfire Fluffy_Pillow 46.6/100: 47% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), corrupting_rage
2:39.646 aoe L starfall Fluffy_Pillow 71.8/100: 72% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall, starlord(3), corrupting_rage
2:40.741 aoe Q starfire Fluffy_Pillow 26.8/100: 27% astral_power eclipse_lunar, primordial_arcanic_pulsar(50), starfall(2), starlord(3), corrupting_rage
2:42.382 aoe N wrath Fluffy_Pillow 38.8/100: 39% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord(3), corrupting_rage
2:43.477 aoe N wrath Fluffy_Pillow 50.8/100: 51% astral_power primordial_arcanic_pulsar(50), starfall, starlord(3), corrupting_rage
2:44.573 aoe Q starfire Fluffy_Pillow 62.8/100: 63% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), corrupting_rage
2:46.215 aoe L starfall Fluffy_Pillow 97.0/100: 97% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, corrupting_rage
2:47.443 aoe L starfall Fluffy_Pillow 89.0/100: 89% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord, corrupting_rage
2:48.624 aoe P starfall Fluffy_Pillow 51.0/100: 51% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(2), corrupting_rage
2:49.655 aoe Q starfire Fluffy_Pillow 25.0/100: 25% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), corrupting_rage
2:51.148 aoe Q starfire Fluffy_Pillow 54.2/100: 54% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), corrupting_rage
2:52.641 aoe Q starfire Fluffy_Pillow 81.4/100: 81% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage
2:54.135 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(3), starlord(3), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage
2:55.129 aoe Q starfire Fluffy_Pillow 67.0/100: 67% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage
2:56.621 aoe L starfall Fluffy_Pillow 88.2/100: 88% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage
2:57.617 aoe Q starfire Fluffy_Pillow 55.2/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage
2:59.110 aoe L starfall Fluffy_Pillow 76.4/100: 76% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage
3:00.107 default F natures_vigil 447 T30 4p 43.4/100: 43% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(3), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage
3:00.143 aoe N wrath Fluffy_Pillow 43.4/100: 43% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(3), starlord(3), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage
3:01.239 aoe N wrath Fluffy_Pillow 55.4/100: 55% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(3), best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage
3:02.467 aoe P starfall Fluffy_Pillow 67.4/100: 67% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage
3:03.694 aoe Q starfire Fluffy_Pillow 26.4/100: 26% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord, best_friends_with_urctos_static, corrupting_rage
3:05.461 aoe L starfall Fluffy_Pillow 55.6/100: 56% astral_power natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:06.552 aoe M incarnation_chosen_of_elune Fluffy_Pillow 14.6/100: 15% astral_power natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:06.552 default E use_items Fluffy_Pillow 14.6/100: 15% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:06.552 aoe Q starfire Fluffy_Pillow 14.6/100: 15% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(100)
3:07.983 aoe P starfall Fluffy_Pillow 70.8/100: 71% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(95)
3:08.938 aoe Q starfire Fluffy_Pillow 39.8/100: 40% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(90)
3:10.319 aoe Q starfire Fluffy_Pillow 67.0/100: 67% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(85)
3:11.702 aoe L starfall Fluffy_Pillow 90.2/100: 90% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(75)
3:12.624 aoe O fury_of_elune Fluffy_Pillow 59.2/100: 59% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(70)
3:13.546 aoe Q starfire Fluffy_Pillow 62.2/100: 62% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(40), starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(70)
3:14.928 aoe L starfall Fluffy_Pillow 97.4/100: 97% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(40), starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(60)
3:15.851 aoe Q starfire Fluffy_Pillow 68.4/100: 68% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), starfall(3), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(55)
3:17.234 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(50)
3:17.234 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), starfall(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(50)
3:18.267 aoe P starfall Fluffy_Pillow 71.0/100: 71% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(3), starlord, best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(45)
3:19.261 aoe P starfall Fluffy_Pillow 46.0/100: 46% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(4), starlord(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(40)
3:20.219 aoe Q starfire Fluffy_Pillow 21.0/100: 21% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(4), starlord(3), umbral_embrace, best_friends_with_urctos_static, corrupting_rage, kindled_soul(35)
3:21.713 aoe Q starfire Fluffy_Pillow 54.2/100: 54% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(4), starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(25)
3:23.205 aoe Q starfire Fluffy_Pillow 82.4/100: 82% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(20)
3:24.698 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(10)
3:25.620 aoe L starfall Fluffy_Pillow 69.0/100: 69% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(3), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(5)
3:26.542 aoe Q starfire Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(5)
3:27.924 aoe L starfall Fluffy_Pillow 53.2/100: 53% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
3:28.847 aoe Q starfire Fluffy_Pillow 50.2/100: 50% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
3:30.228 aoe Q starfire Fluffy_Pillow 69.4/100: 69% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
3:31.609 aoe K cancel_buff Fluffy_Pillow 93.6/100: 94% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
3:31.609 aoe L starfall Fluffy_Pillow 93.6/100: 94% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
3:32.641 aoe P starfall Fluffy_Pillow 60.6/100: 61% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
3:33.634 aoe Q starfire Fluffy_Pillow 27.6/100: 28% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(2), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
3:35.069 aoe P starfall Fluffy_Pillow 50.8/100: 51% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(3), starlord(2), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
3:36.025 aoe Q starfire Fluffy_Pillow 15.8/100: 16% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
3:37.408 aoe Q starfire Fluffy_Pillow 39.0/100: 39% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
3:38.791 aoe Q starfire Fluffy_Pillow 60.2/100: 60% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
3:40.174 aoe L starfall Fluffy_Pillow 83.4/100: 83% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
3:41.171 aoe Q starfire Fluffy_Pillow 48.4/100: 48% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
3:42.663 aoe Q starfire Fluffy_Pillow 69.6/100: 70% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
3:44.155 aoe L starfall Fluffy_Pillow 95.8/100: 96% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall, starlord(3), best_friends_with_aerwynn_static, corrupting_rage
3:45.151 aoe Q starfire Fluffy_Pillow 60.8/100: 61% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
3:46.645 aoe L starfall Fluffy_Pillow 80.0/100: 80% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), best_friends_with_aerwynn_static, corrupting_rage
3:47.762 aoe N wrath Fluffy_Pillow 49.0/100: 49% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord, best_friends_with_aerwynn_static, corrupting_rage
3:48.837 aoe N wrath Fluffy_Pillow 61.0/100: 61% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord, best_friends_with_aerwynn_static, corrupting_rage
3:50.017 aoe L starfall Fluffy_Pillow 73.0/100: 73% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord, best_friends_with_aerwynn_static, corrupting_rage
3:51.197 aoe Q starfire Fluffy_Pillow 32.0/100: 32% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(2), best_friends_with_aerwynn_static
3:52.899 aoe P starfall Fluffy_Pillow 70.2/100: 70% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), best_friends_with_aerwynn_static
3:54.036 aoe Q starfire Fluffy_Pillow 32.2/100: 32% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static
3:55.680 aoe L starfall Fluffy_Pillow 61.4/100: 61% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static
3:56.777 aoe Q starfire Fluffy_Pillow 50.4/100: 50% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static
3:58.270 aoe L starfall Fluffy_Pillow 83.6/100: 84% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static
3:59.266 aoe Q starfire Fluffy_Pillow 52.6/100: 53% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static
4:00.759 aoe Q starfire Fluffy_Pillow 78.8/100: 79% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static
4:02.252 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), best_friends_with_aerwynn_static
4:03.369 aoe P starfall Fluffy_Pillow 67.0/100: 67% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord, best_friends_with_aerwynn_static
4:04.440 aoe Q starfire Fluffy_Pillow 32.0/100: 32% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(2), best_friends_with_aerwynn_static
4:05.988 aoe P starfall Fluffy_Pillow 51.2/100: 51% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(2), best_friends_with_aerwynn_static
4:07.021 aoe N wrath Fluffy_Pillow 18.2/100: 18% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
4:08.018 aoe N wrath Fluffy_Pillow 28.2/100: 28% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
4:09.116 aoe Q starfire Fluffy_Pillow 40.2/100: 40% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
4:10.758 aoe Q starfire Fluffy_Pillow 67.4/100: 67% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
4:12.400 aoe L starfall Fluffy_Pillow 93.6/100: 94% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall, starlord(3), best_friends_with_aerwynn_static, corrupting_rage
4:13.496 aoe O fury_of_elune Fluffy_Pillow 52.6/100: 53% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
4:14.591 aoe Q starfire Fluffy_Pillow 65.6/100: 66% astral_power balance_of_all_things_arcane(3), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall, starlord(3), best_friends_with_aerwynn_static, corrupting_rage
4:16.236 aoe K cancel_buff Fluffy_Pillow 99.8/100: 100% astral_power balance_of_all_things_arcane, eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), starfall, starlord(3), best_friends_with_aerwynn_static, corrupting_rage
4:16.236 aoe L starfall Fluffy_Pillow 99.8/100: 100% astral_power balance_of_all_things_arcane, eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), starfall, best_friends_with_aerwynn_static, corrupting_rage
4:17.463 aoe L starfall Fluffy_Pillow 62.8/100: 63% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(2), starlord, best_friends_with_aerwynn_static, corrupting_rage
4:18.643 aoe Q starfire Fluffy_Pillow 26.8/100: 27% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(35), starfall(3), starlord(2), best_friends_with_aerwynn_static, corrupting_rage
4:20.348 aoe L starfall Fluffy_Pillow 92.0/100: 92% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(35), starfall(3), starlord(2), best_friends_with_aerwynn_static, corrupting_rage
4:21.484 aoe Q starfire Fluffy_Pillow 57.0/100: 57% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(40), starfall(3), starlord(3), umbral_embrace, best_friends_with_aerwynn_static, corrupting_rage
4:23.127 aoe L starfall Fluffy_Pillow 79.2/100: 79% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
4:24.225 aoe N wrath Fluffy_Pillow 34.2/100: 34% astral_power primordial_arcanic_pulsar(45), starfall(4), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
4:25.321 aoe N wrath Fluffy_Pillow 44.2/100: 44% astral_power primordial_arcanic_pulsar(45), starfall(3), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
4:26.417 aoe Q starfire Fluffy_Pillow 58.2/100: 58% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
4:28.060 aoe L starfall Fluffy_Pillow 89.4/100: 89% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
4:29.156 aoe Q starfire Fluffy_Pillow 55.4/100: 55% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
4:30.798 default F natures_vigil 447 T30 4p 78.6/100: 79% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
4:30.798 aoe K cancel_buff Fluffy_Pillow 78.6/100: 79% astral_power natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
4:30.798 aoe L starfall Fluffy_Pillow 78.6/100: 79% astral_power natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), best_friends_with_aerwynn_static, corrupting_rage
4:32.024 aoe Q starfire Fluffy_Pillow 37.6/100: 38% astral_power natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord, best_friends_with_aerwynn_static, corrupting_rage
4:33.793 aoe P starfall Fluffy_Pillow 60.8/100: 61% astral_power natures_vigil, balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord, best_friends_with_aerwynn_static, corrupting_rage
4:34.973 aoe Q starfire Fluffy_Pillow 22.8/100: 23% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(2), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, corrupting_rage
4:36.523 aoe P starfall Fluffy_Pillow 46.0/100: 46% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(2), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage
4:37.557 default E use_items Fluffy_Pillow 15.0/100: 15% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, corrupting_rage
4:37.557 aoe Q starfire Fluffy_Pillow 15.0/100: 15% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(100)
4:39.050 aoe Q starfire Fluffy_Pillow 72.2/100: 72% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(95)
4:40.544 aoe L starfall Fluffy_Pillow 98.4/100: 98% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(90)
4:41.542 aoe Q starfire Fluffy_Pillow 63.4/100: 63% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(85)
4:43.036 aoe L starfall Fluffy_Pillow 84.6/100: 85% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(75)
4:44.031 aoe Q starfire Fluffy_Pillow 51.6/100: 52% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(70)
4:45.526 aoe N wrath Fluffy_Pillow 70.8/100: 71% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(65)
4:46.522 aoe L starfall Fluffy_Pillow 80.8/100: 81% astral_power primordial_arcanic_pulsar(15), starfall(2), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(60)
4:47.749 aoe N wrath Fluffy_Pillow 35.8/100: 36% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord, best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(50)
4:48.929 aoe P starfall Fluffy_Pillow 45.8/100: 46% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord, best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(45)
4:50.111 aoe Q starfire Fluffy_Pillow 6.8/100: 7% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(2), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(40)
4:51.814 aoe Q starfire Fluffy_Pillow 41.0/100: 41% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(2), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(30)
4:53.516 aoe P starfall Fluffy_Pillow 64.2/100: 64% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(2), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(25)
4:54.653 aoe Q starfire Fluffy_Pillow 25.2/100: 25% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(15)
4:56.296 aoe Q starfire Fluffy_Pillow 52.4/100: 52% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(10)
4:57.938 aoe L starfall Fluffy_Pillow 73.6/100: 74% astral_power eclipse_lunar, primordial_arcanic_pulsar(30), starfall, starlord(3), best_friends_with_aerwynn_static, corrupting_rage
4:59.034 aoe Q starfire Fluffy_Pillow 33.6/100: 34% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
5:00.676 aoe Q starfire Fluffy_Pillow 54.8/100: 55% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, corrupting_rage
5:02.319 aoe L starfall Fluffy_Pillow 76.0/100: 76% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage
5:03.547 aoe N wrath Fluffy_Pillow 33.0/100: 33% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord, best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage
5:04.728 default D potion Fluffy_Pillow 80.0/100: 80% astral_power primordial_arcanic_pulsar(40), starfall(2), starlord, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, corrupting_rage
5:04.728 aoe L starfall Fluffy_Pillow 80.0/100: 80% astral_power primordial_arcanic_pulsar(40), starfall(2), starlord, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (tauren) Raid-Buffed Unbuffed Gear Amount
Strength 898 2 986 900 0
Agility 2089 -2 2173 2087 0
Stamina 3848 2 33988 32369 28452
Intellect 2089 -2 13166 12370 9694 (5819)
Spirit 0 0 0 0 0
Health 679760 679760 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13166 12370 0
Crit 26.84% 20.63% 2813
Haste 22.62% 22.62% 3846
Versatility 6.13% 1.13% 232
Mana Regen 2560 2560 0
Attack Power 13693 12865 0
Mastery 28.85% 28.85% 7443
Armor 4288 4288 4288
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 464.00
Local Head Benevolent Embersage's Casque
ilevel: 470, stats: { 585 Armor, +3163 Sta, +655 Crit, +307 Haste, +786 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }, enchant: incandescent_essence
Local Neck Eye of the Rising Flame
ilevel: 470, stats: { +1779 Sta, +233 Haste, +1397 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Life-Bound Shoulderpads
ilevel: 447, stats: { 456 Armor, +1796 Sta, +328 Mastery, +328 Haste, +476 AgiInt }
item effects: { equip: Toxified }
Local Chest Benevolent Embersage's Robe
ilevel: 447, stats: { 664 Armor, +2395 Sta, +605 Crit, +269 Mastery, +635 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 470, stats: { 439 Armor, +2372 Sta, +497 Haste, +224 Mastery, +590 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 447, stats: { 581 Armor, +2395 Sta, +596 Haste, +278 Mastery, +635 AgiInt }, enchant: { +155 StrAgiInt, +41 Vers (lambent_armor_kit_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 470, stats: { 488 Armor, +2372 Sta, +257 Crit, +412 Haste, +590 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Thermal Bindings
ilevel: 470, stats: { 390 Armor, +1779 Sta, +178 Crit, +363 Mastery, +442 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Benevolent Embersage's Talons
ilevel: 447, stats: { 373 Armor, +1796 Sta, +191 Vers, +464 Mastery, +476 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 470, stats: { +1779 Sta, +466 Haste, +1165 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 470, stats: { +1779 Sta, +1118 Crit, +512 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 470, stats: { +747 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 470, stats: { +687 Mastery }
item effects: { use: Balefire Branch }
Local Back Drape of the Loyal Vassal
ilevel: 470, stats: { 312 Armor, +1779 Sta, +305 Haste, +236 Mastery, +442 StrAgiInt }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 470, weapon: { 508 - 654, 2.6 }, stats: { +393 Int, +1896 Int, +1581 Sta, +145 Haste, +335 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 470, stats: { +1206 Int, +1581 Sta, +162 Haste, +319 Mastery }

Profile

druid="447 T30 4p"
source=default
spec=balance
level=70
race=tauren
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:hissing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Balance APL can be found at https://balance-simc.github.io/Balance-SimC/balance.txt

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=470,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=470,gem_id=192961/192961/192961
shoulders=lifebound_shoulderpads,id=193406,bonus_id=8836/1576/8797/8960,ilevel=447,crafted_stats=49/36
back=drape_of_the_loyal_vassal,id=158375,bonus_id=4795,ilevel=470
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=447,enchant_id=6625
wrists=thermal_bindings,id=134461,bonus_id=4795,ilevel=470,gem_id=192961
hands=benevolent_embersages_talons,id=207255,bonus_id=4795,ilevel=447
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=447,enchant_id=6830
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=470
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=470
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=470
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=470,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=470

# Gear Summary
# gear_ilvl=464.25
# gear_stamina=28452
# gear_intellect=9694
# gear_crit_rating=2813
# gear_haste_rating=3846
# gear_mastery_rating=7443
# gear_versatility_rating=232
# gear_armor=4288
# set_bonus=tier30_2pc=1
# set_bonus=tier30_4pc=1

447+460 2p+2p : 714050 dps, 130192 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
714050.3 714050.3 705.8 / 0.099% 63669.2 / 8.9% 52632.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.5 13.7 Astral Power 0.00% 55.6 99.9% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
447+460 2p+2p 714050
Astral Smolder 97393 13.6% 370.4 0.87s 78726 0 Periodic 732.2 39822 0 39822 0.0% 81.3%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 370.41 0.00 732.24 732.24 282.06 0.0000 2.0000 29160996.45 29160996.45 0.00% 19912.16 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 732.24 563 908 39822.38 3369 187497 39875.72 35107 45368 29160996 29160996 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Fury of Elune 19950 2.8% 5.1 64.37s 1162523 1184121 Direct 753.3 4980 10827 7929 50.4%

Stats Details: Fury Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.14 753.30 0.00 0.00 0.00 0.9818 0.0000 5971524.25 5971524.25 0.00% 1184121.41 1184121.41
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.56% 373.36 239 503 4980.08 2684 15922 4988.77 4402 5817 1858959 1858959 0.00%
crit 50.44% 379.94 258 528 10826.99 5475 32480 10830.98 9868 12267 4112566 4112566 0.00%

Action Details: Fury Of Elune

  • id:202770
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:astral_power
  • energize_amount:3.0

Spelldata

  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r

Action Details: Fury Of Elune Tick

  • id:211545
  • school:astral
  • range:105.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.149000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:211545
  • name:Fury of Elune
  • school:astral
  • tooltip:
  • description:{$@spelldesc202770=Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r}

Action Priority List

    aoe
    [P]:5.14
  • if_expr:target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Hungering Shadowflame 2880 0.4% 16.9 17.49s 51147 0 Direct 16.9 40158 80776 51111 27.0%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.91 16.91 0.00 0.00 0.00 0.0000 0.0000 864716.60 864716.60 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.05% 12.35 4 26 40157.50 26959 154597 40010.30 26959 99949 496585 496585 0.00%
crit 26.95% 4.56 0 13 80776.01 54997 315378 80142.37 0 278345 368131 368131 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy3
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24191.79
  • base_dd_max:24191.79
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 5546 0.8% 33.7 8.58s 49321 0 Direct 33.6 38614 78737 49454 27.0%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.71 33.62 0.00 0.00 0.00 0.0000 0.0000 1662403.14 1662403.14 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.99% 24.54 11 43 38614.35 38162 43768 38613.12 38162 40152 947444 947444 0.00%
crit 27.01% 9.08 0 19 78736.77 77851 89287 78701.17 0 84521 714959 714959 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:34245.43
  • base_dd_max:34245.43
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 70781 9.9% 3.0 1.11s 7071594 7560507 Direct 6.0 6973 14218 10479 48.4%
Periodic 1793.6 8233 17049 11795 40.4% 99.0%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.00 6.00 1793.56 1793.56 0.00 0.9355 0.9950 21214783.18 21214783.18 0.00% 11868.51 7560507.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 51.62% 3.10 0 6 6973.35 6907 7921 6874.83 0 7921 21599 21599 0.00%
crit 48.38% 2.90 0 6 14217.65 14090 16159 13940.98 0 16159 41270 41270 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 59.61% 1069.15 810 1320 8233.27 6629 13363 8232.13 8030 8457 8802171 8802171 0.00%
crit 40.39% 724.41 540 915 17049.18 13524 27261 17048.66 16574 17590 12349744 12349744 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.39

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.39
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    aoe
    [J]:3.00
  • if_expr:!fight_style.dungeonroute
  • target_if_expr:refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (65215) 0.0% (9.1%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 17581 2.5% 231.2 1.50s 22791 0 Direct 230.6 14503 31184 22850 50.0%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 231.15 230.58 0.00 0.00 0.00 0.0000 0.0000 5268081.04 5268081.04 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.96% 115.20 70 164 14503.13 10854 26287 14504.99 13712 15627 1670612 1670612 0.00%
crit 50.04% 115.38 77 157 31183.78 22142 53625 31195.11 29413 33119 3597469 3597469 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 17719 2.5% 233.5 1.49s 22738 0 Direct 232.9 14466 31095 22800 50.1%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 233.48 232.88 0.00 0.00 0.00 0.0000 0.0000 5308856.47 5308856.47 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.90% 116.22 71 165 14465.77 9838 26287 14467.22 13545 15333 1681064 1681064 0.00%
crit 50.10% 116.67 79 161 31095.47 20069 53625 31107.16 29460 32849 3627793 3627793 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 29915 4.2% 15.5 19.55s 579471 0 Direct 92.6 61392 132389 96847 49.9%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.47 92.61 0.00 0.00 0.00 0.0000 0.0000 8966206.95 8966206.95 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 50.07% 46.37 23 71 61392.45 33795 221195 61436.78 49727 74473 2846780 2846780 0.00%
crit 49.93% 46.24 26 71 132389.13 68942 451238 132353.07 102258 163124 6119427 6119427 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:enemy4
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfall 223167 31.2% 103.1 2.89s 648227 630491 Direct 1769.0 24991 54230 37788 43.8%

Stats Details: Starfall

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 103.11 1768.99 0.00 0.00 0.00 1.0281 0.0000 66838385.82 66838385.82 0.00% 630491.33 630491.33
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.23% 994.75 732 1254 24991.47 6127 88376 25032.41 23010 27294 24856023 24856023 0.00%
crit 43.77% 774.24 576 986 54230.16 12500 179996 54309.17 49668 59759 41982363 41982363 0.00%

Action Details: Starfall

  • id:191034
  • school:astral
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:45.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]

Action Details: Starfall Damage

  • id:191037
  • school:astral
  • range:200.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.114000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.41

Spelldata

  • id:191037
  • name:Starfall
  • school:astral
  • tooltip:
  • description:{$@spelldesc191034=Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]}

Action Priority List

    aoe
    [L]:68.85
  • if_expr:variable.starfall_condition1
    aoe
    [Q]:34.26
  • if_expr:variable.starfall_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountLunar Shrapnel4151691PCT0.200
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 160262 22.4% 116.2 2.54s 413115 291483 Direct 703.4 42710 92590 68268 51.2%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 116.23 703.36 0.00 0.00 0.00 1.4173 0.0000 48015062.95 48015062.95 0.00% 291482.65 291482.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.76% 342.97 243 449 42710.25 6194 194756 42705.70 36814 47687 14646378 14646378 0.00%
crit 51.24% 360.39 268 456 92589.88 12635 397303 92604.08 83877 102736 33368685 33368685 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    aoe
    [M]:1.37
  • if_expr:buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
    aoe
    [R]:115.41
  • if_expr:spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Solar)4851710.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Sunfire16481550.283Mastery
Sunfire 60164 8.4% 1.0 0.00s 18022102 19111455 Direct 1.0 5492 11202 6964 25.8%
Periodic 1806.4 7058 15025 9974 36.6% 99.7%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 1806.42 1806.42 0.00 0.9435 0.9947 18022102.40 18022102.40 0.00% 10024.65 19111455.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 74.16% 0.74 0 1 5492.02 5460 5527 4073.17 0 5527 4073 4073 0.00%
crit 25.84% 0.26 0 1 11202.01 11138 11274 2894.07 0 11274 2894 2894 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 63.40% 1145.35 876 1453 7057.90 5479 12148 7059.16 6870 7282 8083197 8083197 0.00%
crit 36.60% 661.06 498 867 15025.09 11177 24783 15029.56 14575 15714 9931938 9931938 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.26
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    aoe
    [I]:1.00
  • target_if_expr:refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (5282) 0.0% (0.7%) 8.3 32.88s 191914 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.26 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 2760 0.4% 8.3 32.88s 100280 0 Direct 49.5 13007 26503 16713 27.5%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.26 49.54 0.00 0.00 0.00 0.0000 0.0000 828052.16 828052.16 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.53% 35.94 9 85 13007.47 12846 14733 13004.53 12846 13744 467401 467401 0.00%
crit 27.47% 13.61 1 37 26502.81 26205 30055 26502.11 26205 28956 360651 360651 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:39522.22
  • base_dd_max:39522.22
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 2522 0.4% 15.9 15.99s 47600 0 Direct 95.4 6187 12612 7934 27.2%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.90 95.38 0.00 0.00 0.00 0.0000 0.0000 756657.87 756657.87 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.82% 69.46 15 151 6187.50 6112 7010 6186.68 6112 6598 429732 429732 0.00%
crit 27.18% 25.92 2 67 12612.46 12469 14301 12613.73 12469 13559 326926 326926 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18805.57
  • base_dd_max:18805.57
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 3411 0.5% 25.9 10.58s 39636 51204 Direct 25.8 28313 57919 39852 39.0%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.92 25.78 0.00 0.00 0.00 0.7741 0.0000 1027358.94 1027358.94 0.00% 51204.09 51204.09
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.02% 15.73 6 26 28312.74 12615 53196 28271.45 20303 35894 445353 445353 0.00%
crit 38.98% 10.05 2 21 57918.61 25734 109633 57815.26 34354 74379 582006 582006 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    aoe
    [O]:23.99
  • if_expr:!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.800Spell Data
Eclipse (Solar)4851710.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Lunar)4851810.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
447+460 2p+2p
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+460 2p+2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+460 2p+2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+460 2p+2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 181.08s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    aoe
    [N]:2.00
  • if_expr:variable.cd_condition_aoe

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.2 98.50s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.20 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+460 2p+2p
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:57075.72
  • base_dd_max:57075.72
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.47s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+460 2p+2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.75
Elemental Potion of Ultimate Power 1.4 304.53s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.45 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.44
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 17.7 5.3 17.5s 13.7s 9.5s 55.63% 57.39% 5.3 (17.0) 17.1

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 42.8s
  • trigger_min/max:0.0s / 35.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:51.43% / 58.89%

Stack Uptimes

  • balance_of_all_things_arcane_1:5.82%
  • balance_of_all_things_arcane_2:6.21%
  • balance_of_all_things_arcane_3:6.66%
  • balance_of_all_things_arcane_4:7.03%
  • balance_of_all_things_arcane_5:7.28%
  • balance_of_all_things_arcane_6:7.46%
  • balance_of_all_things_arcane_7:7.56%
  • balance_of_all_things_arcane_8:7.62%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 10.1 0.0 30.1s 30.1s 7.9s 26.77% 29.72% 0.0 (0.0) 9.9

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.2s / 47.5s
  • trigger_min/max:7.0s / 47.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.6s
  • uptime_min/max:24.59% / 29.87%

Stack Uptimes

  • balance_of_all_things_nature_1:3.32%
  • balance_of_all_things_nature_2:3.33%
  • balance_of_all_things_nature_3:3.33%
  • balance_of_all_things_nature_4:3.34%
  • balance_of_all_things_nature_5:3.35%
  • balance_of_all_things_nature_6:3.36%
  • balance_of_all_things_nature_7:3.37%
  • balance_of_all_things_nature_8:3.38%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Best Friends with Aerwynn 2.8 0.0 69.4s 69.4s 10.8s 10.06% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 356.6s
  • trigger_min/max:12.0s / 356.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 31.12%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.90%
  • best_friends_with_aerwynn_2:0.90%
  • best_friends_with_aerwynn_3:0.90%
  • best_friends_with_aerwynn_4:0.91%
  • best_friends_with_aerwynn_5:0.91%
  • best_friends_with_aerwynn_6:0.91%
  • best_friends_with_aerwynn_7:0.92%
  • best_friends_with_aerwynn_8:0.92%
  • best_friends_with_aerwynn_9:0.92%
  • best_friends_with_aerwynn_10:0.93%
  • best_friends_with_aerwynn_11:0.93%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 1.0 115.3s 69.4s 45.3s 32.80% 0.00% 68.1 (68.1) 0.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 357.1s
  • trigger_min/max:12.0s / 356.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 353.3s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:32.80%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.4s 70.4s 10.8s 10.01% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 314.7s
  • trigger_min/max:12.0s / 314.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 11.0s
  • uptime_min/max:0.00% / 31.16%

Stack Uptimes

  • best_friends_with_pip_1:0.89%
  • best_friends_with_pip_2:0.90%
  • best_friends_with_pip_3:0.90%
  • best_friends_with_pip_4:0.90%
  • best_friends_with_pip_5:0.91%
  • best_friends_with_pip_6:0.91%
  • best_friends_with_pip_7:0.91%
  • best_friends_with_pip_8:0.92%
  • best_friends_with_pip_9:0.92%
  • best_friends_with_pip_10:0.92%
  • best_friends_with_pip_11:0.92%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 114.7s 70.4s 45.8s 33.24% 0.00% 69.1 (69.1) 0.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:14.5s / 337.0s
  • trigger_min/max:12.0s / 314.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 322.8s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.24%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 69.0s 69.0s 10.8s 10.22% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 300.4s
  • trigger_min/max:12.0s / 300.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 32.98%

Stack Uptimes

  • best_friends_with_urctos_1:0.91%
  • best_friends_with_urctos_2:0.92%
  • best_friends_with_urctos_3:0.92%
  • best_friends_with_urctos_4:0.92%
  • best_friends_with_urctos_5:0.93%
  • best_friends_with_urctos_6:0.93%
  • best_friends_with_urctos_7:0.93%
  • best_friends_with_urctos_8:0.94%
  • best_friends_with_urctos_9:0.94%
  • best_friends_with_urctos_10:0.94%
  • best_friends_with_urctos_11:0.94%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 1.0 115.9s 69.0s 46.6s 33.96% 0.00% 69.7 (69.7) 0.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:14.4s / 355.1s
  • trigger_min/max:12.0s / 300.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 264.6s
  • uptime_min/max:0.00% / 95.33%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.96%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.51% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.66%

Stack Uptimes

  • bloodlust_1:13.51%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.8 0.0 63.5s 59.8s 51.2s 80.54% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 333.0s
  • trigger_min/max:15.0s / 314.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 333.1s
  • uptime_min/max:52.56% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.54%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dreamstate 15.0 0.2 20.8s 21.5s 2.2s 10.88% 20.44% 0.2 (0.4) 0.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.6s / 54.0s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.3s
  • uptime_min/max:7.37% / 16.18%

Stack Uptimes

  • dreamstate_1:7.28%
  • dreamstate_2:3.60%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 13.1 7.9 24.0s 15.1s 21.3s 92.98% 93.65% 7.9 (7.9) 12.2

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.7s / 66.1s
  • trigger_min/max:0.0s / 56.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 65.0s
  • uptime_min/max:90.23% / 95.83%

Stack Uptimes

  • eclipse_lunar_1:92.98%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 8.1 0.0 38.6s 38.6s 19.2s 52.11% 54.01% 0.0 (0.0) 7.8

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 83.7s
  • trigger_min/max:12.0s / 83.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.90% / 59.41%

Stack Uptimes

  • eclipse_solar_1:52.11%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 305.7s 305.7s 27.3s 12.92% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 325.6s
  • trigger_min/max:300.0s / 325.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 30.0s
  • uptime_min/max:9.75% / 17.87%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.92%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Fury of Elune 5.1 0.0 64.4s 64.4s 7.9s 13.53% 0.00% 76.1 (76.1) 5.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:60.0s / 87.9s
  • trigger_min/max:60.0s / 87.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:11.43% / 15.46%

Stack Uptimes

  • fury_of_elune_1:13.53%

Spelldata

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 8.1 0.0 38.6s 38.6s 19.2s 52.11% 54.73% 0.0 (0.0) 7.8

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 83.7s
  • trigger_min/max:12.0s / 83.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.90% / 59.41%

Stack Uptimes

  • incarnation_chosen_of_elune_1:52.11%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.7 0.0 91.0s 91.0s 19.6s 24.03% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:55.09

Trigger Details

  • interval_min/max:90.0s / 101.1s
  • trigger_min/max:90.0s / 101.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:21.27% / 26.90%

Stack Uptimes

  • kindled_soul_5:1.17%
  • kindled_soul_10:1.18%
  • kindled_soul_15:1.18%
  • kindled_soul_20:1.18%
  • kindled_soul_25:1.19%
  • kindled_soul_30:1.19%
  • kindled_soul_35:1.19%
  • kindled_soul_40:1.19%
  • kindled_soul_45:1.20%
  • kindled_soul_50:1.20%
  • kindled_soul_55:1.20%
  • kindled_soul_60:1.21%
  • kindled_soul_65:1.21%
  • kindled_soul_70:1.21%
  • kindled_soul_75:1.21%
  • kindled_soul_80:1.22%
  • kindled_soul_85:1.22%
  • kindled_soul_90:1.22%
  • kindled_soul_95:1.22%
  • kindled_soul_100:1.23%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Vigil 3.7 0.0 90.4s 90.4s 14.8s 18.41% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.6s
  • trigger_min/max:90.0s / 91.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.53% / 21.01%

Stack Uptimes

  • natures_vigil_1:18.41%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.0 68.0s 67.4s 0.9s 0.76% 1.18% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 325.1s
  • trigger_min/max:0.1s / 325.1s
  • trigger_pct:14.94%
  • duration_min/max:0.0s / 5.8s
  • uptime_min/max:0.00% / 4.36%

Stack Uptimes

  • owlkin_frenzy_1:0.76%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 9.0 95.0 34.5s 34.5s 30.4s 91.27% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:21.9s / 46.3s
  • trigger_min/max:21.9s / 46.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.0s
  • uptime_min/max:87.83% / 94.67%

Stack Uptimes

  • primordial_arcanic_pulsar_5:7.16%
  • primordial_arcanic_pulsar_10:6.74%
  • primordial_arcanic_pulsar_15:7.82%
  • primordial_arcanic_pulsar_20:8.24%
  • primordial_arcanic_pulsar_25:8.47%
  • primordial_arcanic_pulsar_30:8.17%
  • primordial_arcanic_pulsar_35:8.70%
  • primordial_arcanic_pulsar_40:9.19%
  • primordial_arcanic_pulsar_45:8.99%
  • primordial_arcanic_pulsar_50:8.89%
  • primordial_arcanic_pulsar_55:8.91%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 19.8 3.1 15.5s 13.7s 6.6s 43.60% 42.80% 3.1 (3.1) 19.4

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 35.3s
  • trigger_min/max:0.0s / 35.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:40.04% / 46.70%

Stack Uptimes

  • solstice_1:43.60%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starfall 103.1 0.0 143.1s 2.9s 295.8s 98.86% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_starfall
  • max_stacks:20
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:asynchronous
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.9s / 356.9s
  • trigger_min/max:0.7s / 8.5s
  • trigger_pct:99.99%
  • duration_min/max:38.1s / 358.0s
  • uptime_min/max:98.41% / 99.48%

Stack Uptimes

  • starfall_1:5.66%
  • starfall_2:34.02%
  • starfall_3:41.86%
  • starfall_4:14.05%
  • starfall_5:2.97%
  • starfall_6:0.30%
  • starfall_7:0.00%

Spelldata

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]
  • max_stacks:20
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Starlord 21.0 82.2 14.5s 2.9s 14.0s 97.48% 0.00% 40.9 (40.9) 5.9

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 19.1s
  • trigger_min/max:0.8s / 8.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:95.00% / 99.20%

Stack Uptimes

  • starlord_1:12.86%
  • starlord_2:18.07%
  • starlord_3:66.55%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Umbral Embrace 22.7 2.6 12.9s 11.5s 1.6s 12.37% 0.00% 2.6 (2.6) 0.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_umbral_embrace
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 52.1s
  • trigger_min/max:0.0s / 51.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.2s
  • uptime_min/max:4.20% / 22.41%

Stack Uptimes

  • umbral_embrace_1:12.37%

Spelldata

  • id:393763
  • name:Umbral Embrace
  • tooltip:Your next Wrath or Starfire cast during an Eclipse deals Astral damage and deals {$=}w1% additional damage.
  • description:{$@spelldesc393760=Dealing Astral damage has a chance to cause your next Wrath or Starfire cast during an Eclipse to become Astral and deal {$s1=25}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Wafting Devotion 4.3 1.1 61.5s 46.1s 16.4s 23.47% 0.00% 1.1 (1.1) 4.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 229.1s
  • trigger_min/max:0.0s / 229.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 58.1s
  • uptime_min/max:5.26% / 55.72%

Stack Uptimes

  • wafting_devotion_1:23.47%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Primordial Arcanic Pulsar 8.1 6.0 10.0 35.7s 24.4s 47.5s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.04% 0.00% 0.69% 0.0s 0.0s 1.1s
Astral Smolder 73.72% 63.57% 83.26% 4.1s 0.0s 38.3s
Incarnation (Total) 52.11% 46.90% 59.41% 19.2s 0.0s 54.0s
Incarnation (Pulsar) 31.84% 29.03% 34.54% 11.8s 0.0s 12.0s
Lunar Eclipse Only 40.87% 33.25% 47.36% 9.6s 0.0s 15.0s
No Eclipse 6.98% 4.17% 9.77% 1.7s 0.0s 4.3s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Fury of Elune4.7210.00027.90624.2017.31471.785

Eclipse Utilization

NoneSolarLunarBoth
Wrath23.92100.0%0.000.0%0.000.0%0.000.0%
Starfire2.402.0%0.000.0%49.8142.5%65.0155.5%
Starfall21.387.2%0.000.0%119.3340.3%155.4352.5%
Fury of Elune22.553.0%0.000.0%145.4719.3%585.2877.7%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
447+460 2p+2p
Fury of EluneAstral Power81.02242.805.90%3.000.250.10%
MoonfireAstral Power3.0018.000.44%6.000.000.00%
Orbit BreakerAstral Power15.48462.3911.23%29.881.870.40%
Shooting Stars (Moonfire)Astral Power231.18462.1611.23%2.000.200.04%
Shooting Stars (Sunfire)Astral Power233.50466.7611.34%2.000.240.05%
StarfireAstral Power117.232199.6853.43%18.7633.851.52%
SunfireAstral Power1.006.000.15%6.000.000.00%
WrathAstral Power25.92259.166.30%10.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
447+460 2p+2p
StarfallAstral Power 104.714127.38100.00%39.4240.0316193.88
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 696920.0 3203.44 3728.74 2643402.2 539329.1 -56208.8 696920.0
Astral Power 20.0 13.72 13.55 36.3 52.8 0.0 100.0

Statistics & Data Analysis

Fight Length
447+460 2p+2p Fight Length
Count 2063
Mean 300.00
Minimum 240.05
Maximum 359.89
Spread ( max - min ) 119.84
Range [ ( max - min ) / 2 * 100% ] 19.97%
Standard Deviation 34.4109
5th Percentile 245.91
95th Percentile 352.94
( 95th Percentile - 5th Percentile ) 107.04
Mean Distribution
Standard Deviation 0.7576
95.00% Confidence Interval ( 298.52 - 301.49 )
Normalized 95.00% Confidence Interval ( 99.51% - 100.49% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 506
0.1% Error 50541
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1011
DPS
447+460 2p+2p Damage Per Second
Count 2063
Mean 714050.28
Minimum 671082.49
Maximum 770438.51
Spread ( max - min ) 99356.02
Range [ ( max - min ) / 2 * 100% ] 6.96%
Standard Deviation 16356.0282
5th Percentile 687290.68
95th Percentile 742636.92
( 95th Percentile - 5th Percentile ) 55346.24
Mean Distribution
Standard Deviation 360.1042
95.00% Confidence Interval ( 713344.49 - 714756.07 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2016
0.1 Scale Factor Error with Delta=300 2283702
0.05 Scale Factor Error with Delta=300 9134807
0.01 Scale Factor Error with Delta=300 228370166
Priority Target DPS
447+460 2p+2p Priority Target Damage Per Second
Count 2063
Mean 130191.73
Minimum 116985.11
Maximum 143280.84
Spread ( max - min ) 26295.72
Range [ ( max - min ) / 2 * 100% ] 10.10%
Standard Deviation 4032.9499
5th Percentile 123772.31
95th Percentile 136970.59
( 95th Percentile - 5th Percentile ) 13198.28
Mean Distribution
Standard Deviation 88.7919
95.00% Confidence Interval ( 130017.70 - 130365.76 )
Normalized 95.00% Confidence Interval ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3687
0.1 Scale Factor Error with Delta=300 138845
0.05 Scale Factor Error with Delta=300 555379
0.01 Scale Factor Error with Delta=300 13884471
DPS(e)
447+460 2p+2p Damage Per Second (Effective)
Count 2063
Mean 714050.28
Minimum 671082.49
Maximum 770438.51
Spread ( max - min ) 99356.02
Range [ ( max - min ) / 2 * 100% ] 6.96%
Damage
447+460 2p+2p Damage
Count 2063
Mean 213905188.21
Minimum 167557066.08
Maximum 261611772.70
Spread ( max - min ) 94054706.61
Range [ ( max - min ) / 2 * 100% ] 21.99%
DTPS
447+460 2p+2p Damage Taken Per Second
Count 2063
Mean 3730.42
Minimum 1407.34
Maximum 6803.88
Spread ( max - min ) 5396.55
Range [ ( max - min ) / 2 * 100% ] 72.33%
HPS
447+460 2p+2p Healing Per Second
Count 2063
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
447+460 2p+2p Healing Per Second (Effective)
Count 2063
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
447+460 2p+2p Heal
Count 2063
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
447+460 2p+2p Healing Taken Per Second
Count 2063
Mean 3194.48
Minimum 725.91
Maximum 6780.26
Spread ( max - min ) 6054.34
Range [ ( max - min ) / 2 * 100% ] 94.76%
TMI
447+460 2p+2p Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
447+460 2p+2pTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
447+460 2p+2p Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.44 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.69 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.75 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.aoe
# count action,conditions
0.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
0.00 variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
I 1.00 sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
J 3.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
0.00 variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
K 14.04 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
L 68.85 starfall,if=variable.starfall_condition1
M 1.37 starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
0.00 celestial_alignment,if=variable.cd_condition_aoe
N 2.00 incarnation,if=variable.cd_condition_aoe
0.00 warrior_of_elune
0.00 variable,name=enter_solar,value=spell_targets.starfire<3
0.00 starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
O 23.99 wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
0.00 wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
P 5.14 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
Q 34.26 starfall,if=variable.starfall_condition2
0.00 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+50
0.00 convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 new_moon,if=astral_power.deficit>variable.passive_asp+10
0.00 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
R 115.41 starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
0.00 wrath
S 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFIJJJLMNDEPQLRLRLRLRLRRKLQQRRRLRLRLRLRKLQRQRRLRRLRRLRLOOLRQRRLRLRKLQRQPROOLRLRKLRLRRLOORLRRFLQRQRERLRLRLOORLQRRQRLRROKLOQRRQRRRLPKLQQRRLRRLOORKLQRRQRRRLOOKLQRRQRRRLRLKLQROFOMLRLNRERLRKLLQRPRRLRLRLRLLQRRRLRLRRKLQRQRRRLOOLRKLQRQRRRLRLOORLQRQRRLRRLOORLRQRQPFRLRLREKLQQOORRLRLRKLRQROOQRRLRRDLQQRRRRLRLOOKL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask 447+460 2p+2p 0.0/100: 0% astral_power
Pre precombat 1 food 447+460 2p+2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 2 augmentation 447+460 2p+2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 4 no_cd_talent 447+460 2p+2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 5 on_use_trinket 447+460 2p+2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 6 on_use_trinket 447+460 2p+2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 7 on_use_trinket 447+460 2p+2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 10.0/100: 10% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil 447+460 2p+2p 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.000 aoe I sunfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.943 aoe J moonfire Fluffy_Pillow 47.2/100: 47% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:01.886 aoe J moonfire enemy2 57.2/100: 57% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:02.830 aoe J moonfire enemy4 67.2/100: 67% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, umbral_embrace, dreamstate, corrupting_rage
0:03.772 aoe L starfall Fluffy_Pillow 79.2/100: 79% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, solstice, umbral_embrace, dreamstate, corrupting_rage
0:04.714 aoe M starfire Fluffy_Pillow 38.2/100: 38% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, umbral_embrace, corrupting_rage
0:05.532 aoe N incarnation_chosen_of_elune Fluffy_Pillow 61.4/100: 61% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, corrupting_rage
0:05.532 default D potion Fluffy_Pillow 61.4/100: 61% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), corrupting_rage
0:05.532 default E use_items Fluffy_Pillow 61.4/100: 61% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power
0:05.532 aoe P fury_of_elune Fluffy_Pillow 61.4/100: 61% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:06.358 aoe Q starfall Fluffy_Pillow 72.4/100: 72% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:07.184 aoe L starfall Fluffy_Pillow 49.4/100: 49% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:07.980 aoe R starfire Fluffy_Pillow 21.4/100: 21% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), dreamstate, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:08.735 aoe L starfall Fluffy_Pillow 80.6/100: 81% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), dreamstate, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:09.502 aoe R starfire Fluffy_Pillow 52.6/100: 53% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:10.258 aoe L starfall Fluffy_Pillow 83.8/100: 84% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
0:11.022 aoe R starfire Fluffy_Pillow 57.8/100: 58% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(5), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:12.170 aoe L starfall Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), starfall(4), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
0:12.936 aoe R starfire Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(5), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:14.083 aoe L starfall Fluffy_Pillow 85.2/100: 85% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(5), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:14.851 aoe R starfire Fluffy_Pillow 52.2/100: 52% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(5), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:15.998 aoe R starfire Fluffy_Pillow 77.4/100: 77% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:17.146 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:17.146 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:18.004 aoe Q starfall Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord, umbral_embrace, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:18.829 aoe Q starfall Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord(2), umbral_embrace, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:19.625 aoe R starfire Fluffy_Pillow 5.0/100: 5% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(5), starlord(3), umbral_embrace, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:20.772 aoe R starfire Fluffy_Pillow 28.2/100: 28% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), best_friends_with_urctos(10), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:21.918 aoe R starfire Fluffy_Pillow 49.4/100: 49% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), best_friends_with_urctos(9), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:23.067 aoe L starfall Fluffy_Pillow 72.6/100: 73% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(3), starlord(3), best_friends_with_urctos(8), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:23.836 aoe R starfire Fluffy_Pillow 71.6/100: 72% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(4), starlord(3), best_friends_with_urctos(7), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:24.983 aoe L starfall Fluffy_Pillow 94.8/100: 95% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(4), starlord(3), best_friends_with_urctos(6), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:25.749 aoe R starfire Fluffy_Pillow 65.8/100: 66% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(4), starlord(3), best_friends_with_urctos(5), corrupting_rage, elemental_potion_of_ultimate_power
0:26.897 aoe L starfall Fluffy_Pillow 93.0/100: 93% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_urctos(4), corrupting_rage, elemental_potion_of_ultimate_power
0:27.663 aoe R starfire Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_urctos(4), corrupting_rage, elemental_potion_of_ultimate_power
0:28.811 aoe L starfall Fluffy_Pillow 89.2/100: 89% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_urctos(2), corrupting_rage, elemental_potion_of_ultimate_power
0:29.575 aoe R starfire Fluffy_Pillow 58.2/100: 58% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), best_friends_with_urctos(2), corrupting_rage, elemental_potion_of_ultimate_power
0:30.722 aoe K cancel_buff Fluffy_Pillow 83.4/100: 83% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:30.722 aoe L starfall Fluffy_Pillow 83.4/100: 83% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), corrupting_rage, elemental_potion_of_ultimate_power
0:31.581 aoe Q starfall Fluffy_Pillow 52.4/100: 52% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord, corrupting_rage, elemental_potion_of_ultimate_power
0:32.407 aoe R starfire Fluffy_Pillow 19.4/100: 19% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(5), starlord(2), corrupting_rage, elemental_potion_of_ultimate_power
0:33.597 aoe Q starfall Fluffy_Pillow 40.6/100: 41% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), corrupting_rage, elemental_potion_of_ultimate_power
0:34.391 aoe R starfire Fluffy_Pillow 5.6/100: 6% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(5), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:35.539 aoe R starfire Fluffy_Pillow 30.8/100: 31% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), corrupting_rage
0:36.687 aoe L starfall Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), corrupting_rage
0:37.453 aoe R starfire Fluffy_Pillow 17.0/100: 17% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), corrupting_rage
0:38.601 aoe R starfire Fluffy_Pillow 70.2/100: 70% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), corrupting_rage
0:39.750 aoe L starfall Fluffy_Pillow 91.4/100: 91% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), corrupting_rage
0:40.517 aoe R starfire Fluffy_Pillow 58.4/100: 58% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), umbral_embrace, corrupting_rage
0:42.008 aoe R starfire Fluffy_Pillow 79.6/100: 80% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), corrupting_rage
0:43.500 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3)
0:44.495 aoe R starfire Fluffy_Pillow 67.0/100: 67% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(3)
0:45.986 aoe L starfall Fluffy_Pillow 90.2/100: 90% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2)
0:47.101 aoe O wrath Fluffy_Pillow 59.2/100: 59% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord
0:48.174 aoe O wrath Fluffy_Pillow 71.2/100: 71% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord, dreamstate
0:48.928 aoe L starfall Fluffy_Pillow 81.2/100: 81% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord, dreamstate
0:50.106 aoe R starfire Fluffy_Pillow 42.2/100: 42% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(2)
0:51.127 aoe Q starfall Fluffy_Pillow 67.4/100: 67% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(2)
0:52.261 aoe R starfire Fluffy_Pillow 30.4/100: 30% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3)
0:53.899 aoe R starfire Fluffy_Pillow 57.6/100: 58% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3)
0:55.538 aoe L starfall Fluffy_Pillow 82.8/100: 83% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3)
0:56.632 aoe R starfire Fluffy_Pillow 41.8/100: 42% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3)
0:58.121 aoe L starfall Fluffy_Pillow 99.0/100: 99% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), corrupting_rage
0:59.117 aoe R starfire Fluffy_Pillow 68.0/100: 68% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), corrupting_rage
1:00.608 aoe K cancel_buff Fluffy_Pillow 95.2/100: 95% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), corrupting_rage
1:00.608 aoe L starfall Fluffy_Pillow 95.2/100: 95% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), corrupting_rage
1:01.722 aoe Q starfall Fluffy_Pillow 64.2/100: 64% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord, corrupting_rage
1:02.794 aoe R starfire Fluffy_Pillow 29.2/100: 29% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(2), corrupting_rage
1:04.340 aoe Q starfall Fluffy_Pillow 48.4/100: 48% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(2), corrupting_rage
1:05.373 aoe P fury_of_elune Fluffy_Pillow 13.4/100: 13% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), corrupting_rage
1:06.528 aoe R starfire Fluffy_Pillow 16.4/100: 16% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), starfall(3), starlord(3), corrupting_rage
1:08.020 aoe O wrath Fluffy_Pillow 41.4/100: 41% astral_power fury_of_elune, primordial_arcanic_pulsar(20), starfall(3), starlord(3), umbral_embrace, dreamstate, corrupting_rage
1:08.774 aoe O wrath Fluffy_Pillow 59.4/100: 59% astral_power fury_of_elune, primordial_arcanic_pulsar(20), starfall(2), starlord(3), umbral_embrace, corrupting_rage
1:09.529 aoe L starfall Fluffy_Pillow 74.4/100: 74% astral_power balance_of_all_things_arcane(8), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), umbral_embrace, corrupting_rage
1:10.625 aoe R starfire Fluffy_Pillow 44.4/100: 44% astral_power balance_of_all_things_arcane(7), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), umbral_embrace, corrupting_rage
1:12.267 aoe L starfall Fluffy_Pillow 78.6/100: 79% astral_power balance_of_all_things_arcane(6), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), corrupting_rage
1:13.362 aoe R starfire Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_arcane(5), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), corrupting_rage
1:15.001 aoe K cancel_buff Fluffy_Pillow 71.8/100: 72% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), corrupting_rage
1:15.001 aoe L starfall Fluffy_Pillow 71.8/100: 72% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), corrupting_rage
1:16.225 aoe R starfire Fluffy_Pillow 28.8/100: 29% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord, corrupting_rage
1:17.990 aoe L starfall Fluffy_Pillow 52.0/100: 52% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord, corrupting_rage
1:19.170 aoe R starfire Fluffy_Pillow 7.0/100: 7% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage
1:20.872 aoe R starfire Fluffy_Pillow 26.2/100: 26% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage
1:22.573 aoe L starfall Fluffy_Pillow 79.4/100: 79% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), best_friends_with_pip(8), best_friends_with_pip_static, corrupting_rage
1:23.708 aoe O wrath Fluffy_Pillow 34.4/100: 34% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_pip(7), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:24.721 aoe O wrath Fluffy_Pillow 46.4/100: 46% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(3), dreamstate, best_friends_with_pip(6), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:25.476 aoe R starfire Fluffy_Pillow 56.4/100: 56% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), best_friends_with_pip(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:26.388 aoe L starfall Fluffy_Pillow 81.6/100: 82% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), best_friends_with_pip(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:27.401 aoe R starfire Fluffy_Pillow 40.6/100: 41% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_pip(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:28.919 aoe R starfire Fluffy_Pillow 67.8/100: 68% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_pip(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:30.435 default F natures_vigil 447+460 2p+2p 93.0/100: 93% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:30.435 aoe L starfall Fluffy_Pillow 93.0/100: 93% astral_power natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:31.567 aoe Q starfall Fluffy_Pillow 54.0/100: 54% astral_power natures_vigil, balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord, best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:32.656 aoe R starfire Fluffy_Pillow 15.0/100: 15% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:34.086 aoe Q starfall Fluffy_Pillow 40.2/100: 40% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:35.041 aoe R starfire Fluffy_Pillow 11.2/100: 11% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:36.421 default E use_items Fluffy_Pillow 36.4/100: 36% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:36.421 aoe R starfire Fluffy_Pillow 36.4/100: 36% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(100)
1:37.800 aoe L starfall Fluffy_Pillow 93.6/100: 94% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(3), starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(95)
1:38.721 aoe R starfire Fluffy_Pillow 60.6/100: 61% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(90)
1:40.209 aoe L starfall Fluffy_Pillow 81.8/100: 82% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(85)
1:41.205 aoe R starfire Fluffy_Pillow 48.8/100: 49% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(80)
1:42.696 aoe L starfall Fluffy_Pillow 72.0/100: 72% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(70)
1:43.693 aoe O wrath Fluffy_Pillow 39.0/100: 39% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(3), starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage, kindled_soul(65)
1:44.448 aoe O wrath Fluffy_Pillow 51.0/100: 51% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(60)
1:45.203 aoe R starfire Fluffy_Pillow 63.0/100: 63% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(60)
1:46.842 aoe L starfall Fluffy_Pillow 88.2/100: 88% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), best_friends_with_pip_static, kindled_soul(50)
1:48.068 aoe Q starfall Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord, best_friends_with_pip_static, kindled_soul(45)
1:49.244 aoe R starfire Fluffy_Pillow 8.2/100: 8% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(2), best_friends_with_pip_static, kindled_soul(40)
1:50.945 aoe R starfire Fluffy_Pillow 37.4/100: 37% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(2), best_friends_with_pip_static, kindled_soul(30)
1:52.644 aoe Q starfall Fluffy_Pillow 62.6/100: 63% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(2), best_friends_with_pip_static, kindled_soul(20)
1:53.778 aoe R starfire Fluffy_Pillow 19.6/100: 20% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), best_friends_with_pip_static, kindled_soul(15)
1:55.416 aoe L starfall Fluffy_Pillow 72.8/100: 73% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_pip_static, kindled_soul(10)
1:56.508 aoe R starfire Fluffy_Pillow 27.8/100: 28% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), umbral_embrace, best_friends_with_pip_static
1:58.150 aoe R starfire Fluffy_Pillow 49.0/100: 49% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), best_friends_with_pip_static
1:59.789 aoe O wrath Fluffy_Pillow 70.2/100: 70% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), best_friends_with_pip_static
2:00.885 aoe K cancel_buff Fluffy_Pillow 82.2/100: 82% astral_power primordial_arcanic_pulsar(40), starfall, starlord(3), dreamstate(2), best_friends_with_pip_static
2:00.885 aoe L starfall Fluffy_Pillow 82.2/100: 82% astral_power primordial_arcanic_pulsar(40), starfall, dreamstate(2), best_friends_with_pip_static
2:02.109 aoe O wrath Fluffy_Pillow 39.2/100: 39% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord, umbral_embrace, dreamstate, best_friends_with_pip_static, corrupting_rage
2:02.864 aoe Q starfall Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord, umbral_embrace, dreamstate, best_friends_with_pip_static, corrupting_rage
2:04.042 aoe R starfire Fluffy_Pillow 8.2/100: 8% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), umbral_embrace, best_friends_with_pip_static, corrupting_rage
2:05.063 aoe R starfire Fluffy_Pillow 31.4/100: 31% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), best_friends_with_pip_static, corrupting_rage
2:06.765 aoe Q starfall Fluffy_Pillow 62.6/100: 63% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), best_friends_with_pip_static, corrupting_rage
2:07.900 aoe R starfire Fluffy_Pillow 23.6/100: 24% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage
2:09.538 aoe R starfire Fluffy_Pillow 44.8/100: 45% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
2:11.175 aoe R starfire Fluffy_Pillow 68.0/100: 68% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall, starlord(3), best_friends_with_pip_static, corrupting_rage
2:12.814 aoe L starfall Fluffy_Pillow 89.2/100: 89% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall, starlord(3), best_friends_with_pip_static, corrupting_rage
2:13.909 aoe P fury_of_elune Fluffy_Pillow 50.2/100: 50% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
2:14.903 aoe K cancel_buff Fluffy_Pillow 57.2/100: 57% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall, starlord(3), best_friends_with_pip_static, corrupting_rage
2:14.903 aoe L starfall Fluffy_Pillow 57.2/100: 57% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall, best_friends_with_pip_static, corrupting_rage
2:16.018 aoe Q starfall Fluffy_Pillow 37.2/100: 37% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord, best_friends_with_pip_static, corrupting_rage
2:17.089 aoe Q starfall Fluffy_Pillow 42.2/100: 42% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(2), best_friends_with_pip_static, corrupting_rage
2:18.121 aoe R starfire Fluffy_Pillow 17.2/100: 17% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(4), starlord(3), best_friends_with_pip_static, corrupting_rage
2:19.612 aoe R starfire Fluffy_Pillow 49.4/100: 49% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(4), starlord(3), best_friends_with_pip_static, corrupting_rage
2:21.104 aoe L starfall Fluffy_Pillow 79.6/100: 80% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage
2:22.099 aoe R starfire Fluffy_Pillow 50.6/100: 51% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), best_friends_with_pip_static, corrupting_rage
2:23.589 aoe R starfire Fluffy_Pillow 69.8/100: 70% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage
2:25.079 aoe L starfall Fluffy_Pillow 81.8/100: 82% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), dreamstate(2), best_friends_with_pip_static, corrupting_rage
2:26.173 aoe O wrath Fluffy_Pillow 38.8/100: 39% astral_power primordial_arcanic_pulsar(25), starfall(2), starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage
2:26.927 aoe O wrath Fluffy_Pillow 48.8/100: 49% astral_power primordial_arcanic_pulsar(25), starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
2:27.683 aoe R starfire Fluffy_Pillow 60.8/100: 61% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
2:29.322 aoe K cancel_buff Fluffy_Pillow 86.0/100: 86% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall, starlord(3), best_friends_with_pip_static, corrupting_rage
2:29.322 aoe L starfall Fluffy_Pillow 86.0/100: 86% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall, best_friends_with_pip_static, corrupting_rage
2:30.548 aoe Q starfall Fluffy_Pillow 49.0/100: 49% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord, best_friends_with_pip_static, corrupting_rage
2:31.728 aoe R starfire Fluffy_Pillow 10.0/100: 10% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(2), best_friends_with_pip_static, corrupting_rage
2:33.430 aoe R starfire Fluffy_Pillow 37.2/100: 37% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(2), starlord(2), best_friends_with_urctos(11), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:35.003 aoe Q starfall Fluffy_Pillow 58.4/100: 58% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(2), best_friends_with_urctos(10), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:36.054 aoe R starfire Fluffy_Pillow 13.4/100: 13% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), best_friends_with_urctos(9), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:37.573 aoe R starfire Fluffy_Pillow 34.6/100: 35% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), best_friends_with_urctos(7), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:39.091 aoe R starfire Fluffy_Pillow 53.8/100: 54% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), best_friends_with_urctos(6), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:40.609 aoe L starfall Fluffy_Pillow 75.0/100: 75% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:41.621 aoe O wrath Fluffy_Pillow 30.0/100: 30% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_urctos(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:42.631 aoe O wrath Fluffy_Pillow 44.0/100: 44% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(3), dreamstate, best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:43.384 aoe K cancel_buff Fluffy_Pillow 56.0/100: 56% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), dreamstate, best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:43.384 aoe L starfall Fluffy_Pillow 56.0/100: 56% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, dreamstate, best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:44.519 aoe Q starfall Fluffy_Pillow 47.0/100: 47% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:45.610 aoe R starfire Fluffy_Pillow 6.0/100: 6% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:46.557 aoe R starfire Fluffy_Pillow 29.2/100: 29% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:48.130 aoe Q starfall Fluffy_Pillow 56.4/100: 56% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:49.181 aoe R starfire Fluffy_Pillow 17.4/100: 17% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), umbral_embrace, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:50.561 aoe R starfire Fluffy_Pillow 42.6/100: 43% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:51.940 aoe R starfire Fluffy_Pillow 67.8/100: 68% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:53.318 aoe L starfall Fluffy_Pillow 97.0/100: 97% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall, starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:54.239 aoe R starfire Fluffy_Pillow 68.0/100: 68% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:55.619 aoe L starfall Fluffy_Pillow 89.2/100: 89% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:56.539 aoe K cancel_buff Fluffy_Pillow 58.2/100: 58% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:56.539 aoe L starfall Fluffy_Pillow 58.2/100: 58% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:57.570 aoe Q starfall Fluffy_Pillow 55.2/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:58.561 aoe R starfire Fluffy_Pillow 20.2/100: 20% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:59.991 aoe O wrath Fluffy_Pillow 43.4/100: 43% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:00.945 default F natures_vigil 447+460 2p+2p 55.4/100: 55% astral_power primordial_arcanic_pulsar(20), starfall(4), starlord(2), dreamstate(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:00.945 aoe O wrath Fluffy_Pillow 55.4/100: 55% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(4), starlord(2), dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:01.701 aoe M starfire Fluffy_Pillow 69.4/100: 69% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:02.646 aoe L starfall Fluffy_Pillow 90.6/100: 91% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:03.698 aoe R starfire Fluffy_Pillow 51.6/100: 52% astral_power natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:05.215 aoe L starfall Fluffy_Pillow 76.8/100: 77% astral_power natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:06.226 aoe N incarnation_chosen_of_elune Fluffy_Pillow 37.8/100: 38% astral_power natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:06.226 aoe R starfire Fluffy_Pillow 37.8/100: 38% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:07.056 default E use_items Fluffy_Pillow 61.0/100: 61% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:07.056 aoe R starfire Fluffy_Pillow 61.0/100: 61% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(100)
3:07.887 aoe L starfall Fluffy_Pillow 86.2/100: 86% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(100)
3:08.809 aoe R starfire Fluffy_Pillow 57.2/100: 57% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(95)
3:10.187 aoe K cancel_buff Fluffy_Pillow 82.4/100: 82% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(85)
3:10.187 aoe L starfall Fluffy_Pillow 82.4/100: 82% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(85)
3:11.220 aoe L starfall Fluffy_Pillow 51.4/100: 51% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starfall(3), starlord, umbral_embrace, best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(80)
3:12.212 aoe Q starfall Fluffy_Pillow 54.4/100: 54% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), solstice, starfall(4), starlord(2), umbral_embrace, best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(75)
3:13.167 aoe R starfire Fluffy_Pillow 19.4/100: 19% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(5), starlord(3), umbral_embrace, best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(70)
3:14.546 aoe P fury_of_elune Fluffy_Pillow 40.6/100: 41% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(65)
3:15.467 aoe R starfire Fluffy_Pillow 47.6/100: 48% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(4), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(60)
3:16.846 aoe R starfire Fluffy_Pillow 81.8/100: 82% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(3), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(55)
3:18.225 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(45)
3:19.147 aoe R starfire Fluffy_Pillow 71.0/100: 71% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(3), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(40)
3:20.527 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall, starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(35)
3:21.447 aoe R starfire Fluffy_Pillow 75.0/100: 75% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(30)
3:22.828 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(25)
3:23.824 aoe R starfire Fluffy_Pillow 71.0/100: 71% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(20)
3:25.317 aoe L starfall Fluffy_Pillow 96.2/100: 96% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(10)
3:26.433 aoe L starfall Fluffy_Pillow 69.2/100: 69% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord, best_friends_with_urctos_static, corrupting_rage, kindled_soul(5)
3:27.504 aoe Q starfall Fluffy_Pillow 36.2/100: 36% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(2), best_friends_with_urctos_static, corrupting_rage
3:28.537 aoe R starfire Fluffy_Pillow 3.2/100: 3% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(5), starlord(3), best_friends_with_urctos_static, corrupting_rage
3:30.028 aoe R starfire Fluffy_Pillow 22.4/100: 22% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:31.407 aoe R starfire Fluffy_Pillow 75.6/100: 76% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:32.785 aoe L starfall Fluffy_Pillow 98.8/100: 99% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:33.708 aoe R starfire Fluffy_Pillow 63.8/100: 64% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(3), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:35.088 aoe L starfall Fluffy_Pillow 87.0/100: 87% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(2), starlord(3), best_friends_with_pip(11), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:36.012 aoe R starfire Fluffy_Pillow 52.0/100: 52% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), best_friends_with_pip(11), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:37.392 aoe R starfire Fluffy_Pillow 73.2/100: 73% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), best_friends_with_pip(9), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:38.773 aoe K cancel_buff Fluffy_Pillow 94.4/100: 94% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), best_friends_with_pip(8), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:38.773 aoe L starfall Fluffy_Pillow 94.4/100: 94% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), best_friends_with_pip(8), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:39.803 aoe Q starfall Fluffy_Pillow 59.4/100: 59% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord, best_friends_with_pip(7), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:40.794 aoe R starfire Fluffy_Pillow 28.4/100: 28% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord(2), best_friends_with_pip(6), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:42.225 aoe Q starfall Fluffy_Pillow 51.6/100: 52% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), best_friends_with_pip(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:43.180 aoe R starfire Fluffy_Pillow 18.6/100: 19% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), best_friends_with_pip(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:44.560 aoe R starfire Fluffy_Pillow 39.8/100: 40% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), best_friends_with_pip(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:45.940 aoe R starfire Fluffy_Pillow 63.0/100: 63% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), best_friends_with_pip, best_friends_with_pip_static, corrupting_rage
3:47.431 aoe L starfall Fluffy_Pillow 88.2/100: 88% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
3:48.426 aoe O wrath Fluffy_Pillow 53.2/100: 53% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage
3:49.181 aoe O wrath Fluffy_Pillow 63.2/100: 63% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
3:49.936 aoe L starfall Fluffy_Pillow 73.2/100: 73% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
3:51.031 aoe R starfire Fluffy_Pillow 34.2/100: 34% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), umbral_embrace, best_friends_with_pip_static, corrupting_rage
3:52.670 aoe K cancel_buff Fluffy_Pillow 65.4/100: 65% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
3:52.670 aoe L starfall Fluffy_Pillow 65.4/100: 65% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), best_friends_with_pip_static, corrupting_rage
3:53.895 aoe Q starfall Fluffy_Pillow 56.4/100: 56% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord, best_friends_with_pip_static, corrupting_rage
3:54.965 aoe R starfire Fluffy_Pillow 27.4/100: 27% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(4), starlord(2), best_friends_with_pip_static, corrupting_rage
3:56.510 aoe Q starfall Fluffy_Pillow 52.6/100: 53% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), best_friends_with_pip_static, corrupting_rage
3:57.543 aoe R starfire Fluffy_Pillow 21.6/100: 22% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), best_friends_with_pip_static, corrupting_rage
3:59.033 aoe R starfire Fluffy_Pillow 44.8/100: 45% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage
4:00.522 aoe R starfire Fluffy_Pillow 66.0/100: 66% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:01.901 aoe L starfall Fluffy_Pillow 85.2/100: 85% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:02.822 aoe R starfire Fluffy_Pillow 52.2/100: 52% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:04.201 aoe L starfall Fluffy_Pillow 75.4/100: 75% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:05.123 aoe O wrath Fluffy_Pillow 42.4/100: 42% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), dreamstate, best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:05.877 aoe O wrath Fluffy_Pillow 52.4/100: 52% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:06.633 aoe R starfire Fluffy_Pillow 66.4/100: 66% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:08.149 aoe L starfall Fluffy_Pillow 91.6/100: 92% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:09.282 aoe Q starfall Fluffy_Pillow 50.6/100: 51% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord, best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:10.374 aoe R starfire Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:11.946 aoe Q starfall Fluffy_Pillow 70.8/100: 71% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:12.996 aoe R starfire Fluffy_Pillow 31.8/100: 32% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), best_friends_with_pip(11), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:14.513 aoe R starfire Fluffy_Pillow 53.0/100: 53% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), best_friends_with_pip(10), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:16.031 aoe L starfall Fluffy_Pillow 74.2/100: 74% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), best_friends_with_pip(8), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:17.044 aoe R starfire Fluffy_Pillow 31.2/100: 31% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), best_friends_with_pip(7), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:18.558 aoe R starfire Fluffy_Pillow 50.4/100: 50% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), best_friends_with_pip(6), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:20.075 aoe L starfall Fluffy_Pillow 73.6/100: 74% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), best_friends_with_pip(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:21.087 aoe O wrath Fluffy_Pillow 28.6/100: 29% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), umbral_embrace, best_friends_with_pip(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:22.100 aoe O wrath Fluffy_Pillow 42.6/100: 43% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(3), umbral_embrace, dreamstate, best_friends_with_pip(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:22.855 aoe R starfire Fluffy_Pillow 54.6/100: 55% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), umbral_embrace, best_friends_with_pip(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:23.766 aoe L starfall Fluffy_Pillow 79.8/100: 80% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), best_friends_with_pip, best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:24.898 aoe R starfire Fluffy_Pillow 42.8/100: 43% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:26.531 aoe Q starfall Fluffy_Pillow 68.0/100: 68% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
4:27.621 aoe R starfire Fluffy_Pillow 27.0/100: 27% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
4:29.194 aoe Q starfall Fluffy_Pillow 54.2/100: 54% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(2), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
4:30.245 aoe P fury_of_elune Fluffy_Pillow 45.2/100: 45% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, corrupting_rage
4:31.240 default F natures_vigil 447+460 2p+2p 52.2/100: 52% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(3), starlord(3), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, corrupting_rage
4:31.240 aoe R starfire Fluffy_Pillow 52.2/100: 52% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(3), starlord(3), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, corrupting_rage
4:32.730 aoe L starfall Fluffy_Pillow 84.4/100: 84% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, corrupting_rage
4:33.724 aoe R starfire Fluffy_Pillow 61.4/100: 61% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, corrupting_rage
4:35.214 aoe L starfall Fluffy_Pillow 97.6/100: 98% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), starfall(2), starlord(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static, corrupting_rage
4:36.209 aoe R starfire Fluffy_Pillow 72.6/100: 73% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(3), starlord(3), umbral_embrace, best_friends_with_aerwynn_static, corrupting_rage
4:37.699 default E use_items Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_aerwynn_static
4:37.699 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_aerwynn_static, kindled_soul(100)
4:37.699 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(2), best_friends_with_aerwynn_static, kindled_soul(100)
4:38.814 aoe Q starfall Fluffy_Pillow 71.0/100: 71% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord, umbral_embrace, best_friends_with_aerwynn_static, kindled_soul(95)
4:39.885 aoe Q starfall Fluffy_Pillow 38.0/100: 38% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), umbral_embrace, best_friends_with_aerwynn_static, kindled_soul(90)
4:40.918 aoe O wrath Fluffy_Pillow 7.0/100: 7% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), umbral_embrace, best_friends_with_aerwynn_static, kindled_soul(85)
4:41.913 aoe O wrath Fluffy_Pillow 19.0/100: 19% astral_power natures_vigil, primordial_arcanic_pulsar(25), starfall(4), starlord(3), umbral_embrace, dreamstate, best_friends_with_aerwynn_static, kindled_soul(80)
4:42.667 aoe R starfire Fluffy_Pillow 31.0/100: 31% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(4), starlord(3), umbral_embrace, best_friends_with_aerwynn_static, kindled_soul(80)
4:43.654 aoe R starfire Fluffy_Pillow 56.2/100: 56% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, kindled_soul(75)
4:45.292 aoe L starfall Fluffy_Pillow 83.4/100: 83% astral_power natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, kindled_soul(65)
4:46.386 aoe R starfire Fluffy_Pillow 42.4/100: 42% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, kindled_soul(60)
4:48.026 aoe L starfall Fluffy_Pillow 97.6/100: 98% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall, starlord(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, kindled_soul(50)
4:49.122 aoe R starfire Fluffy_Pillow 54.6/100: 55% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, kindled_soul(45)
4:50.761 aoe K cancel_buff Fluffy_Pillow 77.8/100: 78% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, kindled_soul(35)
4:50.761 aoe L starfall Fluffy_Pillow 77.8/100: 78% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, kindled_soul(35)
4:51.987 aoe R starfire Fluffy_Pillow 34.8/100: 35% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord, best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, kindled_soul(30)
4:53.752 aoe Q starfall Fluffy_Pillow 58.0/100: 58% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord, best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(20)
4:54.931 aoe R starfire Fluffy_Pillow 15.0/100: 15% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(3), starlord(2), best_friends_with_aerwynn, best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(15)
4:56.629 aoe O wrath Fluffy_Pillow 38.2/100: 38% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(2), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(10)
4:57.764 aoe O wrath Fluffy_Pillow 50.2/100: 50% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(2), umbral_embrace, dreamstate, best_friends_with_aerwynn_static, corrupting_rage
4:58.519 aoe Q starfall Fluffy_Pillow 60.2/100: 60% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), umbral_embrace, dreamstate, best_friends_with_aerwynn_static, corrupting_rage
4:59.653 aoe R starfire Fluffy_Pillow 21.2/100: 21% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), umbral_embrace, best_friends_with_aerwynn_static, corrupting_rage
5:00.638 aoe R starfire Fluffy_Pillow 44.4/100: 44% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
5:02.279 aoe L starfall Fluffy_Pillow 73.6/100: 74% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), best_friends_with_aerwynn_static, corrupting_rage
5:03.376 aoe R starfire Fluffy_Pillow 32.6/100: 33% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
5:05.016 aoe R starfire Fluffy_Pillow 55.8/100: 56% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
5:06.656 default D potion Fluffy_Pillow 77.0/100: 77% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall, best_friends_with_aerwynn_static, corrupting_rage
5:06.656 aoe L starfall Fluffy_Pillow 77.0/100: 77% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall, best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
5:07.881 aoe Q starfall Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord, best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
5:08.951 aoe Q starfall Fluffy_Pillow 39.0/100: 39% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
5:09.983 aoe R starfire Fluffy_Pillow 8.0/100: 8% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
5:11.474 aoe R starfire Fluffy_Pillow 31.2/100: 31% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
5:12.965 aoe R starfire Fluffy_Pillow 60.4/100: 60% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
5:14.455 aoe R starfire Fluffy_Pillow 81.6/100: 82% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
5:15.945 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall, starlord(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
5:16.941 aoe R starfire Fluffy_Pillow 69.0/100: 69% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
5:18.430 aoe L starfall Fluffy_Pillow 92.2/100: 92% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall, starlord(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
5:19.425 aoe O wrath Fluffy_Pillow 59.2/100: 59% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), dreamstate, best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
5:20.180 aoe O wrath Fluffy_Pillow 71.2/100: 71% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
5:20.935 aoe K cancel_buff Fluffy_Pillow 83.2/100: 83% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
5:20.935 aoe L starfall Fluffy_Pillow 83.2/100: 83% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (tauren) Raid-Buffed Unbuffed Gear Amount
Strength 898 2 986 900 0
Agility 2089 -2 2173 2087 0
Stamina 3848 2 34846 33187 29270
Intellect 2089 -2 13344 12540 9856 (5981)
Spirit 0 0 0 0 0
Health 696920 696920 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13344 12540 0
Crit 27.03% 20.82% 2847
Haste 22.82% 22.82% 3880
Versatility 6.13% 1.13% 232
Mana Regen 2560 2560 0
Attack Power 13878 13042 0
Mastery 28.93% 28.93% 7473
Armor 4406 4406 4406
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 466.00
Local Head Benevolent Embersage's Casque
ilevel: 470, stats: { 585 Armor, +3163 Sta, +655 Crit, +307 Haste, +786 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }, enchant: incandescent_essence
Local Neck Eye of the Rising Flame
ilevel: 470, stats: { +1779 Sta, +233 Haste, +1397 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Life-Bound Shoulderpads
ilevel: 447, stats: { 456 Armor, +1796 Sta, +328 Mastery, +328 Haste, +476 AgiInt }
item effects: { equip: Toxified }
Local Chest Benevolent Embersage's Robe
ilevel: 460, stats: { 727 Armor, +2804 Sta, +639 Crit, +284 Mastery, +716 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 470, stats: { 439 Armor, +2372 Sta, +497 Haste, +224 Mastery, +590 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 460, stats: { 636 Armor, +2804 Sta, +630 Haste, +293 Mastery, +716 AgiInt }, enchant: { +155 StrAgiInt, +41 Vers (lambent_armor_kit_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 470, stats: { 488 Armor, +2372 Sta, +257 Crit, +412 Haste, +590 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Thermal Bindings
ilevel: 470, stats: { 390 Armor, +1779 Sta, +178 Crit, +363 Mastery, +442 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Benevolent Embersage's Talons
ilevel: 447, stats: { 373 Armor, +1796 Sta, +191 Vers, +464 Mastery, +476 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 470, stats: { +1779 Sta, +466 Haste, +1165 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 470, stats: { +1779 Sta, +1118 Crit, +512 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 470, stats: { +747 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 470, stats: { +687 Mastery }
item effects: { use: Balefire Branch }
Local Back Drape of the Loyal Vassal
ilevel: 470, stats: { 312 Armor, +1779 Sta, +305 Haste, +236 Mastery, +442 StrAgiInt }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 470, weapon: { 508 - 654, 2.6 }, stats: { +393 Int, +1896 Int, +1581 Sta, +145 Haste, +335 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 470, stats: { +1206 Int, +1581 Sta, +162 Haste, +319 Mastery }

Profile

druid="447+460 2p+2p"
source=default
spec=balance
level=70
race=tauren
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:hissing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Balance APL can be found at https://balance-simc.github.io/Balance-SimC/balance.txt

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=470,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=470,gem_id=192961/192961/192961
shoulders=lifebound_shoulderpads,id=193406,bonus_id=8836/1576/8797/8960,ilevel=447,crafted_stats=49/36
back=drape_of_the_loyal_vassal,id=158375,bonus_id=4795,ilevel=470
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=460,enchant_id=6625
wrists=thermal_bindings,id=134461,bonus_id=4795,ilevel=470,gem_id=192961
hands=benevolent_embersages_talons,id=207255,bonus_id=4795,ilevel=447
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=460,enchant_id=6830
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=470
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=470
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=470
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=470,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=470

# Gear Summary
# gear_ilvl=465.88
# gear_stamina=29270
# gear_intellect=9856
# gear_crit_rating=2847
# gear_haste_rating=3880
# gear_mastery_rating=7473
# gear_versatility_rating=232
# gear_armor=4406
# set_bonus=tier30_2pc=1
# set_bonus=tier31_2pc=1

447+470 2p+2p : 723645 dps, 131838 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
723645.0 723645.0 712.4 / 0.098% 65808.1 / 9.1% 53265.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.6 13.7 Astral Power 0.00% 55.6 100.0% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
447+470 2p+2p 723645
Astral Smolder 98713 13.6% 371.6 0.87s 79616 0 Periodic 733.6 40327 0 40327 0.0% 81.4%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 371.59 0.00 733.65 733.65 283.31 0.0000 2.0000 29584414.70 29584414.70 0.00% 20162.55 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 733.65 550 912 40327.41 3411 201455 40377.39 35395 46120 29584415 29584415 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Fury of Elune 20279 2.8% 5.1 64.61s 1182612 1205661 Direct 754.1 5052 10963 8058 50.9%

Stats Details: Fury Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.14 754.13 0.00 0.00 0.00 0.9810 0.0000 6076531.69 6076531.69 0.00% 1205661.05 1205661.05
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.15% 370.62 231 501 5052.14 2719 16062 5061.22 4542 5754 1872253 1872253 0.00%
crit 50.85% 383.51 254 537 10963.03 5547 32766 10968.23 9901 12633 4204278 4204278 0.00%

Action Details: Fury Of Elune

  • id:202770
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:astral_power
  • energize_amount:3.0

Spelldata

  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r

Action Details: Fury Of Elune Tick

  • id:211545
  • school:astral
  • range:105.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.149000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:211545
  • name:Fury of Elune
  • school:astral
  • tooltip:
  • description:{$@spelldesc202770=Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r}

Action Priority List

    aoe
    [P]:5.14
  • if_expr:target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Hungering Shadowflame 2881 0.4% 16.8 17.79s 51355 0 Direct 16.8 40001 82350 51329 26.8%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.81 16.81 0.00 0.00 0.00 0.0000 0.0000 863136.80 863136.80 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.24% 12.31 4 26 40000.91 26959 154597 39907.49 26959 80614 492309 492309 0.00%
crit 26.76% 4.50 0 13 82350.20 54997 315378 81477.45 0 305286 370828 370828 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24191.79
  • base_dd_max:24191.79
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 5542 0.8% 33.6 8.71s 49419 0 Direct 33.5 38603 78681 49551 27.3%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.63 33.53 0.00 0.00 0.00 0.0000 0.0000 1661910.63 1661910.63 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.66% 24.37 9 42 38602.70 38162 43768 38601.95 38162 39855 940558 940558 0.00%
crit 27.34% 9.17 1 21 78680.61 77851 89287 78683.72 77851 85475 721353 721353 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:34245.43
  • base_dd_max:34245.43
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 71726 9.9% 3.0 1.06s 7172362 7676449 Direct 6.0 7062 14400 10609 48.2%
Periodic 1797.3 8328 17240 11938 40.5% 99.1%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.00 6.00 1797.29 1797.29 0.00 0.9347 0.9938 21517086.67 21517086.67 0.00% 12028.33 7676449.04
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 51.77% 3.11 0 6 7062.11 6990 8017 6948.64 0 8017 21938 21938 0.00%
crit 48.23% 2.89 0 6 14399.95 14260 16355 14142.63 0 16355 41671 41671 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 59.50% 1069.45 811 1327 8327.83 6711 13474 8326.62 8102 8555 8905698 8905698 0.00%
crit 40.50% 727.84 539 930 17240.50 13691 27487 17240.59 16787 17680 12547779 12547779 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.39

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.39
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    aoe
    [J]:3.00
  • if_expr:!fight_style.dungeonroute
  • target_if_expr:refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (66042) 0.0% (9.1%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 17856 2.5% 231.9 1.49s 23100 0 Direct 231.3 14682 31560 23162 50.2%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 231.89 231.29 0.00 0.00 0.00 0.0000 0.0000 5356748.65 5356748.65 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.77% 115.11 72 163 14682.28 10996 26518 14685.21 13991 15529 1690079 1690079 0.00%
crit 50.23% 116.19 77 162 31559.66 22432 54097 31573.83 29826 33527 3666670 3666670 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 17956 2.5% 233.8 1.48s 23033 0 Direct 233.2 14645 31476 23094 50.2%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 233.84 233.24 0.00 0.00 0.00 0.0000 0.0000 5385994.88 5385994.88 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.81% 116.19 73 165 14645.19 9964 26518 14645.51 13655 15605 1701558 1701558 0.00%
crit 50.19% 117.05 72 158 31475.68 20327 54097 31491.27 29687 34003 3684437 3684437 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 30230 4.2% 15.5 19.46s 584661 0 Direct 92.8 62145 133526 97709 49.8%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.51 92.83 0.00 0.00 0.00 0.0000 0.0000 9067755.75 9067755.75 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 50.18% 46.58 21 72 62144.95 34230 220090 62169.02 49454 75561 2894617 2894617 0.00%
crit 49.82% 46.25 25 72 133526.01 69829 455210 133457.01 112473 159475 6173139 6173139 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:enemy5
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfall 226335 31.3% 103.3 2.88s 656518 639429 Direct 1770.5 25339 54913 38327 43.9%

Stats Details: Starfall

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 103.35 1770.51 0.00 0.00 0.00 1.0267 0.0000 67850482.88 67850482.88 0.00% 639429.30 639429.30
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.09% 993.03 733 1282 25339.39 6206 87858 25378.43 23445 28452 25157541 25157541 0.00%
crit 43.91% 777.47 571 982 54913.23 12660 179230 54991.44 51354 59450 42692942 42692942 0.00%

Action Details: Starfall

  • id:191034
  • school:astral
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:45.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]

Action Details: Starfall Damage

  • id:191037
  • school:astral
  • range:200.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy5
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.114000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.41

Spelldata

  • id:191037
  • name:Starfall
  • school:astral
  • tooltip:
  • description:{$@spelldesc191034=Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]}

Action Priority List

    aoe
    [L]:68.89
  • if_expr:variable.starfall_condition1
    aoe
    [Q]:34.46
  • if_expr:variable.starfall_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountLunar Shrapnel4151691PCT0.200
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 162409 22.4% 116.5 2.54s 418068 295351 Direct 704.8 43204 93658 69084 51.3%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 116.47 704.83 0.00 0.00 0.00 1.4155 0.0000 48693074.69 48693074.69 0.00% 295351.19 295351.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.71% 343.33 241 480 43203.75 6270 196547 43219.51 37888 49811 14832636 14832636 0.00%
crit 51.29% 361.50 267 458 93658.20 12791 400955 93689.61 84528 102814 33860439 33860439 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    aoe
    [M]:1.37
  • if_expr:buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
    aoe
    [R]:115.66
  • if_expr:spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Solar)4851710.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Sunfire16481550.283Mastery
Sunfire 60990 8.4% 1.0 0.00s 18286251 19412156 Direct 1.0 5558 11337 7186 28.2%
Periodic 1810.2 7138 15195 10099 36.7% 99.8%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 1810.18 1810.18 0.00 0.9425 0.9934 18286251.36 18286251.36 0.00% 10163.75 19412156.43
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.77% 0.72 0 1 5557.90 5526 5593 3989.06 0 5593 3989 3989 0.00%
crit 28.23% 0.28 0 1 11336.91 11273 11411 3199.88 0 11411 3200 3200 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 63.26% 1145.08 885 1440 7137.97 5547 12249 7139.33 6924 7357 8173008 8173008 0.00%
crit 36.74% 665.11 493 834 15195.26 11315 24988 15199.86 14779 15761 10106055 10106055 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.26
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    aoe
    [I]:1.00
  • target_if_expr:refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (5272) 0.0% (0.7%) 8.3 32.36s 191396 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.27 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 2754 0.4% 8.3 32.36s 99992 0 Direct 49.6 12992 26495 16672 27.2%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.27 49.65 0.00 0.00 0.00 0.0000 0.0000 827385.71 827385.71 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.79% 36.14 6 84 12992.49 12846 14733 12990.56 12846 13765 469496 469496 0.00%
crit 27.21% 13.51 1 41 26494.88 26205 30055 26489.66 26205 30055 357890 357890 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:39522.22
  • base_dd_max:39522.22
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 2518 0.3% 15.9 15.59s 47571 0 Direct 95.4 6183 12603 7929 27.2%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.90 95.39 0.00 0.00 0.00 0.0000 0.0000 756324.37 756324.37 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.80% 69.45 17 159 6182.65 6112 7010 6181.68 6112 6600 429365 429365 0.00%
crit 27.20% 25.94 4 67 12602.60 12469 14301 12602.94 12469 13673 326960 326960 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18805.57
  • base_dd_max:18805.57
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 3457 0.5% 26.0 10.56s 40170 51919 Direct 25.8 28666 58555 40390 39.2%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.96 25.82 0.00 0.00 0.00 0.7737 0.0000 1042749.48 1042749.48 0.00% 51919.41 51919.41
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 60.78% 15.70 5 26 28666.04 12768 51954 28611.13 20450 35231 449844 449844 0.00%
crit 39.22% 10.13 2 22 58554.99 26046 105985 58447.57 32557 75447 592905 592905 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    aoe
    [O]:24.02
  • if_expr:!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.800Spell Data
Eclipse (Solar)4851710.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Lunar)4851810.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
447+470 2p+2p
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+470 2p+2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+470 2p+2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+470 2p+2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 181.01s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    aoe
    [N]:2.00
  • if_expr:variable.cd_condition_aoe

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.2 103.00s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.19 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+470 2p+2p
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:57075.72
  • base_dd_max:57075.72
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.41s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+470 2p+2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.75
Elemental Potion of Ultimate Power 1.4 305.56s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.45 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.44
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 17.7 5.4 17.5s 13.7s 9.5s 55.67% 57.45% 5.4 (17.4) 17.1

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 52.0s
  • trigger_min/max:0.0s / 37.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.8s
  • uptime_min/max:51.33% / 59.17%

Stack Uptimes

  • balance_of_all_things_arcane_1:5.80%
  • balance_of_all_things_arcane_2:6.20%
  • balance_of_all_things_arcane_3:6.66%
  • balance_of_all_things_arcane_4:7.04%
  • balance_of_all_things_arcane_5:7.28%
  • balance_of_all_things_arcane_6:7.47%
  • balance_of_all_things_arcane_7:7.58%
  • balance_of_all_things_arcane_8:7.63%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 10.1 0.0 30.1s 30.1s 7.9s 26.83% 29.79% 0.0 (0.0) 9.9

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.2s / 46.5s
  • trigger_min/max:5.1s / 46.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.9s
  • uptime_min/max:24.49% / 29.95%

Stack Uptimes

  • balance_of_all_things_nature_1:3.32%
  • balance_of_all_things_nature_2:3.33%
  • balance_of_all_things_nature_3:3.34%
  • balance_of_all_things_nature_4:3.35%
  • balance_of_all_things_nature_5:3.36%
  • balance_of_all_things_nature_6:3.37%
  • balance_of_all_things_nature_7:3.38%
  • balance_of_all_things_nature_8:3.38%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Best Friends with Aerwynn 2.8 0.0 70.6s 70.6s 10.8s 10.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 329.8s
  • trigger_min/max:12.0s / 329.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 34.95%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.89%
  • best_friends_with_aerwynn_2:0.90%
  • best_friends_with_aerwynn_3:0.90%
  • best_friends_with_aerwynn_4:0.90%
  • best_friends_with_aerwynn_5:0.91%
  • best_friends_with_aerwynn_6:0.91%
  • best_friends_with_aerwynn_7:0.91%
  • best_friends_with_aerwynn_8:0.91%
  • best_friends_with_aerwynn_9:0.92%
  • best_friends_with_aerwynn_10:0.92%
  • best_friends_with_aerwynn_11:0.92%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 112.4s 70.6s 44.7s 33.06% 0.00% 70.4 (70.4) 0.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:15.3s / 347.2s
  • trigger_min/max:12.0s / 329.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 261.3s
  • uptime_min/max:0.00% / 94.72%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.06%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.9 0.0 68.7s 68.7s 10.8s 10.30% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 320.5s
  • trigger_min/max:12.0s / 320.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 32.06%

Stack Uptimes

  • best_friends_with_pip_1:0.92%
  • best_friends_with_pip_2:0.92%
  • best_friends_with_pip_3:0.93%
  • best_friends_with_pip_4:0.93%
  • best_friends_with_pip_5:0.93%
  • best_friends_with_pip_6:0.94%
  • best_friends_with_pip_7:0.94%
  • best_friends_with_pip_8:0.94%
  • best_friends_with_pip_9:0.95%
  • best_friends_with_pip_10:0.95%
  • best_friends_with_pip_11:0.95%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 1.0 111.9s 68.7s 45.8s 34.08% 0.00% 70.1 (70.1) 0.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.9s / 347.9s
  • trigger_min/max:12.0s / 320.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 325.4s
  • uptime_min/max:0.00% / 96.38%

Stack Uptimes

  • best_friends_with_pip_static_1:34.08%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 70.7s 70.7s 10.7s 10.02% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 316.8s
  • trigger_min/max:12.0s / 316.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 28.83%

Stack Uptimes

  • best_friends_with_urctos_1:0.89%
  • best_friends_with_urctos_2:0.90%
  • best_friends_with_urctos_3:0.90%
  • best_friends_with_urctos_4:0.90%
  • best_friends_with_urctos_5:0.91%
  • best_friends_with_urctos_6:0.91%
  • best_friends_with_urctos_7:0.91%
  • best_friends_with_urctos_8:0.92%
  • best_friends_with_urctos_9:0.92%
  • best_friends_with_urctos_10:0.93%
  • best_friends_with_urctos_11:0.93%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 113.5s 70.7s 44.5s 32.87% 0.00% 69.7 (69.7) 0.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 344.4s
  • trigger_min/max:12.0s / 316.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 259.8s
  • uptime_min/max:0.00% / 95.74%

Stack Uptimes

  • best_friends_with_urctos_static_1:32.87%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.50% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.50%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 61.5s 57.6s 49.5s 79.98% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 310.0s
  • trigger_min/max:15.0s / 298.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 317.2s
  • uptime_min/max:49.42% / 100.00%

Stack Uptimes

  • corrupting_rage_1:79.98%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dreamstate 15.0 0.2 20.7s 21.5s 2.2s 10.85% 20.44% 0.2 (0.4) 0.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 54.0s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.4s
  • uptime_min/max:7.13% / 14.57%

Stack Uptimes

  • dreamstate_1:7.27%
  • dreamstate_2:3.59%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 13.1 7.9 24.0s 15.1s 21.3s 92.99% 93.67% 7.9 (7.9) 12.2

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.7s / 68.0s
  • trigger_min/max:0.0s / 56.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 65.2s
  • uptime_min/max:89.71% / 95.72%

Stack Uptimes

  • eclipse_lunar_1:92.99%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 8.1 0.0 38.6s 38.6s 19.2s 52.17% 54.09% 0.0 (0.0) 7.8

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 82.2s
  • trigger_min/max:12.0s / 82.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.75% / 59.19%

Stack Uptimes

  • eclipse_solar_1:52.17%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 305.6s 305.6s 27.3s 12.95% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 325.4s
  • trigger_min/max:300.0s / 325.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.77% / 17.82%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.95%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Fury of Elune 5.1 0.0 64.5s 64.5s 7.9s 13.52% 0.00% 76.1 (76.1) 5.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:60.0s / 88.6s
  • trigger_min/max:60.0s / 88.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:11.70% / 15.45%

Stack Uptimes

  • fury_of_elune_1:13.52%

Spelldata

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 8.1 0.0 38.6s 38.6s 19.2s 52.17% 54.80% 0.0 (0.0) 7.8

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 82.2s
  • trigger_min/max:12.0s / 82.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.75% / 59.19%

Stack Uptimes

  • incarnation_chosen_of_elune_1:52.17%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.7 0.0 91.0s 91.0s 19.6s 23.99% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:55.09

Trigger Details

  • interval_min/max:90.0s / 102.0s
  • trigger_min/max:90.0s / 102.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 20.0s
  • uptime_min/max:21.39% / 26.97%

Stack Uptimes

  • kindled_soul_5:1.17%
  • kindled_soul_10:1.17%
  • kindled_soul_15:1.18%
  • kindled_soul_20:1.18%
  • kindled_soul_25:1.18%
  • kindled_soul_30:1.19%
  • kindled_soul_35:1.19%
  • kindled_soul_40:1.19%
  • kindled_soul_45:1.19%
  • kindled_soul_50:1.20%
  • kindled_soul_55:1.20%
  • kindled_soul_60:1.20%
  • kindled_soul_65:1.21%
  • kindled_soul_70:1.21%
  • kindled_soul_75:1.21%
  • kindled_soul_80:1.22%
  • kindled_soul_85:1.22%
  • kindled_soul_90:1.22%
  • kindled_soul_95:1.23%
  • kindled_soul_100:1.23%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Vigil 3.7 0.0 90.4s 90.4s 14.8s 18.42% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.5s
  • trigger_min/max:90.0s / 91.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.50% / 21.00%

Stack Uptimes

  • natures_vigil_1:18.42%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.0 70.3s 69.6s 0.9s 0.74% 1.15% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 328.9s
  • trigger_min/max:0.1s / 328.9s
  • trigger_pct:14.70%
  • duration_min/max:0.0s / 6.1s
  • uptime_min/max:0.00% / 3.38%

Stack Uptimes

  • owlkin_frenzy_1:0.74%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 9.1 95.2 34.5s 34.5s 30.3s 91.24% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:21.8s / 45.7s
  • trigger_min/max:21.8s / 45.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.4s
  • uptime_min/max:87.96% / 94.40%

Stack Uptimes

  • primordial_arcanic_pulsar_5:7.15%
  • primordial_arcanic_pulsar_10:6.77%
  • primordial_arcanic_pulsar_15:7.78%
  • primordial_arcanic_pulsar_20:8.24%
  • primordial_arcanic_pulsar_25:8.45%
  • primordial_arcanic_pulsar_30:8.17%
  • primordial_arcanic_pulsar_35:8.73%
  • primordial_arcanic_pulsar_40:9.14%
  • primordial_arcanic_pulsar_45:9.01%
  • primordial_arcanic_pulsar_50:8.87%
  • primordial_arcanic_pulsar_55:8.94%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 19.8 3.2 15.6s 13.7s 6.6s 43.67% 42.85% 3.2 (3.2) 19.4

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 42.3s
  • trigger_min/max:0.0s / 37.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:39.37% / 46.82%

Stack Uptimes

  • solstice_1:43.67%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starfall 103.3 0.0 143.3s 2.9s 296.3s 98.87% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_starfall
  • max_stacks:20
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:asynchronous
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.9s / 355.9s
  • trigger_min/max:0.7s / 8.5s
  • trigger_pct:99.99%
  • duration_min/max:44.4s / 357.4s
  • uptime_min/max:98.39% / 99.47%

Stack Uptimes

  • starfall_1:5.66%
  • starfall_2:33.86%
  • starfall_3:41.93%
  • starfall_4:14.09%
  • starfall_5:3.02%
  • starfall_6:0.31%

Spelldata

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]
  • max_stacks:20
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Starlord 21.0 82.4 14.5s 2.9s 14.0s 97.51% 0.00% 41.1 (41.1) 6.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 18.6s
  • trigger_min/max:0.8s / 8.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:94.83% / 99.39%

Stack Uptimes

  • starlord_1:12.87%
  • starlord_2:18.00%
  • starlord_3:66.64%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Umbral Embrace 22.9 2.7 12.8s 11.4s 1.6s 12.40% 0.00% 2.7 (2.7) 0.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_umbral_embrace
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 54.5s
  • trigger_min/max:0.0s / 54.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.0s
  • uptime_min/max:4.00% / 22.24%

Stack Uptimes

  • umbral_embrace_1:12.40%

Spelldata

  • id:393763
  • name:Umbral Embrace
  • tooltip:Your next Wrath or Starfire cast during an Eclipse deals Astral damage and deals {$=}w1% additional damage.
  • description:{$@spelldesc393760=Dealing Astral damage has a chance to cause your next Wrath or Starfire cast during an Eclipse to become Astral and deal {$s1=25}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Wafting Devotion 4.3 1.2 60.7s 44.8s 16.6s 23.72% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 200.9s
  • trigger_min/max:0.0s / 200.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.0s
  • uptime_min/max:5.21% / 56.59%

Stack Uptimes

  • wafting_devotion_1:23.72%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Primordial Arcanic Pulsar 8.1 6.0 10.0 35.7s 24.2s 46.5s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.05% 0.00% 0.57% 0.0s 0.0s 1.1s
Astral Smolder 73.75% 64.30% 84.05% 4.1s 0.0s 42.0s
Incarnation (Total) 52.17% 46.75% 59.19% 19.2s 0.0s 54.0s
Incarnation (Pulsar) 31.92% 28.70% 34.45% 11.8s 0.0s 12.0s
Lunar Eclipse Only 40.82% 33.32% 46.56% 9.6s 0.0s 15.0s
No Eclipse 6.97% 4.28% 10.29% 1.7s 0.0s 4.3s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Fury of Elune4.8200.00028.55924.7496.88071.153

Eclipse Utilization

NoneSolarLunarBoth
Wrath23.96100.0%0.000.0%0.000.0%0.000.0%
Starfire2.382.0%0.000.0%49.8642.4%65.2355.5%
Starfall21.297.2%0.000.0%119.3240.3%155.7752.6%
Fury of Elune22.293.0%0.000.0%142.4318.9%589.4178.2%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
447+470 2p+2p
Fury of EluneAstral Power81.00242.645.88%3.000.370.15%
MoonfireAstral Power3.0018.000.44%6.000.000.00%
Orbit BreakerAstral Power15.51463.4911.23%29.881.830.39%
Shooting Stars (Moonfire)Astral Power231.93463.5711.24%2.000.290.06%
Shooting Stars (Sunfire)Astral Power233.84467.4211.33%2.000.260.05%
StarfireAstral Power117.472205.4053.45%18.7732.901.47%
SunfireAstral Power1.006.000.15%6.000.000.00%
WrathAstral Power25.96259.586.29%10.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
447+470 2p+2p
StarfallAstral Power 104.954136.46100.00%39.4140.0216403.03
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 712000.0 3319.85 3832.96 2658353.3 557942.2 6049.1 712000.0
Astral Power 20.0 13.74 13.57 35.7 52.7 0.6 99.8

Statistics & Data Analysis

Fight Length
447+470 2p+2p Fight Length
Count 2069
Mean 300.24
Minimum 240.01
Maximum 359.95
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 19.97%
Standard Deviation 34.2333
5th Percentile 245.90
95th Percentile 353.68
( 95th Percentile - 5th Percentile ) 107.78
Mean Distribution
Standard Deviation 0.7526
95.00% Confidence Interval ( 298.77 - 301.72 )
Normalized 95.00% Confidence Interval ( 99.51% - 100.49% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 500
0.1% Error 49941
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1001
DPS
447+470 2p+2p Damage Per Second
Count 2069
Mean 723644.97
Minimum 669520.93
Maximum 780109.83
Spread ( max - min ) 110588.90
Range [ ( max - min ) / 2 * 100% ] 7.64%
Standard Deviation 16533.1369
5th Percentile 698098.98
95th Percentile 751741.21
( 95th Percentile - 5th Percentile ) 53642.24
Mean Distribution
Standard Deviation 363.4754
95.00% Confidence Interval ( 722932.57 - 724357.37 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2006
0.1 Scale Factor Error with Delta=300 2333427
0.05 Scale Factor Error with Delta=300 9333708
0.01 Scale Factor Error with Delta=300 233342686
Priority Target DPS
447+470 2p+2p Priority Target Damage Per Second
Count 2069
Mean 131837.96
Minimum 120132.98
Maximum 148584.78
Spread ( max - min ) 28451.79
Range [ ( max - min ) / 2 * 100% ] 10.79%
Standard Deviation 4062.1050
5th Percentile 125417.92
95th Percentile 138821.38
( 95th Percentile - 5th Percentile ) 13403.46
Mean Distribution
Standard Deviation 89.3040
95.00% Confidence Interval ( 131662.93 - 132013.00 )
Normalized 95.00% Confidence Interval ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3647
0.1 Scale Factor Error with Delta=300 140860
0.05 Scale Factor Error with Delta=300 563438
0.01 Scale Factor Error with Delta=300 14085945
DPS(e)
447+470 2p+2p Damage Per Second (Effective)
Count 2069
Mean 723644.97
Minimum 669520.93
Maximum 780109.83
Spread ( max - min ) 110588.90
Range [ ( max - min ) / 2 * 100% ] 7.64%
Damage
447+470 2p+2p Damage
Count 2069
Mean 216969848.25
Minimum 171279246.09
Maximum 265207445.97
Spread ( max - min ) 93928199.88
Range [ ( max - min ) / 2 * 100% ] 21.65%
DTPS
447+470 2p+2p Damage Taken Per Second
Count 2069
Mean 3832.09
Minimum 1090.62
Maximum 7807.61
Spread ( max - min ) 6716.99
Range [ ( max - min ) / 2 * 100% ] 87.64%
HPS
447+470 2p+2p Healing Per Second
Count 2069
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
447+470 2p+2p Healing Per Second (Effective)
Count 2069
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
447+470 2p+2p Heal
Count 2069
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
447+470 2p+2p Healing Taken Per Second
Count 2069
Mean 3311.67
Minimum 843.08
Maximum 6979.41
Spread ( max - min ) 6136.34
Range [ ( max - min ) / 2 * 100% ] 92.65%
TMI
447+470 2p+2p Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
447+470 2p+2pTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
447+470 2p+2p Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.44 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.69 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.75 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.aoe
# count action,conditions
0.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
0.00 variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
I 1.00 sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
J 3.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
0.00 variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
K 14.04 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
L 68.89 starfall,if=variable.starfall_condition1
M 1.37 starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
0.00 celestial_alignment,if=variable.cd_condition_aoe
N 2.00 incarnation,if=variable.cd_condition_aoe
0.00 warrior_of_elune
0.00 variable,name=enter_solar,value=spell_targets.starfire<3
0.00 starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
O 24.02 wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
0.00 wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
P 5.14 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
Q 34.46 starfall,if=variable.starfall_condition2
0.00 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+50
0.00 convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 new_moon,if=astral_power.deficit>variable.passive_asp+10
0.00 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
R 115.66 starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
0.00 wrath
S 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFIJLJJMLNDEPQRRLRLLRLRKLQRQRRRRLRLRRKLQQRRLRRLRLRRLRQQROOQRRLRLRRLQQRRPOOLRLLRKLRQRRQOORRKLRFQRQRERLRLRKLQOORQRLRRLRRLOOQRQRRRLRRLPQQRRLRLRLOORLRQRRQRLROORLQRRQRRLLRRFKLQROONQERRRLRLRRLPQLRLRLRLRRKLQQRRRRLLRRKLQOOQRRRLRRLRQQRQRRRLRLOOKLRQRLRRLRRKLOOFQRQRRRLEPKLRQQRRLRLOOLRRLQRRRLDRLOORKLRQRQRRLRLRKLO

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask 447+470 2p+2p 0.0/100: 0% astral_power
Pre precombat 1 food 447+470 2p+2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 2 augmentation 447+470 2p+2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 4 no_cd_talent 447+470 2p+2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 5 on_use_trinket 447+470 2p+2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 6 on_use_trinket 447+470 2p+2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 7 on_use_trinket 447+470 2p+2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 10.0/100: 10% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil 447+470 2p+2p 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.000 aoe I sunfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.944 aoe J moonfire Fluffy_Pillow 47.2/100: 47% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, wafting_devotion, corrupting_rage
0:01.817 aoe L starfall Fluffy_Pillow 57.2/100: 57% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, dreamstate, wafting_devotion, corrupting_rage
0:02.689 aoe J moonfire enemy2 14.2/100: 14% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate, wafting_devotion, corrupting_rage
0:03.527 aoe J moonfire enemy4 56.2/100: 56% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate, wafting_devotion, corrupting_rage
0:04.363 aoe M starfire Fluffy_Pillow 66.2/100: 66% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, wafting_devotion, corrupting_rage
0:05.120 aoe L starfall Fluffy_Pillow 87.4/100: 87% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, wafting_devotion, corrupting_rage
0:05.960 aoe N incarnation_chosen_of_elune Fluffy_Pillow 48.4/100: 48% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), wafting_devotion, corrupting_rage
0:05.960 default D potion Fluffy_Pillow 48.4/100: 48% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), wafting_devotion, corrupting_rage
0:05.960 default E use_items Fluffy_Pillow 48.4/100: 48% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:05.960 aoe P fury_of_elune Fluffy_Pillow 48.4/100: 48% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:06.714 aoe Q starfall Fluffy_Pillow 55.4/100: 55% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:07.470 aoe R starfire Fluffy_Pillow 36.4/100: 36% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), dreamstate, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:08.225 aoe R starfire Fluffy_Pillow 66.6/100: 67% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:08.981 aoe L starfall Fluffy_Pillow 97.8/100: 98% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:09.738 aoe R starfire Fluffy_Pillow 69.8/100: 70% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:10.797 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
0:11.551 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(4), starlord(3), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:12.306 aoe R starfire Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(5), starlord(3), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
0:13.368 aoe L starfall Fluffy_Pillow 99.2/100: 99% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(4), starlord(3), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:14.122 aoe R starfire Fluffy_Pillow 70.2/100: 70% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(5), starlord(3), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:15.183 aoe K cancel_buff Fluffy_Pillow 91.4/100: 91% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:15.183 aoe L starfall Fluffy_Pillow 91.4/100: 91% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:15.976 aoe Q starfall Fluffy_Pillow 56.4/100: 56% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(5), starlord, best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:16.801 aoe R starfire Fluffy_Pillow 25.4/100: 25% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(6), starlord(2), best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:17.990 aoe Q starfall Fluffy_Pillow 48.6/100: 49% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(5), starlord(2), best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:18.784 aoe R starfire Fluffy_Pillow 15.6/100: 16% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(6), starlord(3), best_friends_with_pip(8), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:19.930 aoe R starfire Fluffy_Pillow 34.8/100: 35% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), best_friends_with_pip(7), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:21.077 aoe R starfire Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:22.224 aoe R starfire Fluffy_Pillow 75.2/100: 75% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(3), starlord(3), best_friends_with_pip(5), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:23.372 aoe L starfall Fluffy_Pillow 96.4/100: 96% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(2), starlord(3), best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:24.136 aoe R starfire Fluffy_Pillow 61.4/100: 61% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_pip(3), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:25.283 aoe L starfall Fluffy_Pillow 84.6/100: 85% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:26.049 aoe R starfire Fluffy_Pillow 53.6/100: 54% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_pip, best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power
0:27.196 aoe R starfire Fluffy_Pillow 78.8/100: 79% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power
0:28.340 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power
0:28.340 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power
0:29.197 aoe Q starfall Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord, best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power
0:30.022 aoe Q starfall Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(2), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power
0:30.815 aoe R starfire Fluffy_Pillow 7.0/100: 7% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), solstice, starfall(5), starlord(3), umbral_embrace, best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power
0:31.960 aoe R starfire Fluffy_Pillow 62.2/100: 62% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power
0:33.107 aoe L starfall Fluffy_Pillow 85.4/100: 85% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power
0:33.873 aoe R starfire Fluffy_Pillow 52.4/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power
0:35.019 aoe R starfire Fluffy_Pillow 71.6/100: 72% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power
0:36.166 aoe L starfall Fluffy_Pillow 94.8/100: 95% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), best_friends_with_pip_static, corrupting_rage
0:36.931 aoe R starfire Fluffy_Pillow 61.8/100: 62% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), best_friends_with_pip_static, corrupting_rage
0:38.079 aoe L starfall Fluffy_Pillow 85.0/100: 85% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
0:38.845 aoe R starfire Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage
0:39.990 aoe R starfire Fluffy_Pillow 73.2/100: 73% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage
0:41.136 aoe L starfall Fluffy_Pillow 92.4/100: 92% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage
0:42.131 aoe R starfire Fluffy_Pillow 61.4/100: 61% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), umbral_embrace, best_friends_with_pip_static, corrupting_rage
0:43.623 aoe Q starfall Fluffy_Pillow 82.6/100: 83% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), best_friends_with_pip_static, corrupting_rage
0:44.736 aoe Q starfall Fluffy_Pillow 49.6/100: 50% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord, best_friends_with_pip_static, corrupting_rage
0:45.806 aoe R starfire Fluffy_Pillow 14.6/100: 15% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord(2), best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage
0:47.350 aoe O wrath Fluffy_Pillow 39.8/100: 40% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(2), best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage
0:48.380 aoe O wrath Fluffy_Pillow 51.8/100: 52% astral_power primordial_arcanic_pulsar(45), starfall(3), starlord(2), dreamstate, best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage
0:49.135 aoe Q starfall Fluffy_Pillow 63.8/100: 64% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(3), starlord(2), dreamstate, best_friends_with_pip(8), best_friends_with_pip_static, corrupting_rage
0:50.268 aoe R starfire Fluffy_Pillow 24.8/100: 25% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), best_friends_with_pip(7), best_friends_with_pip_static, corrupting_rage
0:51.251 aoe R starfire Fluffy_Pillow 48.0/100: 48% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage
0:52.890 aoe L starfall Fluffy_Pillow 77.2/100: 77% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage
0:53.983 aoe R starfire Fluffy_Pillow 68.2/100: 68% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), best_friends_with_pip(3), best_friends_with_pip_static, corrupting_rage
0:55.620 aoe L starfall Fluffy_Pillow 91.4/100: 91% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage
0:56.712 aoe R starfire Fluffy_Pillow 50.4/100: 50% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage
0:58.203 aoe R starfire Fluffy_Pillow 79.6/100: 80% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
0:59.693 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), best_friends_with_pip_static, corrupting_rage
1:00.804 aoe Q starfall Fluffy_Pillow 71.0/100: 71% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord, best_friends_with_pip_static, corrupting_rage
1:01.874 aoe Q starfall Fluffy_Pillow 40.0/100: 40% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(2), best_friends_with_pip_static, corrupting_rage
1:02.904 aoe R starfire Fluffy_Pillow 7.0/100: 7% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), best_friends_with_pip_static, corrupting_rage
1:04.393 aoe R starfire Fluffy_Pillow 28.2/100: 28% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage
1:05.885 aoe P fury_of_elune Fluffy_Pillow 49.4/100: 49% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage
1:06.955 aoe O wrath Fluffy_Pillow 52.4/100: 52% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage
1:07.949 aoe O wrath Fluffy_Pillow 68.4/100: 68% astral_power fury_of_elune, primordial_arcanic_pulsar(15), starfall(2), starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage
1:08.703 aoe L starfall Fluffy_Pillow 86.4/100: 86% astral_power balance_of_all_things_arcane(8), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(2), starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage
1:09.796 aoe R starfire Fluffy_Pillow 51.4/100: 51% astral_power balance_of_all_things_arcane(7), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
1:10.779 aoe L starfall Fluffy_Pillow 80.6/100: 81% astral_power balance_of_all_things_arcane(6), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall, starlord(3), best_friends_with_pip_static, corrupting_rage
1:11.873 aoe L starfall Fluffy_Pillow 79.6/100: 80% astral_power balance_of_all_things_arcane(5), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
1:12.966 aoe R starfire Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_arcane(4), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage
1:14.604 aoe K cancel_buff Fluffy_Pillow 80.8/100: 81% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage
1:14.604 aoe L starfall Fluffy_Pillow 80.8/100: 81% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(30), starfall(3), best_friends_with_pip_static, corrupting_rage
1:15.828 aoe R starfire Fluffy_Pillow 35.8/100: 36% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(4), starlord, best_friends_with_pip_static, corrupting_rage
1:17.591 aoe Q starfall Fluffy_Pillow 55.0/100: 55% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord, best_friends_with_pip_static, corrupting_rage
1:18.768 aoe R starfire Fluffy_Pillow 10.0/100: 10% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(4), starlord(2), best_friends_with_pip_static, corrupting_rage
1:20.467 aoe R starfire Fluffy_Pillow 31.2/100: 31% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), best_friends_with_pip_static, corrupting_rage
1:22.165 aoe Q starfall Fluffy_Pillow 50.4/100: 50% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), best_friends_with_pip_static, corrupting_rage
1:23.300 aoe O wrath Fluffy_Pillow 9.4/100: 9% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
1:24.393 aoe O wrath Fluffy_Pillow 23.4/100: 23% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage
1:25.148 aoe R starfire Fluffy_Pillow 33.4/100: 33% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
1:26.130 aoe R starfire Fluffy_Pillow 58.6/100: 59% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), best_friends_with_pip_static, corrupting_rage
1:27.768 aoe K cancel_buff Fluffy_Pillow 83.8/100: 84% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), best_friends_with_pip_static, corrupting_rage
1:27.768 aoe L starfall Fluffy_Pillow 83.8/100: 84% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, best_friends_with_pip_static, corrupting_rage
1:28.991 aoe R starfire Fluffy_Pillow 42.8/100: 43% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, best_friends_with_pip_static, corrupting_rage
1:30.754 default F natures_vigil 447+470 2p+2p 72.0/100: 72% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord, best_friends_with_pip_static, corrupting_rage
1:30.754 aoe Q starfall Fluffy_Pillow 72.0/100: 72% astral_power natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord, best_friends_with_pip_static, corrupting_rage
1:31.929 aoe R starfire Fluffy_Pillow 29.0/100: 29% astral_power natures_vigil, balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(2), best_friends_with_pip_static, corrupting_rage
1:33.629 aoe Q starfall Fluffy_Pillow 50.2/100: 50% astral_power natures_vigil, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(2), best_friends_with_pip_static, corrupting_rage
1:34.763 aoe R starfire Fluffy_Pillow 43.2/100: 43% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage
1:36.253 default E use_items Fluffy_Pillow 68.4/100: 68% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
1:36.253 aoe R starfire Fluffy_Pillow 68.4/100: 68% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
1:37.743 aoe L starfall Fluffy_Pillow 95.6/100: 96% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(95)
1:38.737 aoe R starfire Fluffy_Pillow 66.6/100: 67% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(90)
1:40.225 aoe L starfall Fluffy_Pillow 89.8/100: 90% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(85)
1:41.219 aoe R starfire Fluffy_Pillow 58.8/100: 59% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(80)
1:42.708 aoe K cancel_buff Fluffy_Pillow 80.0/100: 80% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(70)
1:42.708 aoe L starfall Fluffy_Pillow 80.0/100: 80% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(70)
1:43.819 aoe Q starfall Fluffy_Pillow 45.0/100: 45% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord, best_friends_with_pip_static, corrupting_rage, kindled_soul(65)
1:44.890 aoe O wrath Fluffy_Pillow 12.0/100: 12% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage, kindled_soul(60)
1:45.919 aoe O wrath Fluffy_Pillow 24.0/100: 24% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(2), dreamstate, best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage, kindled_soul(55)
1:46.673 aoe R starfire Fluffy_Pillow 36.0/100: 36% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(2), best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage, kindled_soul(50)
1:47.695 aoe Q starfall Fluffy_Pillow 59.2/100: 59% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(2), best_friends_with_pip(8), best_friends_with_pip_static, corrupting_rage, kindled_soul(45)
1:48.826 aoe R starfire Fluffy_Pillow 18.2/100: 18% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), best_friends_with_pip(7), best_friends_with_pip_static, corrupting_rage, kindled_soul(40)
1:50.462 aoe L starfall Fluffy_Pillow 45.4/100: 45% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), best_friends_with_pip(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(30)
1:51.557 aoe R starfire Fluffy_Pillow 4.4/100: 4% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), umbral_embrace, best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage, kindled_soul(25)
1:53.194 aoe R starfire Fluffy_Pillow 57.6/100: 58% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), best_friends_with_pip(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(20)
1:54.832 aoe L starfall Fluffy_Pillow 76.8/100: 77% astral_power eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), best_friends_with_pip, best_friends_with_pip_static, corrupting_rage, kindled_soul(10)
1:55.925 aoe R starfire Fluffy_Pillow 31.8/100: 32% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), umbral_embrace, best_friends_with_pip_static, corrupting_rage, kindled_soul(5)
1:57.563 aoe R starfire Fluffy_Pillow 57.0/100: 57% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
1:59.201 aoe L starfall Fluffy_Pillow 80.2/100: 80% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, best_friends_with_pip_static, corrupting_rage
2:00.425 aoe O wrath Fluffy_Pillow 37.2/100: 37% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord, best_friends_with_pip_static, corrupting_rage
2:01.602 aoe O wrath Fluffy_Pillow 51.2/100: 51% astral_power primordial_arcanic_pulsar(40), starfall(2), starlord, dreamstate, best_friends_with_pip_static, corrupting_rage
2:02.358 aoe Q starfall Fluffy_Pillow 61.2/100: 61% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(40), solstice, starfall(2), starlord, umbral_embrace, dreamstate, best_friends_with_pip_static, corrupting_rage
2:03.534 aoe R starfire Fluffy_Pillow 22.2/100: 22% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), umbral_embrace, best_friends_with_pip_static, corrupting_rage
2:04.554 aoe Q starfall Fluffy_Pillow 45.4/100: 45% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), best_friends_with_pip_static, corrupting_rage
2:05.689 aoe R starfire Fluffy_Pillow 6.4/100: 6% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage
2:07.326 aoe R starfire Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
2:08.963 aoe R starfire Fluffy_Pillow 54.8/100: 55% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(50), starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
2:10.601 aoe L starfall Fluffy_Pillow 76.0/100: 76% astral_power eclipse_lunar, primordial_arcanic_pulsar(50), starfall, starlord(3), best_friends_with_pip_static, corrupting_rage
2:11.695 aoe R starfire Fluffy_Pillow 35.0/100: 35% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
2:13.333 aoe R starfire Fluffy_Pillow 54.2/100: 54% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall, starlord(3), best_friends_with_pip_static, corrupting_rage
2:14.969 aoe L starfall Fluffy_Pillow 73.4/100: 73% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall, best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage
2:16.194 aoe P fury_of_elune Fluffy_Pillow 34.4/100: 34% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord, best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage
2:17.264 aoe Q starfall Fluffy_Pillow 76.4/100: 76% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord, best_friends_with_pip(8), best_friends_with_pip_static, corrupting_rage
2:18.336 aoe Q starfall Fluffy_Pillow 51.4/100: 51% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), best_friends_with_pip(7), best_friends_with_pip_static, corrupting_rage
2:19.366 aoe R starfire Fluffy_Pillow 26.4/100: 26% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage
2:20.855 aoe R starfire Fluffy_Pillow 58.6/100: 59% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), best_friends_with_pip(5), best_friends_with_pip_static, corrupting_rage
2:22.345 aoe L starfall Fluffy_Pillow 92.8/100: 93% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_pip(3), best_friends_with_pip_static
2:23.339 aoe R starfire Fluffy_Pillow 63.8/100: 64% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_pip(2), best_friends_with_pip_static
2:24.828 aoe L starfall Fluffy_Pillow 93.0/100: 93% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_pip, best_friends_with_pip_static
2:25.823 aoe R starfire Fluffy_Pillow 58.0/100: 58% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), best_friends_with_pip_static
2:27.311 aoe L starfall Fluffy_Pillow 72.0/100: 72% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), dreamstate(2), best_friends_with_pip(10), best_friends_with_pip_static
2:28.404 aoe O wrath Fluffy_Pillow 29.0/100: 29% astral_power primordial_arcanic_pulsar(25), starfall(3), starlord(3), dreamstate, best_friends_with_pip(9), best_friends_with_pip_static
2:29.159 aoe O wrath Fluffy_Pillow 39.0/100: 39% astral_power primordial_arcanic_pulsar(25), starfall(3), starlord(3), best_friends_with_pip(8), best_friends_with_pip_static
2:29.912 aoe R starfire Fluffy_Pillow 49.0/100: 49% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), best_friends_with_pip(8), best_friends_with_pip_static
2:31.551 aoe L starfall Fluffy_Pillow 74.2/100: 74% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), best_friends_with_pip(6), best_friends_with_pip_static
2:32.773 aoe R starfire Fluffy_Pillow 35.2/100: 35% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, best_friends_with_pip(5), best_friends_with_pip_static
2:34.537 aoe Q starfall Fluffy_Pillow 60.4/100: 60% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord, best_friends_with_pip(3), best_friends_with_pip_static
2:35.714 aoe R starfire Fluffy_Pillow 19.4/100: 19% astral_power balance_of_all_things_arcane(3), eclipse_lunar, owlkin_frenzy, primordial_arcanic_pulsar(35), solstice, starfall(2), starlord(2), best_friends_with_pip(2), best_friends_with_pip_static
2:36.848 aoe R starfire Fluffy_Pillow 40.6/100: 41% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(2), best_friends_with_pip, best_friends_with_pip_static
2:38.547 aoe Q starfall Fluffy_Pillow 61.8/100: 62% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(2), best_friends_with_pip_static, corrupting_rage
2:39.681 aoe R starfire Fluffy_Pillow 20.8/100: 21% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
2:41.319 aoe L starfall Fluffy_Pillow 72.0/100: 72% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
2:42.412 aoe R starfire Fluffy_Pillow 27.0/100: 27% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage
2:44.050 aoe O wrath Fluffy_Pillow 48.2/100: 48% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
2:45.145 aoe O wrath Fluffy_Pillow 60.2/100: 60% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage
2:45.898 aoe R starfire Fluffy_Pillow 70.2/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
2:46.882 aoe L starfall Fluffy_Pillow 95.4/100: 95% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, best_friends_with_pip_static, corrupting_rage
2:48.105 aoe Q starfall Fluffy_Pillow 58.4/100: 58% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, best_friends_with_pip_static, corrupting_rage
2:49.282 aoe R starfire Fluffy_Pillow 17.4/100: 17% astral_power balance_of_all_things_arcane(5), eclipse_lunar, owlkin_frenzy, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), best_friends_with_pip_static, corrupting_rage
2:50.416 aoe R starfire Fluffy_Pillow 40.6/100: 41% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(2), best_friends_with_pip_static, corrupting_rage
2:52.115 aoe Q starfall Fluffy_Pillow 69.8/100: 70% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:53.164 aoe R starfire Fluffy_Pillow 28.8/100: 29% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:54.543 aoe R starfire Fluffy_Pillow 54.0/100: 54% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:55.921 aoe L starfall Fluffy_Pillow 79.2/100: 79% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:56.840 aoe L starfall Fluffy_Pillow 50.2/100: 50% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:57.762 aoe R starfire Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:59.140 aoe R starfire Fluffy_Pillow 72.4/100: 72% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:00.519 default F natures_vigil 447+470 2p+2p 93.6/100: 94% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:00.754 aoe K cancel_buff Fluffy_Pillow 93.6/100: 94% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:00.754 aoe L starfall Fluffy_Pillow 93.6/100: 94% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:01.785 aoe Q starfall Fluffy_Pillow 60.6/100: 61% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord, best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:02.777 aoe R starfire Fluffy_Pillow 25.6/100: 26% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:04.206 aoe O wrath Fluffy_Pillow 41.6/100: 42% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(3), starlord(2), dreamstate, best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:04.960 aoe O wrath Fluffy_Pillow 51.6/100: 52% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(2), starlord(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:05.714 aoe N incarnation_chosen_of_elune Fluffy_Pillow 61.6/100: 62% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(2), best_friends_with_pip_static, corrupting_rage
3:05.960 aoe Q starfall Fluffy_Pillow 67.6/100: 68% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(2), dreamstate(2), best_friends_with_pip_static, corrupting_rage
3:06.990 default E use_items Fluffy_Pillow 34.6/100: 35% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), dreamstate(2), best_friends_with_pip_static, corrupting_rage
3:06.990 aoe R starfire Fluffy_Pillow 34.6/100: 35% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
3:07.886 aoe R starfire Fluffy_Pillow 57.8/100: 58% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
3:08.779 aoe R starfire Fluffy_Pillow 79.0/100: 79% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(95)
3:10.269 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), solstice, starfall, starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(85)
3:11.263 aoe R starfire Fluffy_Pillow 71.0/100: 71% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(80)
3:12.754 aoe L starfall Fluffy_Pillow 94.2/100: 94% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(75)
3:13.748 aoe R starfire Fluffy_Pillow 61.2/100: 61% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(70)
3:15.235 aoe R starfire Fluffy_Pillow 82.4/100: 82% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(60)
3:16.725 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(55)
3:17.836 aoe P fury_of_elune Fluffy_Pillow 67.0/100: 67% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord, best_friends_with_pip_static, corrupting_rage, kindled_soul(50)
3:18.907 aoe Q starfall Fluffy_Pillow 75.0/100: 75% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(40), starfall(2), starlord, best_friends_with_pip_static, corrupting_rage, kindled_soul(45)
3:19.976 aoe L starfall Fluffy_Pillow 48.0/100: 48% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), starfall(3), starlord(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(40)
3:21.004 aoe R starfire Fluffy_Pillow 21.0/100: 21% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(30)
3:22.493 aoe L starfall Fluffy_Pillow 83.2/100: 83% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(3), starlord(3), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage, kindled_soul(25)
3:23.488 aoe R starfire Fluffy_Pillow 56.2/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(4), starlord(3), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage, kindled_soul(20)
3:24.977 aoe L starfall Fluffy_Pillow 86.4/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(3), starlord(3), best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage, kindled_soul(15)
3:25.971 aoe R starfire Fluffy_Pillow 61.4/100: 61% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(4), starlord(3), umbral_embrace, best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage, kindled_soul(10)
3:27.461 aoe L starfall Fluffy_Pillow 88.6/100: 89% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage
3:28.456 aoe R starfire Fluffy_Pillow 57.6/100: 58% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage
3:29.945 aoe R starfire Fluffy_Pillow 80.8/100: 81% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage
3:31.435 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage
3:31.435 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage
3:32.547 aoe Q starfall Fluffy_Pillow 69.0/100: 69% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord, best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage
3:33.617 aoe Q starfall Fluffy_Pillow 38.0/100: 38% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(2), best_friends_with_urctos_static, corrupting_rage
3:34.646 aoe R starfire Fluffy_Pillow 7.0/100: 7% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), best_friends_with_urctos_static, corrupting_rage
3:36.137 aoe R starfire Fluffy_Pillow 30.2/100: 30% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), best_friends_with_urctos_static, corrupting_rage
3:37.626 aoe R starfire Fluffy_Pillow 49.4/100: 49% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), best_friends_with_urctos_static, corrupting_rage
3:39.115 aoe R starfire Fluffy_Pillow 70.6/100: 71% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), best_friends_with_urctos_static, corrupting_rage
3:40.607 aoe L starfall Fluffy_Pillow 91.8/100: 92% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall, starlord(3), best_friends_with_urctos_static, corrupting_rage
3:41.601 aoe L starfall Fluffy_Pillow 58.8/100: 59% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:42.521 aoe R starfire Fluffy_Pillow 23.8/100: 24% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:43.901 aoe R starfire Fluffy_Pillow 79.0/100: 79% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:45.278 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:45.278 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:46.307 aoe Q starfall Fluffy_Pillow 67.0/100: 67% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:47.298 aoe O wrath Fluffy_Pillow 34.0/100: 34% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:48.252 aoe O wrath Fluffy_Pillow 44.0/100: 44% astral_power primordial_arcanic_pulsar(40), starfall(4), starlord(2), umbral_embrace, dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:49.008 aoe Q starfall Fluffy_Pillow 56.0/100: 56% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(40), solstice, starfall(3), starlord(2), umbral_embrace, dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:50.058 aoe R starfire Fluffy_Pillow 15.0/100: 15% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(3), starlord(3), umbral_embrace, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:50.968 aoe R starfire Fluffy_Pillow 38.2/100: 38% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(3), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:52.483 aoe R starfire Fluffy_Pillow 65.4/100: 65% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(3), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:54.002 aoe L starfall Fluffy_Pillow 90.6/100: 91% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:55.012 aoe R starfire Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(50), starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:56.528 aoe R starfire Fluffy_Pillow 68.8/100: 69% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(50), starfall(2), starlord(3), best_friends_with_urctos_static, corrupting_rage
3:58.165 aoe L starfall Fluffy_Pillow 90.0/100: 90% astral_power eclipse_lunar, primordial_arcanic_pulsar(50), starfall, starlord(3), best_friends_with_urctos_static, corrupting_rage
3:59.258 aoe R starfire Fluffy_Pillow 47.0/100: 47% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:00.773 aoe Q starfall Fluffy_Pillow 70.2/100: 70% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:01.905 aoe Q starfall Fluffy_Pillow 35.2/100: 35% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:02.894 aoe R starfire Fluffy_Pillow 34.2/100: 34% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:04.325 aoe Q starfall Fluffy_Pillow 59.4/100: 59% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:05.280 aoe R starfire Fluffy_Pillow 28.4/100: 28% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:06.660 aoe R starfire Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), best_friends_with_pip(10), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:08.038 aoe R starfire Fluffy_Pillow 76.8/100: 77% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_pip(9), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:09.417 aoe L starfall Fluffy_Pillow 98.0/100: 98% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_pip(8), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:10.337 aoe R starfire Fluffy_Pillow 67.0/100: 67% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_pip(7), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:11.716 aoe L starfall Fluffy_Pillow 86.2/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_pip(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:12.634 aoe O wrath Fluffy_Pillow 51.2/100: 51% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(2), starlord(3), best_friends_with_pip(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:13.554 aoe O wrath Fluffy_Pillow 65.2/100: 65% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), dreamstate, best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage
4:14.307 aoe K cancel_buff Fluffy_Pillow 75.2/100: 75% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), dreamstate, best_friends_with_pip(3), best_friends_with_pip_static, corrupting_rage
4:14.307 aoe L starfall Fluffy_Pillow 75.2/100: 75% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), dreamstate, best_friends_with_pip(3), best_friends_with_pip_static, corrupting_rage
4:15.529 aoe R starfire Fluffy_Pillow 38.2/100: 38% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord, best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage
4:16.589 aoe Q starfall Fluffy_Pillow 61.4/100: 61% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord, best_friends_with_pip_static, corrupting_rage
4:17.765 aoe R starfire Fluffy_Pillow 22.4/100: 22% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(2), best_friends_with_pip_static, corrupting_rage
4:19.464 aoe L starfall Fluffy_Pillow 47.6/100: 48% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(2), best_friends_with_pip_static, corrupting_rage
4:20.598 aoe R starfire Fluffy_Pillow 6.6/100: 7% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), best_friends_with_pip_static
4:22.235 aoe R starfire Fluffy_Pillow 59.8/100: 60% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), best_friends_with_pip_static
4:23.873 aoe L starfall Fluffy_Pillow 79.0/100: 79% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static
4:24.966 aoe R starfire Fluffy_Pillow 34.0/100: 34% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static
4:26.605 aoe R starfire Fluffy_Pillow 57.2/100: 57% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static
4:28.242 aoe K cancel_buff Fluffy_Pillow 80.4/100: 80% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static
4:28.242 aoe L starfall Fluffy_Pillow 80.4/100: 80% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static
4:29.465 aoe O wrath Fluffy_Pillow 37.4/100: 37% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord, dreamstate, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static
4:30.221 aoe O wrath Fluffy_Pillow 49.4/100: 49% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord, best_friends_with_aerwynn(4), best_friends_with_aerwynn_static
4:30.977 default F natures_vigil 447+470 2p+2p 61.4/100: 61% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord, best_friends_with_aerwynn(4), best_friends_with_aerwynn_static
4:30.977 aoe Q starfall Fluffy_Pillow 61.4/100: 61% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord, best_friends_with_aerwynn(4), best_friends_with_aerwynn_static
4:32.154 aoe R starfire Fluffy_Pillow 22.4/100: 22% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static
4:33.852 aoe Q starfall Fluffy_Pillow 45.6/100: 46% astral_power natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), best_friends_with_aerwynn, best_friends_with_aerwynn_static
4:34.987 aoe R starfire Fluffy_Pillow 4.6/100: 5% astral_power natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), umbral_embrace, best_friends_with_aerwynn_static
4:36.626 aoe R starfire Fluffy_Pillow 33.8/100: 34% astral_power natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
4:38.142 aoe R starfire Fluffy_Pillow 55.0/100: 55% astral_power natures_vigil, balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
4:39.656 aoe L starfall Fluffy_Pillow 78.2/100: 78% astral_power natures_vigil, eclipse_lunar, primordial_arcanic_pulsar(55), starfall, starlord(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
4:40.667 default E use_items Fluffy_Pillow 37.2/100: 37% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
4:40.667 aoe P fury_of_elune Fluffy_Pillow 37.2/100: 37% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(100)
4:41.587 aoe K cancel_buff Fluffy_Pillow 44.2/100: 44% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(100)
4:41.587 aoe L starfall Fluffy_Pillow 44.2/100: 44% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(100)
4:42.617 aoe R starfire Fluffy_Pillow 19.2/100: 19% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(95)
4:44.098 aoe Q starfall Fluffy_Pillow 81.4/100: 81% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(85)
4:45.087 aoe Q starfall Fluffy_Pillow 60.4/100: 60% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(2), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(80)
4:46.043 aoe R starfire Fluffy_Pillow 37.4/100: 37% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(4), starlord(3), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(75)
4:47.422 aoe R starfire Fluffy_Pillow 67.6/100: 68% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(4), starlord(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(70)
4:48.800 aoe L starfall Fluffy_Pillow 95.8/100: 96% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(60)
4:49.721 aoe R starfire Fluffy_Pillow 62.8/100: 63% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(55)
4:51.101 aoe L starfall Fluffy_Pillow 86.0/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(50)
4:52.021 aoe O wrath Fluffy_Pillow 53.0/100: 53% astral_power primordial_arcanic_pulsar(25), starfall(4), starlord(3), dreamstate, best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(45)
4:52.774 aoe O wrath Fluffy_Pillow 63.0/100: 63% astral_power primordial_arcanic_pulsar(25), starfall(3), starlord(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(40)
4:53.530 aoe L starfall Fluffy_Pillow 73.0/100: 73% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(40)
4:54.621 aoe R starfire Fluffy_Pillow 32.0/100: 32% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(35)
4:56.259 aoe R starfire Fluffy_Pillow 59.2/100: 59% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(25)
4:57.894 aoe L starfall Fluffy_Pillow 84.4/100: 84% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(15)
4:59.119 aoe Q starfall Fluffy_Pillow 45.4/100: 45% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord, best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(10)
5:00.295 aoe R starfire Fluffy_Pillow 4.4/100: 4% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(5)
5:01.994 aoe R starfire Fluffy_Pillow 23.6/100: 24% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), best_friends_with_aerwynn_static, corrupting_rage
5:03.692 aoe R starfire Fluffy_Pillow 44.8/100: 45% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), best_friends_with_aerwynn_static, corrupting_rage
5:05.390 aoe L starfall Fluffy_Pillow 66.0/100: 66% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), best_friends_with_aerwynn_static, corrupting_rage
5:06.523 default D potion Fluffy_Pillow 53.0/100: 53% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
5:06.523 aoe R starfire Fluffy_Pillow 53.0/100: 53% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
5:08.159 aoe L starfall Fluffy_Pillow 74.2/100: 74% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall, starlord(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
5:09.252 aoe O wrath Fluffy_Pillow 29.2/100: 29% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord(3), dreamstate, best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
5:10.008 aoe O wrath Fluffy_Pillow 41.2/100: 41% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
5:10.762 aoe R starfire Fluffy_Pillow 53.2/100: 53% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
5:12.398 aoe K cancel_buff Fluffy_Pillow 76.4/100: 76% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, elemental_potion_of_ultimate_power
5:12.398 aoe L starfall Fluffy_Pillow 76.4/100: 76% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), best_friends_with_aerwynn_static, elemental_potion_of_ultimate_power
5:13.620 aoe R starfire Fluffy_Pillow 35.4/100: 35% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord, best_friends_with_aerwynn_static, elemental_potion_of_ultimate_power
5:15.382 aoe Q starfall Fluffy_Pillow 66.6/100: 67% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord, best_friends_with_aerwynn_static, wafting_devotion, elemental_potion_of_ultimate_power
5:16.472 aoe R starfire Fluffy_Pillow 25.6/100: 26% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(2), best_friends_with_aerwynn_static, wafting_devotion, elemental_potion_of_ultimate_power
5:17.902 aoe Q starfall Fluffy_Pillow 48.8/100: 49% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(2), best_friends_with_aerwynn_static, wafting_devotion, elemental_potion_of_ultimate_power
5:18.856 aoe R starfire Fluffy_Pillow 19.8/100: 20% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, elemental_potion_of_ultimate_power
5:20.235 aoe R starfire Fluffy_Pillow 49.0/100: 49% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, elemental_potion_of_ultimate_power
5:21.613 aoe L starfall Fluffy_Pillow 74.2/100: 74% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, elemental_potion_of_ultimate_power
5:22.533 aoe R starfire Fluffy_Pillow 39.2/100: 39% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, elemental_potion_of_ultimate_power
5:23.911 aoe L starfall Fluffy_Pillow 92.4/100: 92% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, elemental_potion_of_ultimate_power
5:24.832 aoe R starfire Fluffy_Pillow 57.4/100: 57% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, elemental_potion_of_ultimate_power
5:26.210 aoe K cancel_buff Fluffy_Pillow 78.6/100: 79% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, elemental_potion_of_ultimate_power
5:26.210 aoe L starfall Fluffy_Pillow 78.6/100: 79% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), best_friends_with_aerwynn_static, wafting_devotion, elemental_potion_of_ultimate_power
5:27.240 aoe O wrath Fluffy_Pillow 47.6/100: 48% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (tauren) Raid-Buffed Unbuffed Gear Amount
Strength 898 2 986 900 0
Agility 2089 -2 2173 2087 0
Stamina 3848 2 35600 33905 29988
Intellect 2089 -2 13499 12687 9996 (6121)
Spirit 0 0 0 0 0
Health 712000 712000 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13499 12687 0
Crit 27.17% 20.96% 2873
Haste 22.98% 22.98% 3906
Versatility 6.13% 1.13% 232
Mana Regen 2560 2560 0
Attack Power 14039 13194 0
Mastery 28.99% 28.99% 7497
Armor 4506 4506 4506
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 467.00
Local Head Benevolent Embersage's Casque
ilevel: 470, stats: { 585 Armor, +3163 Sta, +655 Crit, +307 Haste, +786 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }, enchant: incandescent_essence
Local Neck Eye of the Rising Flame
ilevel: 470, stats: { +1779 Sta, +233 Haste, +1397 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Life-Bound Shoulderpads
ilevel: 447, stats: { 456 Armor, +1796 Sta, +328 Mastery, +328 Haste, +476 AgiInt }
item effects: { equip: Toxified }
Local Chest Benevolent Embersage's Robe
ilevel: 470, stats: { 780 Armor, +3163 Sta, +665 Crit, +296 Mastery, +786 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 470, stats: { 439 Armor, +2372 Sta, +497 Haste, +224 Mastery, +590 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 470, stats: { 683 Armor, +3163 Sta, +656 Haste, +305 Mastery, +786 AgiInt }, enchant: { +155 StrAgiInt, +41 Vers (lambent_armor_kit_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 470, stats: { 488 Armor, +2372 Sta, +257 Crit, +412 Haste, +590 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Thermal Bindings
ilevel: 470, stats: { 390 Armor, +1779 Sta, +178 Crit, +363 Mastery, +442 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Benevolent Embersage's Talons
ilevel: 447, stats: { 373 Armor, +1796 Sta, +191 Vers, +464 Mastery, +476 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 470, stats: { +1779 Sta, +466 Haste, +1165 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 470, stats: { +1779 Sta, +1118 Crit, +512 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 470, stats: { +747 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 470, stats: { +687 Mastery }
item effects: { use: Balefire Branch }
Local Back Drape of the Loyal Vassal
ilevel: 470, stats: { 312 Armor, +1779 Sta, +305 Haste, +236 Mastery, +442 StrAgiInt }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 470, weapon: { 508 - 654, 2.6 }, stats: { +393 Int, +1896 Int, +1581 Sta, +145 Haste, +335 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 470, stats: { +1206 Int, +1581 Sta, +162 Haste, +319 Mastery }

Profile

druid="447+470 2p+2p"
source=default
spec=balance
level=70
race=tauren
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:hissing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Balance APL can be found at https://balance-simc.github.io/Balance-SimC/balance.txt

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=470,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=470,gem_id=192961/192961/192961
shoulders=lifebound_shoulderpads,id=193406,bonus_id=8836/1576/8797/8960,ilevel=447,crafted_stats=49/36
back=drape_of_the_loyal_vassal,id=158375,bonus_id=4795,ilevel=470
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=470,enchant_id=6625
wrists=thermal_bindings,id=134461,bonus_id=4795,ilevel=470,gem_id=192961
hands=benevolent_embersages_talons,id=207255,bonus_id=4795,ilevel=447
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=470,enchant_id=6830
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=470
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=470
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=470
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=470,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=470

# Gear Summary
# gear_ilvl=467.13
# gear_stamina=29988
# gear_intellect=9996
# gear_crit_rating=2873
# gear_haste_rating=3906
# gear_mastery_rating=7497
# gear_versatility_rating=232
# gear_armor=4506
# set_bonus=tier30_2pc=1
# set_bonus=tier31_2pc=1

460 T31 2p : 702661 dps, 128418 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
702660.8 702660.8 693.1 / 0.099% 63775.6 / 9.1% 51685.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.6 13.8 Astral Power 0.00% 55.7 99.8% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
460 T31 2p 702661
Astral Smolder 99546 14.2% 370.6 0.87s 80341 0 Periodic 731.8 40682 0 40682 0.0% 81.2%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 370.57 0.00 731.80 731.80 282.58 0.0000 2.0000 29771975.44 29771975.44 0.00% 20341.65 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 731.80 548 933 40682.19 3444 201160 40739.95 35055 46498 29771975 29771975 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Fury of Elune 20521 2.9% 5.1 64.51s 1197144 1220780 Direct 754.8 5106 11062 8130 50.8%

Stats Details: Fury Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.13 754.76 0.00 0.00 0.00 0.9807 0.0000 6135642.77 6135642.77 0.00% 1220780.49 1220780.49
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.22% 371.51 230 511 5105.72 2750 16198 5115.16 4552 5749 1896751 1896751 0.00%
crit 50.78% 383.24 263 525 11061.68 5611 33044 11065.98 10138 12565 4238892 4238892 0.00%

Action Details: Fury Of Elune

  • id:202770
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:astral_power
  • energize_amount:3.0

Spelldata

  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r

Action Details: Fury Of Elune Tick

  • id:211545
  • school:astral
  • range:105.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.149000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:211545
  • name:Fury of Elune
  • school:astral
  • tooltip:
  • description:{$@spelldesc202770=Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r}

Action Priority List

    aoe
    [P]:5.12
  • if_expr:target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Hungering Shadowflame 2925 0.4% 17.0 17.18s 51554 0 Direct 17.0 40111 81918 51570 27.4%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.01 17.01 0.00 0.00 0.00 0.0000 0.0000 877135.47 877135.47 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.61% 12.35 3 25 40110.98 26983 154715 39906.65 26983 76072 495473 495473 0.00%
crit 27.39% 4.66 0 13 81917.96 55045 315618 80693.01 0 278586 381663 381663 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24191.79
  • base_dd_max:24191.79
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 5589 0.8% 33.8 8.91s 49447 0 Direct 33.7 38642 78773 49586 27.3%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.84 33.75 0.00 0.00 0.00 0.0000 0.0000 1673287.66 1673287.66 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.74% 24.55 7 43 38641.91 38195 43801 38642.76 38195 39775 948514 948514 0.00%
crit 27.26% 9.20 1 21 78772.71 77919 89355 78774.47 77919 86973 724773 724773 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:34245.43
  • base_dd_max:34245.43
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 60357 8.6% 3.0 1.08s 6023231 6453462 Direct 6.0 5935 12102 8920 48.5%
Periodic 1795.0 7005 14499 10038 40.5% 98.9%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.00 6.00 1795.02 1795.02 0.00 0.9334 0.9930 18069692.37 18069692.37 0.00% 10121.98 6453461.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 51.53% 3.09 0 6 5934.91 5879 6741 5845.41 0 6741 18348 18348 0.00%
crit 48.47% 2.91 0 6 12101.89 11992 13753 11864.21 0 13753 35195 35195 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 59.54% 1068.83 806 1326 7005.44 5648 11309 7004.27 6825 7176 7487280 7487280 0.00%
crit 40.46% 726.19 534 915 14499.18 11521 23071 14499.85 14123 14871 10528870 10528870 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    aoe
    [J]:3.00
  • if_expr:!fight_style.dungeonroute
  • target_if_expr:refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (60855) 0.0% (8.7%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 15067 2.1% 231.7 1.48s 19462 0 Direct 231.1 12375 26572 19515 50.3%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 231.72 231.11 0.00 0.00 0.00 0.0000 0.0000 4509827.92 4509827.92 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.72% 114.90 71 163 12374.54 9269 22286 12374.56 11672 13145 1421728 1421728 0.00%
crit 50.28% 116.21 72 165 26572.35 18909 45463 26586.15 25072 28471 3088100 3088100 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 15143 2.2% 233.8 1.49s 19384 0 Direct 233.2 12342 26514 19435 50.1%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 233.82 233.21 0.00 0.00 0.00 0.0000 0.0000 4532400.91 4532400.91 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.95% 116.48 71 174 12341.74 8394 22286 12342.83 11650 13117 1437517 1437517 0.00%
crit 50.05% 116.73 74 166 26514.23 17124 45463 26525.24 24952 28302 3094884 3094884 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 30645 4.4% 15.5 19.51s 591033 0 Direct 92.8 62928 135103 98795 49.7%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.51 92.82 0.00 0.00 0.00 0.0000 0.0000 9169849.07 9169849.07 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 50.31% 46.70 24 74 62927.61 34603 221727 62941.54 51508 75345 2938789 2938789 0.00%
crit 49.69% 46.12 24 74 135102.62 70590 459061 135089.39 107998 164679 6231060 6231060 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:enemy5
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfall 228814 32.6% 103.2 2.87s 663112 646345 Direct 1766.9 25664 55509 38741 43.8%

Stats Details: Starfall

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 103.23 1766.94 0.00 0.00 0.00 1.0259 0.0000 68449877.85 68449877.85 0.00% 646345.03 646345.03
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.18% 992.74 715 1262 25664.44 6274 91122 25711.01 23343 28472 25477648 25477648 0.00%
crit 43.82% 774.21 582 1019 55509.47 12798 185888 55584.19 51550 59992 42972230 42972230 0.00%

Action Details: Starfall

  • id:191034
  • school:astral
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:45.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]

Action Details: Starfall Damage

  • id:191037
  • school:astral
  • range:200.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.114000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.41

Spelldata

  • id:191037
  • name:Starfall
  • school:astral
  • tooltip:
  • description:{$@spelldesc191034=Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]}

Action Priority List

    aoe
    [L]:69.05
  • if_expr:variable.starfall_condition1
    aoe
    [Q]:34.18
  • if_expr:variable.starfall_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountLunar Shrapnel4151691PCT0.200
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 163902 23.3% 116.3 2.54s 421759 298120 Direct 703.6 43618 94511 69694 51.2%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 116.27 703.63 0.00 0.00 0.00 1.4147 0.0000 49038920.64 49038920.64 0.00% 298119.81 298119.81
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.76% 343.12 250 442 43617.52 6332 198041 43626.72 39245 48941 14964303 14964303 0.00%
crit 51.24% 360.51 274 476 94511.36 12916 405744 94553.40 86306 105392 34074617 34074617 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    aoe
    [M]:1.39
  • if_expr:buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
    aoe
    [R]:115.44
  • if_expr:spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Solar)4851710.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Sunfire16481550.283Mastery
Sunfire 51301 7.3% 1.0 0.00s 15350081 16312520 Direct 1.0 4676 9536 5969 26.6%
Periodic 1807.9 6006 12774 8488 36.7% 99.6%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 1807.90 1807.90 0.00 0.9415 0.9926 15350081.34 15350081.34 0.00% 8549.29 16312520.02
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.41% 0.73 0 1 4675.62 4647 4704 3432.45 0 4704 3432 3432 0.00%
crit 26.59% 0.27 0 1 9536.08 9480 9596 2535.54 0 9596 2536 2536 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 63.33% 1144.99 869 1422 6006.24 4667 10281 6007.41 5839 6166 6876717 6876717 0.00%
crit 36.67% 662.91 501 844 12773.53 9521 20974 12777.45 12336 13202 8467396 8467396 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    aoe
    [I]:1.00
  • target_if_expr:refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (5354) 0.0% (0.8%) 8.4 33.89s 191796 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.36 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy5
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 2800 0.4% 8.4 33.89s 100274 0 Direct 50.2 13014 26530 16708 27.4%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.36 50.18 0.00 0.00 0.00 0.0000 0.0000 838551.98 838551.98 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.64% 36.45 9 81 13014.28 12857 14744 13014.90 12857 13912 474371 474371 0.00%
crit 27.36% 13.73 0 35 26529.58 26228 30078 26521.54 0 29543 364181 364181 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:39522.22
  • base_dd_max:39522.22
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 2555 0.4% 16.1 16.48s 47606 0 Direct 96.5 6192 12622 7935 27.1%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.08 96.46 0.00 0.00 0.00 0.0000 0.0000 765362.81 765362.81 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.91% 70.33 14 181 6192.15 6118 7016 6192.19 6118 6620 435507 435507 0.00%
crit 27.09% 26.13 4 72 12621.56 12480 14312 12624.57 12480 13772 329856 329856 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18805.57
  • base_dd_max:18805.57
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 3497 0.5% 26.0 10.53s 40535 52450 Direct 25.8 28996 59136 40760 39.1%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.97 25.82 0.00 0.00 0.00 0.7729 0.0000 1052722.53 1052722.53 0.00% 52449.93 52449.93
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 60.92% 15.73 5 27 28995.57 12885 52930 28935.55 21128 37717 455981 455981 0.00%
crit 39.08% 10.09 2 22 59136.30 26286 105049 59041.49 32334 81277 596742 596742 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    aoe
    [O]:24.04
  • if_expr:!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.800Spell Data
Eclipse (Solar)4851710.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Lunar)4851810.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
460 T31 2p
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31 2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31 2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31 2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 181.02s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    aoe
    [N]:2.00
  • if_expr:variable.cd_condition_aoe

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.2 18.00s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.18 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31 2p
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:57075.72
  • base_dd_max:57075.72
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.43s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.75 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31 2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.75
Elemental Potion of Ultimate Power 1.4 306.68s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.44 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.43
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 17.6 5.4 17.6s 13.6s 9.5s 55.73% 57.54% 5.4 (17.4) 17.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 44.7s
  • trigger_min/max:0.1s / 37.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:51.07% / 58.93%

Stack Uptimes

  • balance_of_all_things_arcane_1:5.80%
  • balance_of_all_things_arcane_2:6.19%
  • balance_of_all_things_arcane_3:6.66%
  • balance_of_all_things_arcane_4:7.05%
  • balance_of_all_things_arcane_5:7.30%
  • balance_of_all_things_arcane_6:7.49%
  • balance_of_all_things_arcane_7:7.59%
  • balance_of_all_things_arcane_8:7.65%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 10.1 0.0 30.1s 30.1s 7.9s 26.86% 29.86% 0.0 (0.0) 9.9

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.3s / 47.2s
  • trigger_min/max:6.4s / 47.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:24.49% / 29.97%

Stack Uptimes

  • balance_of_all_things_nature_1:3.32%
  • balance_of_all_things_nature_2:3.33%
  • balance_of_all_things_nature_3:3.35%
  • balance_of_all_things_nature_4:3.36%
  • balance_of_all_things_nature_5:3.36%
  • balance_of_all_things_nature_6:3.37%
  • balance_of_all_things_nature_7:3.38%
  • balance_of_all_things_nature_8:3.39%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Best Friends with Aerwynn 2.8 0.0 68.2s 68.2s 10.8s 10.27% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 326.4s
  • trigger_min/max:12.0s / 326.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 11.0s
  • uptime_min/max:0.00% / 35.55%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.92%
  • best_friends_with_aerwynn_2:0.92%
  • best_friends_with_aerwynn_3:0.92%
  • best_friends_with_aerwynn_4:0.93%
  • best_friends_with_aerwynn_5:0.93%
  • best_friends_with_aerwynn_6:0.93%
  • best_friends_with_aerwynn_7:0.94%
  • best_friends_with_aerwynn_8:0.94%
  • best_friends_with_aerwynn_9:0.94%
  • best_friends_with_aerwynn_10:0.95%
  • best_friends_with_aerwynn_11:0.95%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 1.0 111.2s 68.2s 45.5s 33.38% 0.00% 69.4 (69.4) 0.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:13.9s / 336.5s
  • trigger_min/max:12.0s / 326.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 316.1s
  • uptime_min/max:0.00% / 94.35%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.38%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.9 0.0 69.6s 69.6s 10.8s 10.28% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 337.6s
  • trigger_min/max:12.0s / 337.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 31.30%

Stack Uptimes

  • best_friends_with_pip_1:0.92%
  • best_friends_with_pip_2:0.92%
  • best_friends_with_pip_3:0.92%
  • best_friends_with_pip_4:0.93%
  • best_friends_with_pip_5:0.93%
  • best_friends_with_pip_6:0.93%
  • best_friends_with_pip_7:0.94%
  • best_friends_with_pip_8:0.94%
  • best_friends_with_pip_9:0.95%
  • best_friends_with_pip_10:0.95%
  • best_friends_with_pip_11:0.95%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.3 0.9 110.7s 69.6s 44.1s 33.42% 0.00% 69.9 (69.9) 0.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:13.5s / 351.5s
  • trigger_min/max:12.0s / 337.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 245.8s
  • uptime_min/max:0.00% / 92.12%

Stack Uptimes

  • best_friends_with_pip_static_1:33.42%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 69.1s 69.1s 10.8s 10.17% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 322.1s
  • trigger_min/max:12.0s / 322.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 30.46%

Stack Uptimes

  • best_friends_with_urctos_1:0.91%
  • best_friends_with_urctos_2:0.91%
  • best_friends_with_urctos_3:0.92%
  • best_friends_with_urctos_4:0.92%
  • best_friends_with_urctos_5:0.92%
  • best_friends_with_urctos_6:0.92%
  • best_friends_with_urctos_7:0.93%
  • best_friends_with_urctos_8:0.93%
  • best_friends_with_urctos_9:0.93%
  • best_friends_with_urctos_10:0.94%
  • best_friends_with_urctos_11:0.94%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 1.0 112.2s 69.1s 44.8s 33.21% 0.00% 69.5 (69.5) 0.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:13.2s / 354.4s
  • trigger_min/max:12.0s / 322.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 252.6s
  • uptime_min/max:0.00% / 95.16%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.21%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.53% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.66%

Stack Uptimes

  • bloodlust_1:13.53%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.8 0.0 62.1s 58.5s 50.3s 80.27% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 319.0s
  • trigger_min/max:15.0s / 278.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 336.5s
  • uptime_min/max:47.41% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.27%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dreamstate 15.0 0.2 20.7s 21.5s 2.2s 10.80% 20.49% 0.2 (0.4) 0.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.6s / 54.0s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.3s
  • uptime_min/max:7.27% / 14.93%

Stack Uptimes

  • dreamstate_1:7.27%
  • dreamstate_2:3.54%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 13.1 7.9 23.9s 15.1s 21.3s 93.03% 93.72% 7.9 (7.9) 12.2

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.7s / 71.2s
  • trigger_min/max:0.1s / 56.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 68.4s
  • uptime_min/max:90.24% / 95.69%

Stack Uptimes

  • eclipse_lunar_1:93.03%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 8.1 0.0 38.5s 38.5s 19.1s 52.21% 54.13% 0.0 (0.0) 7.8

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 84.9s
  • trigger_min/max:12.0s / 84.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.75% / 59.32%

Stack Uptimes

  • eclipse_solar_1:52.21%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 305.8s 305.8s 27.3s 12.87% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 326.0s
  • trigger_min/max:300.0s / 326.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.77% / 17.81%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.87%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Fury of Elune 5.1 0.0 64.6s 64.6s 7.9s 13.54% 0.00% 76.0 (76.0) 5.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:60.0s / 88.8s
  • trigger_min/max:60.0s / 88.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:10.99% / 15.46%

Stack Uptimes

  • fury_of_elune_1:13.54%

Spelldata

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 8.1 0.0 38.5s 38.5s 19.1s 52.21% 54.84% 0.0 (0.0) 7.8

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 84.9s
  • trigger_min/max:12.0s / 84.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.75% / 59.32%

Stack Uptimes

  • incarnation_chosen_of_elune_1:52.21%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.7 0.0 91.0s 91.0s 19.5s 23.98% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:55.09

Trigger Details

  • interval_min/max:90.0s / 121.7s
  • trigger_min/max:90.0s / 121.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:21.28% / 26.88%

Stack Uptimes

  • kindled_soul_5:1.17%
  • kindled_soul_10:1.17%
  • kindled_soul_15:1.18%
  • kindled_soul_20:1.18%
  • kindled_soul_25:1.18%
  • kindled_soul_30:1.19%
  • kindled_soul_35:1.19%
  • kindled_soul_40:1.19%
  • kindled_soul_45:1.19%
  • kindled_soul_50:1.20%
  • kindled_soul_55:1.20%
  • kindled_soul_60:1.20%
  • kindled_soul_65:1.21%
  • kindled_soul_70:1.21%
  • kindled_soul_75:1.21%
  • kindled_soul_80:1.22%
  • kindled_soul_85:1.22%
  • kindled_soul_90:1.22%
  • kindled_soul_95:1.23%
  • kindled_soul_100:1.23%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Vigil 3.7 0.0 90.4s 90.4s 14.7s 18.43% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.5s
  • trigger_min/max:90.0s / 91.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s
  • uptime_min/max:16.54% / 21.04%

Stack Uptimes

  • natures_vigil_1:18.43%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.0 68.5s 67.9s 0.9s 0.76% 1.19% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 310.7s
  • trigger_min/max:0.1s / 310.7s
  • trigger_pct:14.90%
  • duration_min/max:0.0s / 5.4s
  • uptime_min/max:0.00% / 4.01%

Stack Uptimes

  • owlkin_frenzy_1:0.76%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 9.0 95.1 34.5s 34.5s 30.2s 91.25% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:21.2s / 45.7s
  • trigger_min/max:21.2s / 45.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.4s
  • uptime_min/max:87.71% / 94.13%

Stack Uptimes

  • primordial_arcanic_pulsar_5:7.18%
  • primordial_arcanic_pulsar_10:6.71%
  • primordial_arcanic_pulsar_15:7.73%
  • primordial_arcanic_pulsar_20:8.28%
  • primordial_arcanic_pulsar_25:8.48%
  • primordial_arcanic_pulsar_30:8.15%
  • primordial_arcanic_pulsar_35:8.68%
  • primordial_arcanic_pulsar_40:9.16%
  • primordial_arcanic_pulsar_45:8.99%
  • primordial_arcanic_pulsar_50:8.88%
  • primordial_arcanic_pulsar_55:8.99%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 19.8 3.3 15.6s 13.6s 6.6s 43.75% 42.95% 3.3 (3.3) 19.3

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 37.8s
  • trigger_min/max:0.1s / 37.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:39.47% / 46.57%

Stack Uptimes

  • solstice_1:43.75%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starfall 103.2 0.0 143.0s 2.9s 295.9s 98.87% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_starfall
  • max_stacks:20
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:asynchronous
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.9s / 357.0s
  • trigger_min/max:0.7s / 8.5s
  • trigger_pct:99.99%
  • duration_min/max:47.9s / 357.9s
  • uptime_min/max:98.39% / 99.49%

Stack Uptimes

  • starfall_1:5.67%
  • starfall_2:33.74%
  • starfall_3:41.90%
  • starfall_4:14.21%
  • starfall_5:3.03%
  • starfall_6:0.31%
  • starfall_7:0.00%

Spelldata

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]
  • max_stacks:20
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Starlord 20.9 82.3 14.5s 2.9s 13.9s 97.48% 0.00% 41.1 (41.1) 5.9

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 18.6s
  • trigger_min/max:0.8s / 8.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:94.95% / 99.07%

Stack Uptimes

  • starlord_1:12.83%
  • starlord_2:18.02%
  • starlord_3:66.63%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Umbral Embrace 22.8 2.6 12.8s 11.5s 1.6s 12.31% 0.00% 2.6 (2.6) 0.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_umbral_embrace
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 55.1s
  • trigger_min/max:0.0s / 55.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.8s
  • uptime_min/max:4.73% / 21.17%

Stack Uptimes

  • umbral_embrace_1:12.31%

Spelldata

  • id:393763
  • name:Umbral Embrace
  • tooltip:Your next Wrath or Starfire cast during an Eclipse deals Astral damage and deals {$=}w1% additional damage.
  • description:{$@spelldesc393760=Dealing Astral damage has a chance to cause your next Wrath or Starfire cast during an Eclipse to become Astral and deal {$s1=25}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Wafting Devotion 4.3 1.2 60.8s 45.5s 16.5s 23.83% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 200.9s
  • trigger_min/max:0.0s / 200.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 64.0s
  • uptime_min/max:5.06% / 58.19%

Stack Uptimes

  • wafting_devotion_1:23.83%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Primordial Arcanic Pulsar 8.1 6.0 10.0 35.7s 24.2s 47.2s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.05% 0.00% 0.44% 0.0s 0.0s 1.0s
Astral Smolder 73.73% 64.06% 82.42% 4.1s 0.0s 48.0s
Incarnation (Total) 52.21% 46.75% 59.32% 19.1s 0.0s 54.0s
Incarnation (Pulsar) 31.92% 29.15% 34.49% 11.8s 0.0s 12.0s
Lunar Eclipse Only 40.82% 33.68% 46.82% 9.5s 0.0s 15.0s
No Eclipse 6.93% 4.22% 9.76% 1.7s 0.0s 4.3s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Fury of Elune4.8650.00028.80724.9027.18875.456

Eclipse Utilization

NoneSolarLunarBoth
Wrath23.97100.0%0.000.0%0.000.0%0.000.0%
Starfire2.432.1%0.000.0%49.7242.4%65.1355.5%
Starfall21.117.1%0.000.0%119.0940.3%155.5752.6%
Fury of Elune20.802.8%0.000.0%145.9019.3%588.0677.9%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
460 T31 2p
Fury of EluneAstral Power80.91242.445.88%3.000.300.12%
MoonfireAstral Power3.0018.000.44%6.000.000.00%
Orbit BreakerAstral Power15.51463.4911.25%29.881.850.40%
Shooting Stars (Moonfire)Astral Power231.70463.1411.24%2.000.260.06%
Shooting Stars (Sunfire)Astral Power233.78467.2911.34%2.000.260.06%
StarfireAstral Power117.282201.0153.41%18.7733.321.49%
SunfireAstral Power1.006.000.15%6.000.000.00%
WrathAstral Power25.97259.676.30%10.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
460 T31 2p
StarfallAstral Power 104.774128.34100.00%39.4039.9916580.49
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 721120.0 3334.24 3847.39 2588496.0 567363.5 37235.5 721120.0
Astral Power 20.0 13.75 13.58 36.1 53.6 0.4 100.0

Statistics & Data Analysis

Fight Length
460 T31 2p Fight Length
Count 2140
Mean 299.63
Minimum 240.09
Maximum 359.98
Spread ( max - min ) 119.89
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 34.2341
5th Percentile 246.37
95th Percentile 353.66
( 95th Percentile - 5th Percentile ) 107.29
Mean Distribution
Standard Deviation 0.7400
95.00% Confidence Interval ( 298.18 - 301.08 )
Normalized 95.00% Confidence Interval ( 99.52% - 100.48% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 502
0.1% Error 50146
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1001
DPS
460 T31 2p Damage Per Second
Count 2140
Mean 702660.84
Minimum 652655.33
Maximum 770043.89
Spread ( max - min ) 117388.56
Range [ ( max - min ) / 2 * 100% ] 8.35%
Standard Deviation 16359.5554
5th Percentile 676560.50
95th Percentile 730222.16
( 95th Percentile - 5th Percentile ) 53661.66
Mean Distribution
Standard Deviation 353.6426
95.00% Confidence Interval ( 701967.71 - 703353.97 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2083
0.1 Scale Factor Error with Delta=300 2284687
0.05 Scale Factor Error with Delta=300 9138747
0.01 Scale Factor Error with Delta=300 228468674
Priority Target DPS
460 T31 2p Priority Target Damage Per Second
Count 2140
Mean 128417.94
Minimum 114426.83
Maximum 141913.23
Spread ( max - min ) 27486.40
Range [ ( max - min ) / 2 * 100% ] 10.70%
Standard Deviation 4083.5684
5th Percentile 121947.10
95th Percentile 135584.60
( 95th Percentile - 5th Percentile ) 13637.50
Mean Distribution
Standard Deviation 88.2740
95.00% Confidence Interval ( 128244.92 - 128590.95 )
Normalized 95.00% Confidence Interval ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3885
0.1 Scale Factor Error with Delta=300 142352
0.05 Scale Factor Error with Delta=300 569408
0.01 Scale Factor Error with Delta=300 14235193
DPS(e)
460 T31 2p Damage Per Second (Effective)
Count 2140
Mean 702660.84
Minimum 652655.33
Maximum 770043.89
Spread ( max - min ) 117388.56
Range [ ( max - min ) / 2 * 100% ] 8.35%
Damage
460 T31 2p Damage
Count 2140
Mean 210235328.74
Minimum 164324461.61
Maximum 258653786.12
Spread ( max - min ) 94329324.52
Range [ ( max - min ) / 2 * 100% ] 22.43%
DTPS
460 T31 2p Damage Taken Per Second
Count 2140
Mean 3849.34
Minimum 1077.54
Maximum 7957.00
Spread ( max - min ) 6879.45
Range [ ( max - min ) / 2 * 100% ] 89.36%
HPS
460 T31 2p Healing Per Second
Count 2140
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
460 T31 2p Healing Per Second (Effective)
Count 2140
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
460 T31 2p Heal
Count 2140
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
460 T31 2p Healing Taken Per Second
Count 2140
Mean 3328.31
Minimum 786.12
Maximum 7122.00
Spread ( max - min ) 6335.88
Range [ ( max - min ) / 2 * 100% ] 95.18%
TMI
460 T31 2p Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
460 T31 2pTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
460 T31 2p Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.43 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.69 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.75 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.aoe
# count action,conditions
0.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
0.00 variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
I 1.00 sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
J 3.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
0.00 variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
K 14.04 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
L 69.05 starfall,if=variable.starfall_condition1
M 1.39 starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
0.00 celestial_alignment,if=variable.cd_condition_aoe
N 2.00 incarnation,if=variable.cd_condition_aoe
0.00 warrior_of_elune
0.00 variable,name=enter_solar,value=spell_targets.starfire<3
0.00 starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
O 24.04 wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
0.00 wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
P 5.12 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
Q 34.18 starfall,if=variable.starfall_condition2
0.00 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+50
0.00 convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 new_moon,if=astral_power.deficit>variable.passive_asp+10
0.00 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
R 115.44 starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
0.00 wrath
S 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFIJJLJMLNDEPQRRLRLRLRLRKLLQRRRRLRRLRLRKLQRQRRRLLRRLRRKLQROOQRRLRRKLLRQRRLPRLOLORLQRRQRLRRLOOQFRRQREQRRRLKLRLOOQRRLRRKLQRRLOORLRLRRLPQRLRLLRRLOORLQRRQRRRLOKOLRQRQRRRLRKLLRFLOORLNERRLRKLQRPQRRLLRLRKLQRQRRRLRRKLQRQRRRLOLORKLQRRQRRRLLRKLQOORQRPRLRLRLRLOORLFRLRREKLRR

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask 460 T31 2p 0.0/100: 0% astral_power
Pre precombat 1 food 460 T31 2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 2 augmentation 460 T31 2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 4 no_cd_talent 460 T31 2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 5 on_use_trinket 460 T31 2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 6 on_use_trinket 460 T31 2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 7 on_use_trinket 460 T31 2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 10.0/100: 10% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil 460 T31 2p 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.000 aoe I sunfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.942 aoe J moonfire Fluffy_Pillow 45.2/100: 45% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:01.883 aoe J moonfire enemy2 53.2/100: 53% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, umbral_embrace, dreamstate, corrupting_rage
0:02.824 aoe L starfall Fluffy_Pillow 65.2/100: 65% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, umbral_embrace, dreamstate, corrupting_rage
0:03.764 aoe J moonfire enemy5 24.2/100: 24% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, umbral_embrace, dreamstate, corrupting_rage
0:04.670 aoe M starfire Fluffy_Pillow 64.2/100: 64% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, umbral_embrace, corrupting_rage
0:05.487 aoe L starfall Fluffy_Pillow 89.4/100: 89% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, corrupting_rage
0:06.394 aoe N incarnation_chosen_of_elune Fluffy_Pillow 48.4/100: 48% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(10), starfall(2), starlord(2), corrupting_rage
0:06.394 default D potion Fluffy_Pillow 48.4/100: 48% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), corrupting_rage
0:06.394 default E use_items Fluffy_Pillow 48.4/100: 48% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power
0:06.394 aoe P fury_of_elune Fluffy_Pillow 48.4/100: 48% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:07.186 aoe Q starfall Fluffy_Pillow 57.4/100: 57% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:07.978 aoe R starfire Fluffy_Pillow 32.4/100: 32% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), dreamstate, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:08.732 aoe R starfire Fluffy_Pillow 58.6/100: 59% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:09.484 aoe L starfall Fluffy_Pillow 87.8/100: 88% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:10.250 aoe R starfire Fluffy_Pillow 59.8/100: 60% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:11.396 aoe L starfall Fluffy_Pillow 96.0/100: 96% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:12.161 aoe R starfire Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(4), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:13.307 aoe L starfall Fluffy_Pillow 95.2/100: 95% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), starfall(4), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
0:14.072 aoe R starfire Fluffy_Pillow 66.2/100: 66% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(4), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:15.218 aoe L starfall Fluffy_Pillow 90.4/100: 90% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:15.984 aoe R starfire Fluffy_Pillow 57.4/100: 57% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:17.132 aoe K cancel_buff Fluffy_Pillow 80.6/100: 81% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:17.132 aoe L starfall Fluffy_Pillow 80.6/100: 81% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:17.988 aoe L starfall Fluffy_Pillow 47.6/100: 48% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:18.810 aoe Q starfall Fluffy_Pillow 44.6/100: 45% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(5), starlord(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:19.602 aoe R starfire Fluffy_Pillow 11.6/100: 12% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(5), starlord(3), umbral_embrace, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:20.748 aoe R starfire Fluffy_Pillow 32.8/100: 33% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(5), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:21.894 aoe R starfire Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:23.040 aoe R starfire Fluffy_Pillow 71.2/100: 71% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), best_friends_with_pip(11), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:24.187 aoe L starfall Fluffy_Pillow 90.4/100: 90% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(3), starlord(3), best_friends_with_pip(10), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:24.941 aoe R starfire Fluffy_Pillow 57.4/100: 57% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(4), starlord(3), best_friends_with_pip(10), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:26.001 aoe R starfire Fluffy_Pillow 78.6/100: 79% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(3), starlord(3), best_friends_with_pip(9), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:27.062 aoe L starfall Fluffy_Pillow 99.8/100: 100% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall, starlord(3), best_friends_with_pip(7), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:27.817 aoe R starfire Fluffy_Pillow 68.8/100: 69% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_pip(7), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:28.877 aoe L starfall Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_pip(6), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:29.633 aoe R starfire Fluffy_Pillow 63.0/100: 63% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_pip(5), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:30.695 aoe K cancel_buff Fluffy_Pillow 88.2/100: 88% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_pip(4), wafting_devotion, elemental_potion_of_ultimate_power
0:30.695 aoe L starfall Fluffy_Pillow 88.2/100: 88% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), best_friends_with_pip(4), wafting_devotion, elemental_potion_of_ultimate_power
0:31.490 aoe Q starfall Fluffy_Pillow 59.2/100: 59% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord, umbral_embrace, best_friends_with_pip(3), wafting_devotion, elemental_potion_of_ultimate_power
0:32.251 aoe R starfire Fluffy_Pillow 30.2/100: 30% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), solstice, starfall(4), starlord(2), umbral_embrace, best_friends_with_pip(2), wafting_devotion, elemental_potion_of_ultimate_power
0:33.352 aoe Q starfall Fluffy_Pillow 53.4/100: 53% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(2), best_friends_with_pip, wafting_devotion, elemental_potion_of_ultimate_power
0:34.108 aoe R starfire Fluffy_Pillow 20.4/100: 20% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(5), starlord(3), wafting_devotion, elemental_potion_of_ultimate_power
0:35.169 aoe R starfire Fluffy_Pillow 45.6/100: 46% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), wafting_devotion, elemental_potion_of_ultimate_power
0:36.229 aoe R starfire Fluffy_Pillow 64.8/100: 65% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), wafting_devotion, elemental_potion_of_ultimate_power
0:37.289 aoe L starfall Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), wafting_devotion
0:38.044 aoe L starfall Fluffy_Pillow 53.0/100: 53% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), wafting_devotion
0:38.798 aoe R starfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), wafting_devotion
0:39.857 aoe R starfire Fluffy_Pillow 69.2/100: 69% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3)
0:41.003 aoe L starfall Fluffy_Pillow 90.4/100: 90% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3)
0:41.996 aoe R starfire Fluffy_Pillow 57.4/100: 57% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3)
0:43.484 aoe R starfire Fluffy_Pillow 76.6/100: 77% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3)
0:44.971 aoe K cancel_buff Fluffy_Pillow 95.8/100: 96% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3)
0:44.971 aoe L starfall Fluffy_Pillow 95.8/100: 96% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3)
0:46.083 aoe Q starfall Fluffy_Pillow 60.8/100: 61% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), starlord, corrupting_rage
0:47.153 aoe R starfire Fluffy_Pillow 25.8/100: 26% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(2), corrupting_rage
0:48.696 aoe O wrath Fluffy_Pillow 43.8/100: 44% astral_power primordial_arcanic_pulsar(45), starfall(3), starlord(2), umbral_embrace, dreamstate, corrupting_rage
0:49.452 aoe O wrath Fluffy_Pillow 53.8/100: 54% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(2), umbral_embrace
0:50.206 aoe Q starfall Fluffy_Pillow 65.8/100: 66% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), umbral_embrace
0:51.341 aoe R starfire Fluffy_Pillow 26.8/100: 27% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), umbral_embrace
0:52.980 aoe R starfire Fluffy_Pillow 58.0/100: 58% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), wafting_devotion
0:54.493 aoe L starfall Fluffy_Pillow 85.2/100: 85% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), wafting_devotion
0:55.505 aoe R starfire Fluffy_Pillow 44.2/100: 44% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), wafting_devotion
0:57.021 aoe R starfire Fluffy_Pillow 65.4/100: 65% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), wafting_devotion
0:58.536 aoe K cancel_buff Fluffy_Pillow 86.6/100: 87% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall, starlord(3), wafting_devotion
0:58.536 aoe L starfall Fluffy_Pillow 86.6/100: 87% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall, wafting_devotion
0:59.669 aoe L starfall Fluffy_Pillow 47.6/100: 48% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord, wafting_devotion
1:00.658 aoe R starfire Fluffy_Pillow 16.6/100: 17% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), wafting_devotion
1:02.089 aoe Q starfall Fluffy_Pillow 71.8/100: 72% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), wafting_devotion
1:03.042 aoe R starfire Fluffy_Pillow 42.8/100: 43% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), wafting_devotion
1:04.419 aoe R starfire Fluffy_Pillow 68.0/100: 68% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), wafting_devotion, corrupting_rage
1:05.795 aoe L starfall Fluffy_Pillow 87.2/100: 87% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), wafting_devotion, corrupting_rage
1:06.713 aoe P fury_of_elune Fluffy_Pillow 52.2/100: 52% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), corrupting_rage
1:07.705 aoe R starfire Fluffy_Pillow 55.2/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(2), starlord(3), corrupting_rage
1:09.194 aoe L starfall Fluffy_Pillow 85.4/100: 85% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(2), starlord(3), corrupting_rage
1:10.188 aoe O wrath Fluffy_Pillow 56.4/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), starfall(2), starlord(3), corrupting_rage
1:11.181 aoe L starfall Fluffy_Pillow 74.4/100: 74% astral_power fury_of_elune, primordial_arcanic_pulsar(20), starfall(2), starlord(3), dreamstate(2), corrupting_rage
1:12.276 aoe O wrath Fluffy_Pillow 40.4/100: 40% astral_power fury_of_elune, primordial_arcanic_pulsar(25), starfall(3), starlord(3), dreamstate, corrupting_rage
1:13.031 aoe R starfire Fluffy_Pillow 53.4/100: 53% astral_power balance_of_all_things_arcane(8), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), corrupting_rage
1:14.015 aoe L starfall Fluffy_Pillow 84.6/100: 85% astral_power balance_of_all_things_arcane(7), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(2), corrupting_rage
1:15.238 aoe Q starfall Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, corrupting_rage
1:16.411 aoe R starfire Fluffy_Pillow 14.6/100: 15% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(4), starlord(2), corrupting_rage
1:18.107 aoe R starfire Fluffy_Pillow 43.8/100: 44% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(2), corrupting_rage
1:19.805 aoe Q starfall Fluffy_Pillow 65.0/100: 65% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(2)
1:20.939 aoe R starfire Fluffy_Pillow 22.0/100: 22% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), umbral_embrace
1:22.578 aoe L starfall Fluffy_Pillow 77.2/100: 77% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3)
1:23.671 aoe R starfire Fluffy_Pillow 32.2/100: 32% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3)
1:25.307 aoe R starfire Fluffy_Pillow 53.4/100: 53% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3)
1:26.945 aoe L starfall Fluffy_Pillow 72.6/100: 73% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3)
1:28.038 aoe O wrath Fluffy_Pillow 27.6/100: 28% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord(3), umbral_embrace, dreamstate
1:28.792 aoe O wrath Fluffy_Pillow 37.6/100: 38% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord(3), umbral_embrace
1:29.546 aoe Q starfall Fluffy_Pillow 47.6/100: 48% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), umbral_embrace
1:30.771 default F natures_vigil 460 T31 2p 8.6/100: 9% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord, umbral_embrace
1:30.771 aoe R starfire Fluffy_Pillow 8.6/100: 9% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord, umbral_embrace
1:32.533 aoe R starfire Fluffy_Pillow 35.8/100: 36% astral_power natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord
1:34.295 aoe Q starfall Fluffy_Pillow 59.0/100: 59% astral_power natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord, corrupting_rage
1:35.471 aoe R starfire Fluffy_Pillow 22.0/100: 22% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(2), corrupting_rage
1:37.013 default E use_items Fluffy_Pillow 47.2/100: 47% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(2), corrupting_rage
1:37.013 aoe Q starfall Fluffy_Pillow 47.2/100: 47% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(2), corrupting_rage, kindled_soul(100)
1:38.043 aoe R starfire Fluffy_Pillow 18.2/100: 18% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), corrupting_rage, kindled_soul(95)
1:39.532 aoe R starfire Fluffy_Pillow 43.4/100: 43% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), corrupting_rage, kindled_soul(90)
1:41.021 aoe R starfire Fluffy_Pillow 66.6/100: 67% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), corrupting_rage, kindled_soul(80)
1:42.512 aoe L starfall Fluffy_Pillow 89.8/100: 90% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall, starlord(3), corrupting_rage, kindled_soul(75)
1:43.504 aoe K cancel_buff Fluffy_Pillow 56.8/100: 57% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), corrupting_rage, kindled_soul(70)
1:43.504 aoe L starfall Fluffy_Pillow 56.8/100: 57% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), corrupting_rage, kindled_soul(70)
1:44.617 aoe R starfire Fluffy_Pillow 23.8/100: 24% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord, corrupting_rage, kindled_soul(65)
1:46.220 aoe L starfall Fluffy_Pillow 77.0/100: 77% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord, corrupting_rage, kindled_soul(55)
1:47.289 aoe O wrath Fluffy_Pillow 44.0/100: 44% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(2), dreamstate, corrupting_rage, kindled_soul(50)
1:48.043 aoe O wrath Fluffy_Pillow 54.0/100: 54% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(2), corrupting_rage, kindled_soul(45)
1:48.799 aoe Q starfall Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(2), corrupting_rage, kindled_soul(45)
1:49.933 aoe R starfire Fluffy_Pillow 29.0/100: 29% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(4), starlord(3), corrupting_rage, kindled_soul(40)
1:51.570 aoe R starfire Fluffy_Pillow 56.2/100: 56% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), corrupting_rage, kindled_soul(30)
1:53.206 aoe L starfall Fluffy_Pillow 83.4/100: 83% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(20)
1:54.299 aoe R starfire Fluffy_Pillow 44.4/100: 44% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(15)
1:55.936 aoe R starfire Fluffy_Pillow 69.6/100: 70% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(10)
1:57.575 aoe K cancel_buff Fluffy_Pillow 92.8/100: 93% astral_power eclipse_lunar, primordial_arcanic_pulsar(30), starfall, starlord(3), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, corrupting_rage
1:57.575 aoe L starfall Fluffy_Pillow 92.8/100: 93% astral_power eclipse_lunar, primordial_arcanic_pulsar(30), starfall, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, corrupting_rage
1:58.800 aoe Q starfall Fluffy_Pillow 51.8/100: 52% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord, umbral_embrace, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, corrupting_rage
1:59.978 aoe R starfire Fluffy_Pillow 6.8/100: 7% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), umbral_embrace, best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, corrupting_rage
2:01.678 aoe R starfire Fluffy_Pillow 30.0/100: 30% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, corrupting_rage
2:03.376 aoe L starfall Fluffy_Pillow 51.2/100: 51% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:04.425 aoe O wrath Fluffy_Pillow 8.2/100: 8% astral_power primordial_arcanic_pulsar(45), starfall(3), starlord(3), dreamstate, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:05.178 aoe O wrath Fluffy_Pillow 50.2/100: 50% astral_power primordial_arcanic_pulsar(45), starfall(3), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:05.931 aoe R starfire Fluffy_Pillow 64.2/100: 64% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:07.448 aoe L starfall Fluffy_Pillow 91.4/100: 91% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:08.460 aoe R starfire Fluffy_Pillow 52.4/100: 52% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:09.976 aoe L starfall Fluffy_Pillow 77.6/100: 78% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:10.988 aoe R starfire Fluffy_Pillow 36.6/100: 37% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:12.503 aoe R starfire Fluffy_Pillow 61.8/100: 62% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:14.019 aoe L starfall Fluffy_Pillow 85.0/100: 85% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:15.153 aoe P fury_of_elune Fluffy_Pillow 46.0/100: 46% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:16.144 aoe Q starfall Fluffy_Pillow 55.0/100: 55% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:17.134 aoe R starfire Fluffy_Pillow 30.0/100: 30% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:18.562 aoe L starfall Fluffy_Pillow 94.2/100: 94% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(2), best_friends_with_aerwynn_static, corrupting_rage
2:19.592 aoe R starfire Fluffy_Pillow 69.2/100: 69% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:21.081 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:22.075 aoe L starfall Fluffy_Pillow 73.0/100: 73% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:23.068 aoe R starfire Fluffy_Pillow 46.0/100: 46% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), starfall(4), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:24.557 aoe R starfire Fluffy_Pillow 70.2/100: 70% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:26.047 aoe L starfall Fluffy_Pillow 84.2/100: 84% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(3), dreamstate(2), best_friends_with_aerwynn_static, corrupting_rage
2:27.138 aoe O wrath Fluffy_Pillow 41.2/100: 41% astral_power primordial_arcanic_pulsar(25), starfall(3), starlord(3), dreamstate, best_friends_with_aerwynn_static, corrupting_rage
2:27.890 aoe O wrath Fluffy_Pillow 51.2/100: 51% astral_power primordial_arcanic_pulsar(25), starfall(3), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:28.645 aoe R starfire Fluffy_Pillow 61.2/100: 61% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:30.283 aoe L starfall Fluffy_Pillow 86.4/100: 86% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall, best_friends_with_aerwynn_static, corrupting_rage
2:31.507 aoe Q starfall Fluffy_Pillow 45.4/100: 45% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord, best_friends_with_aerwynn_static, corrupting_rage
2:32.683 aoe R starfire Fluffy_Pillow 6.4/100: 6% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(2), best_friends_with_aerwynn_static, corrupting_rage
2:34.381 aoe R starfire Fluffy_Pillow 35.6/100: 36% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(2), starlord(2), best_friends_with_aerwynn_static, corrupting_rage
2:36.080 aoe Q starfall Fluffy_Pillow 54.8/100: 55% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(2), best_friends_with_aerwynn_static
2:37.214 aoe R starfire Fluffy_Pillow 11.8/100: 12% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), best_friends_with_aerwynn_static
2:38.852 aoe R starfire Fluffy_Pillow 33.0/100: 33% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), best_friends_with_aerwynn_static
2:40.491 aoe R starfire Fluffy_Pillow 56.2/100: 56% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), best_friends_with_aerwynn_static
2:42.129 aoe L starfall Fluffy_Pillow 77.4/100: 77% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), best_friends_with_aerwynn_static
2:43.221 aoe O wrath Fluffy_Pillow 32.4/100: 32% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_aerwynn_static
2:44.312 aoe K cancel_buff Fluffy_Pillow 44.4/100: 44% astral_power primordial_arcanic_pulsar(45), starfall, starlord(3), dreamstate(2), best_friends_with_aerwynn_static
2:44.312 aoe O wrath Fluffy_Pillow 44.4/100: 44% astral_power primordial_arcanic_pulsar(45), starfall, dreamstate, best_friends_with_aerwynn_static
2:45.068 aoe L starfall Fluffy_Pillow 54.4/100: 54% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, dreamstate, best_friends_with_aerwynn_static
2:46.291 aoe R starfire Fluffy_Pillow 43.4/100: 43% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, best_friends_with_aerwynn_static
2:47.350 aoe Q starfall Fluffy_Pillow 68.6/100: 69% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, best_friends_with_aerwynn_static
2:48.528 aoe R starfire Fluffy_Pillow 29.6/100: 30% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), best_friends_with_aerwynn_static
2:50.223 aoe Q starfall Fluffy_Pillow 54.8/100: 55% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(2), best_friends_with_aerwynn_static
2:51.358 aoe R starfire Fluffy_Pillow 15.8/100: 16% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:52.847 aoe R starfire Fluffy_Pillow 41.0/100: 41% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:54.336 aoe R starfire Fluffy_Pillow 68.2/100: 68% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:55.826 aoe L starfall Fluffy_Pillow 93.4/100: 93% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall, starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:56.819 aoe R starfire Fluffy_Pillow 62.4/100: 62% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:58.307 aoe K cancel_buff Fluffy_Pillow 85.6/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall, starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:58.307 aoe L starfall Fluffy_Pillow 85.6/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall, best_friends_with_aerwynn_static, corrupting_rage
2:59.417 aoe L starfall Fluffy_Pillow 52.6/100: 53% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord, best_friends_with_aerwynn_static, corrupting_rage
3:00.485 aoe R starfire Fluffy_Pillow 19.6/100: 20% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(2), best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage
3:02.029 default F natures_vigil 460 T31 2p 38.8/100: 39% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(2), best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage
3:02.029 aoe L starfall Fluffy_Pillow 38.8/100: 39% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(2), best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage
3:03.060 aoe O wrath Fluffy_Pillow 37.8/100: 38% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(4), starlord(3), dreamstate, best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage
3:03.814 aoe O wrath Fluffy_Pillow 49.8/100: 50% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(4), starlord(3), best_friends_with_pip(8), best_friends_with_pip_static, corrupting_rage
3:04.570 aoe R starfire Fluffy_Pillow 63.8/100: 64% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), best_friends_with_pip(7), best_friends_with_pip_static, corrupting_rage
3:06.207 aoe L starfall Fluffy_Pillow 87.0/100: 87% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage
3:07.299 aoe N incarnation_chosen_of_elune Fluffy_Pillow 46.0/100: 46% astral_power natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage
3:07.299 default E use_items Fluffy_Pillow 46.0/100: 46% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), dreamstate(2), best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage
3:07.299 aoe R starfire Fluffy_Pillow 46.0/100: 46% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), dreamstate, best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
3:08.195 aoe R starfire Fluffy_Pillow 69.2/100: 69% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
3:09.088 aoe L starfall Fluffy_Pillow 94.4/100: 94% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_pip(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(95)
3:10.081 aoe R starfire Fluffy_Pillow 65.4/100: 65% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(90)
3:11.568 aoe K cancel_buff Fluffy_Pillow 92.6/100: 93% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(80)
3:11.568 aoe L starfall Fluffy_Pillow 92.6/100: 93% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(80)
3:12.682 aoe Q starfall Fluffy_Pillow 61.6/100: 62% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord, best_friends_with_pip_static, corrupting_rage, kindled_soul(75)
3:13.752 aoe R starfire Fluffy_Pillow 28.6/100: 29% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(70)
3:15.295 aoe P fury_of_elune Fluffy_Pillow 51.8/100: 52% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage, kindled_soul(65)
3:16.326 aoe Q starfall Fluffy_Pillow 59.8/100: 60% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(40), starfall(3), starlord(2), best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage, kindled_soul(55)
3:17.357 aoe R starfire Fluffy_Pillow 32.8/100: 33% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), starfall(3), starlord(3), best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage, kindled_soul(50)
3:18.845 aoe R starfire Fluffy_Pillow 61.0/100: 61% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), starfall(3), starlord(3), best_friends_with_pip(7), best_friends_with_pip_static, corrupting_rage, kindled_soul(45)
3:20.335 aoe L starfall Fluffy_Pillow 91.2/100: 91% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage, kindled_soul(35)
3:21.329 aoe L starfall Fluffy_Pillow 96.2/100: 96% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(2), starlord(3), best_friends_with_pip(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(30)
3:22.322 aoe R starfire Fluffy_Pillow 67.2/100: 67% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(3), starlord(3), best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage, kindled_soul(25)
3:23.811 aoe L starfall Fluffy_Pillow 96.4/100: 96% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(3), starlord(3), best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(20)
3:24.807 aoe R starfire Fluffy_Pillow 65.4/100: 65% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), best_friends_with_pip, best_friends_with_pip_static, corrupting_rage, kindled_soul(15)
3:26.295 aoe K cancel_buff Fluffy_Pillow 94.6/100: 95% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(10)
3:26.295 aoe L starfall Fluffy_Pillow 94.6/100: 95% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(10)
3:27.409 aoe Q starfall Fluffy_Pillow 63.6/100: 64% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(4), starlord, best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage
3:28.478 aoe R starfire Fluffy_Pillow 34.6/100: 35% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(2), best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage
3:30.021 aoe Q starfall Fluffy_Pillow 57.8/100: 58% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(2), best_friends_with_pip(8), best_friends_with_pip_static
3:31.052 aoe R starfire Fluffy_Pillow 22.8/100: 23% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), best_friends_with_pip(7), best_friends_with_pip_static
3:32.539 aoe R starfire Fluffy_Pillow 44.0/100: 44% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_pip(6), best_friends_with_pip_static
3:34.029 aoe R starfire Fluffy_Pillow 69.2/100: 69% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_pip(4), best_friends_with_pip_static
3:35.517 aoe L starfall Fluffy_Pillow 88.4/100: 88% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall, starlord(3), best_friends_with_pip(3), best_friends_with_pip_static
3:36.512 aoe R starfire Fluffy_Pillow 57.4/100: 57% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(2), starlord(3), best_friends_with_pip(2), best_friends_with_pip_static
3:38.001 aoe R starfire Fluffy_Pillow 76.6/100: 77% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(2), starlord(3), best_friends_with_pip_static
3:39.489 aoe K cancel_buff Fluffy_Pillow 95.8/100: 96% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall, starlord(3), best_friends_with_pip_static
3:39.489 aoe L starfall Fluffy_Pillow 95.8/100: 96% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall, best_friends_with_pip_static
3:40.602 aoe Q starfall Fluffy_Pillow 62.8/100: 63% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(2), starlord, best_friends_with_pip_static
3:41.671 aoe R starfire Fluffy_Pillow 27.8/100: 28% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(2), best_friends_with_pip_static
3:43.215 aoe Q starfall Fluffy_Pillow 49.0/100: 49% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(2), best_friends_with_pip_static
3:44.245 aoe R starfire Fluffy_Pillow 14.0/100: 14% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage
3:45.734 aoe R starfire Fluffy_Pillow 35.2/100: 35% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage
3:47.222 aoe R starfire Fluffy_Pillow 56.4/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage
3:48.710 aoe L starfall Fluffy_Pillow 75.6/100: 76% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall, starlord(3), best_friends_with_pip_static, corrupting_rage
3:49.703 aoe O wrath Fluffy_Pillow 42.6/100: 43% astral_power primordial_arcanic_pulsar(40), starfall(2), starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage
3:50.458 aoe L starfall Fluffy_Pillow 56.6/100: 57% astral_power primordial_arcanic_pulsar(40), starfall(2), starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage
3:51.550 aoe O wrath Fluffy_Pillow 43.6/100: 44% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
3:52.306 aoe R starfire Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
3:53.944 aoe K cancel_buff Fluffy_Pillow 86.8/100: 87% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
3:53.944 aoe L starfall Fluffy_Pillow 86.8/100: 87% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), best_friends_with_pip_static, corrupting_rage
3:55.167 aoe Q starfall Fluffy_Pillow 45.8/100: 46% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord, best_friends_with_pip_static, corrupting_rage
3:56.343 aoe R starfire Fluffy_Pillow 4.8/100: 5% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(4), starlord(2), best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage
3:58.039 aoe R starfire Fluffy_Pillow 32.0/100: 32% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage
3:59.736 aoe Q starfall Fluffy_Pillow 53.2/100: 53% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(2), best_friends_with_pip(8), best_friends_with_pip_static, corrupting_rage
4:00.869 aoe R starfire Fluffy_Pillow 12.2/100: 12% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), umbral_embrace, best_friends_with_pip(7), best_friends_with_pip_static, corrupting_rage
4:02.358 aoe R starfire Fluffy_Pillow 39.4/100: 39% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_pip(5), best_friends_with_pip_static, corrupting_rage
4:03.847 aoe R starfire Fluffy_Pillow 64.6/100: 65% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall, starlord(3), best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage
4:05.334 aoe L starfall Fluffy_Pillow 91.8/100: 92% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall, starlord(3), best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage
4:06.327 aoe L starfall Fluffy_Pillow 90.8/100: 91% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), best_friends_with_pip, best_friends_with_pip_static
4:07.321 aoe R starfire Fluffy_Pillow 57.8/100: 58% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_pip_static
4:08.810 aoe K cancel_buff Fluffy_Pillow 77.0/100: 77% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_pip_static
4:08.810 aoe L starfall Fluffy_Pillow 77.0/100: 77% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), best_friends_with_pip_static
4:09.922 aoe Q starfall Fluffy_Pillow 42.0/100: 42% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord, best_friends_with_pip_static
4:10.990 aoe O wrath Fluffy_Pillow 9.0/100: 9% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), best_friends_with_pip_static
4:12.021 aoe O wrath Fluffy_Pillow 21.0/100: 21% astral_power primordial_arcanic_pulsar(20), starfall(4), starlord(2), umbral_embrace, dreamstate, best_friends_with_pip_static
4:12.775 aoe R starfire Fluffy_Pillow 33.0/100: 33% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(2), umbral_embrace, best_friends_with_pip_static
4:13.794 aoe Q starfall Fluffy_Pillow 56.2/100: 56% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(2), best_friends_with_pip_static, wafting_devotion
4:14.842 aoe R starfire Fluffy_Pillow 17.2/100: 17% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), best_friends_with_pip_static, wafting_devotion
4:16.358 aoe P fury_of_elune Fluffy_Pillow 44.4/100: 44% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), best_friends_with_pip_static, wafting_devotion
4:17.369 aoe R starfire Fluffy_Pillow 58.4/100: 58% astral_power balance_of_all_things_arcane(4), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_pip_static, wafting_devotion
4:18.885 aoe L starfall Fluffy_Pillow 92.6/100: 93% astral_power balance_of_all_things_arcane(2), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), starfall, starlord(3), best_friends_with_pip_static, wafting_devotion
4:19.897 aoe R starfire Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_arcane, eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(2), starlord(3), best_friends_with_pip_static, wafting_devotion
4:21.409 aoe L starfall Fluffy_Pillow 85.8/100: 86% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(2), starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:22.420 aoe R starfire Fluffy_Pillow 50.8/100: 51% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:23.936 aoe L starfall Fluffy_Pillow 85.0/100: 85% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(35), starfall(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:25.069 aoe R starfire Fluffy_Pillow 43.0/100: 43% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord, best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:26.699 aoe L starfall Fluffy_Pillow 64.2/100: 64% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord, best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:27.789 aoe O wrath Fluffy_Pillow 19.2/100: 19% astral_power primordial_arcanic_pulsar(45), starfall(3), starlord(2), dreamstate, best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:28.544 aoe O wrath Fluffy_Pillow 29.2/100: 29% astral_power primordial_arcanic_pulsar(45), starfall(3), starlord(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:29.299 aoe R starfire Fluffy_Pillow 39.2/100: 39% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(3), starlord(2), best_friends_with_pip_static, corrupting_rage
4:30.996 aoe L starfall Fluffy_Pillow 96.4/100: 96% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), best_friends_with_pip_static, corrupting_rage
4:32.129 default F natures_vigil 460 T31 2p 57.4/100: 57% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
4:32.129 aoe R starfire Fluffy_Pillow 57.4/100: 57% astral_power natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
4:33.766 aoe L starfall Fluffy_Pillow 84.6/100: 85% astral_power natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
4:34.860 aoe R starfire Fluffy_Pillow 47.6/100: 48% astral_power natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
4:36.498 aoe R starfire Fluffy_Pillow 68.8/100: 69% astral_power natures_vigil, balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
4:38.136 default E use_items Fluffy_Pillow 90.0/100: 90% astral_power natures_vigil, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
4:38.136 aoe K cancel_buff Fluffy_Pillow 90.0/100: 90% astral_power natures_vigil, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
4:38.136 aoe L starfall Fluffy_Pillow 90.0/100: 90% astral_power natures_vigil, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
4:39.359 aoe R starfire Fluffy_Pillow 51.0/100: 51% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord, best_friends_with_pip_static, corrupting_rage, kindled_soul(95)
4:40.962 aoe R starfire Fluffy_Pillow 78.2/100: 78% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord, best_friends_with_pip_static, corrupting_rage, kindled_soul(90)

Stats

Level Bonus (70) Race Bonus (tauren) Raid-Buffed Unbuffed Gear Amount
Strength 898 2 986 900 0
Agility 2089 -2 2173 2087 0
Stamina 3848 2 36056 34339 30422
Intellect 2089 -2 13596 12779 10084 (6209)
Spirit 0 0 0 0 0
Health 721120 721120 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13596 12779 0
Crit 27.03% 20.82% 2847
Haste 23.01% 23.01% 3912
Versatility 6.22% 1.22% 251
Mana Regen 2560 2560 0
Attack Power 14140 13290 0
Mastery 29.14% 29.14% 7552
Armor 4552 4552 4552
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 469.00
Local Head Benevolent Embersage's Casque
ilevel: 470, stats: { 585 Armor, +3163 Sta, +655 Crit, +307 Haste, +786 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }, enchant: incandescent_essence
Local Neck Eye of the Rising Flame
ilevel: 470, stats: { +1779 Sta, +233 Haste, +1397 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Life-Bound Shoulderpads
ilevel: 470, stats: { 536 Armor, +2372 Sta, +360 Mastery, +360 Haste, +590 AgiInt }
item effects: { equip: Toxified }
Local Chest Benevolent Embersage's Robe
ilevel: 460, stats: { 727 Armor, +2804 Sta, +639 Crit, +284 Mastery, +716 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 470, stats: { 439 Armor, +2372 Sta, +497 Haste, +224 Mastery, +590 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 460, stats: { 636 Armor, +2804 Sta, +630 Haste, +293 Mastery, +716 AgiInt }, enchant: { +155 StrAgiInt, +41 Vers (lambent_armor_kit_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 470, stats: { 488 Armor, +2372 Sta, +257 Crit, +412 Haste, +590 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Thermal Bindings
ilevel: 470, stats: { 390 Armor, +1779 Sta, +178 Crit, +363 Mastery, +442 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Benevolent Embersage's Talons
ilevel: 470, stats: { 439 Armor, +2372 Sta, +210 Vers, +511 Mastery, +590 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 470, stats: { +1779 Sta, +466 Haste, +1165 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 470, stats: { +1779 Sta, +1118 Crit, +512 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 470, stats: { +747 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 470, stats: { +687 Mastery }
item effects: { use: Balefire Branch }
Local Back Drape of the Loyal Vassal
ilevel: 470, stats: { 312 Armor, +1779 Sta, +305 Haste, +236 Mastery, +442 StrAgiInt }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 470, weapon: { 508 - 654, 2.6 }, stats: { +393 Int, +1896 Int, +1581 Sta, +145 Haste, +335 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 470, stats: { +1206 Int, +1581 Sta, +162 Haste, +319 Mastery }

Profile

druid="460 T31 2p"
source=default
spec=balance
level=70
race=tauren
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:hissing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Balance APL can be found at https://balance-simc.github.io/Balance-SimC/balance.txt

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=470,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=470,gem_id=192961/192961/192961
shoulders=lifebound_shoulderpads,id=193406,bonus_id=8836/1576/8797/8960,ilevel=470,crafted_stats=49/36
back=drape_of_the_loyal_vassal,id=158375,bonus_id=4795,ilevel=470
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=460,enchant_id=6625
wrists=thermal_bindings,id=134461,bonus_id=4795,ilevel=470,gem_id=192961
hands=benevolent_embersages_talons,id=207255,bonus_id=4795,ilevel=470
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=460,enchant_id=6830
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=470
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=470
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=470
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=470,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=470

# Gear Summary
# gear_ilvl=468.75
# gear_stamina=30422
# gear_intellect=10084
# gear_crit_rating=2847
# gear_haste_rating=3912
# gear_mastery_rating=7552
# gear_versatility_rating=251
# gear_armor=4552
# set_bonus=tier31_2pc=1

460 T31 4p : 753285 dps, 137274 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
753285.4 753285.4 738.2 / 0.098% 72737.5 / 9.7% 55470.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.6 13.7 Astral Power 0.00% 55.6 100.2% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
460 T31 4p 753285
Astral Smolder 112465 14.9% 371.2 0.87s 90987 0 Periodic 734.1 46011 0 46011 0.0% 81.5%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 371.21 0.00 734.08 734.08 282.66 0.0000 2.0000 33774792.27 33774792.27 0.00% 23004.97 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 734.08 554 917 46011.11 3921 228956 46060.74 39503 53272 33774792 33774792 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Fury of Elune 22268 3.0% 5.1 64.63s 1302622 1327649 Direct 754.0 5614 12037 8870 50.7%

Stats Details: Fury Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.13 753.98 0.00 0.00 0.00 0.9813 0.0000 6686042.64 6686042.64 0.00% 1327649.45 1327649.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.32% 371.87 233 513 5613.60 2720 17520 5625.19 4907 6485 2086998 2086998 0.00%
crit 50.68% 382.11 263 538 12036.58 5549 35712 12041.40 10985 13635 4599045 4599045 0.00%

Action Details: Fury Of Elune

  • id:202770
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:astral_power
  • energize_amount:3.0

Spelldata

  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r

Action Details: Fury Of Elune Tick

  • id:211545
  • school:astral
  • range:105.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.149000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:211545
  • name:Fury of Elune
  • school:astral
  • tooltip:
  • description:{$@spelldesc202770=Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r}

Action Priority List

    aoe
    [P]:5.13
  • if_expr:target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Hungering Shadowflame 2887 0.4% 16.9 16.54s 51452 0 Direct 16.9 40031 82488 51441 26.9%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.89 16.89 0.00 0.00 0.00 0.0000 0.0000 869235.11 869235.11 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.12% 12.35 3 25 40030.75 26973 154665 39897.75 26973 81303 494976 494976 0.00%
crit 26.88% 4.54 0 16 82488.29 55024 315517 80961.47 0 302057 374259 374259 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy3
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24191.79
  • base_dd_max:24191.79
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 5533 0.7% 33.7 8.78s 49358 0 Direct 33.6 38618 78732 49495 27.1%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.70 33.61 0.00 0.00 0.00 0.0000 0.0000 1663185.43 1663185.43 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.91% 24.51 10 42 38618.32 38181 43787 38620.79 38181 40077 946435 946435 0.00%
crit 27.09% 9.10 0 23 78732.14 77890 89326 78706.89 0 84031 716750 716750 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy3
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:34245.43
  • base_dd_max:34245.43
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 63059 8.4% 3.0 1.10s 6317762 6759374 Direct 6.0 5898 12020 8818 47.7%
Periodic 1800.4 7331 15159 10498 40.5% 99.3%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.00 6.00 1800.45 1800.45 0.00 0.9348 0.9941 18953285.45 18953285.45 0.00% 10572.50 6759374.27
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.27% 3.14 0 6 5897.53 5822 6793 5842.52 0 6793 18498 18498 0.00%
crit 47.73% 2.86 0 6 12019.53 11877 13857 11816.16 0 13857 34420 34420 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 59.54% 1072.05 809 1341 7330.77 5591 11625 7330.78 7123 7523 7858765 7858765 0.00%
crit 40.46% 728.40 540 931 15159.09 11406 23716 15161.09 14714 15731 11041603 11041603 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy3
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    aoe
    [J]:3.00
  • if_expr:!fight_style.dungeonroute
  • target_if_expr:refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (65199) 0.0% (8.7%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 16134 2.1% 232.2 1.49s 20878 0 Direct 231.6 13249 28542 20935 50.2%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 232.19 231.59 0.00 0.00 0.00 0.0000 0.0000 4847755.27 4847755.27 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.75% 115.23 69 162 13249.39 9166 24484 13254.65 12459 14140 1526581 1526581 0.00%
crit 50.25% 116.36 75 171 28541.92 18700 49172 28563.49 26887 30908 3321174 3321174 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 16215 2.2% 234.2 1.49s 20806 0 Direct 233.6 13210 28460 20859 50.2%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 234.18 233.58 0.00 0.00 0.00 0.0000 0.0000 4872255.47 4872255.47 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.84% 116.42 71 173 13210.06 8304 24149 13216.45 12371 14143 1537937 1537937 0.00%
crit 50.16% 117.16 75 166 28460.18 16941 49264 28478.79 26709 30985 3334318 3334318 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 32850 4.4% 15.5 19.55s 635165 0 Direct 92.9 67354 145464 106192 49.7%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.54 92.95 0.00 0.00 0.00 0.0000 0.0000 9871556.75 9871556.75 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 50.26% 46.72 20 76 67354.07 34233 239561 67382.36 51811 83310 3147128 3147128 0.00%
crit 49.74% 46.23 26 72 145463.69 69835 497441 145514.88 115763 187264 6724429 6724429 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:enemy5
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfall 249987 33.2% 103.5 2.88s 725508 706266 Direct 1774.2 27981 60659 42313 43.9%

Stats Details: Starfall

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 103.47 1774.24 0.00 0.00 0.00 1.0273 0.0000 75065522.10 75065522.10 0.00% 706266.38 706266.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.14% 996.08 735 1258 27981.39 6315 105302 28040.80 25816 31272 27867316 27867316 0.00%
crit 43.86% 778.16 582 984 60658.58 12882 217794 60763.08 56117 66757 47198206 47198206 0.00%

Action Details: Starfall

  • id:191034
  • school:astral
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:45.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]

Action Details: Starfall Damage

  • id:191037
  • school:astral
  • range:200.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.114000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.41

Spelldata

  • id:191037
  • name:Starfall
  • school:astral
  • tooltip:
  • description:{$@spelldesc191034=Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]}

Action Priority List

    aoe
    [L]:69.12
  • if_expr:variable.starfall_condition1
    aoe
    [Q]:34.35
  • if_expr:variable.starfall_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountLunar Shrapnel4151691PCT0.200
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 170336 22.6% 116.7 2.54s 438524 309636 Direct 706.1 45496 98236 72471 51.1%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 116.69 706.12 0.00 0.00 0.00 1.4163 0.0000 51170112.40 51170112.40 0.00% 309635.86 309635.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.85% 344.95 240 448 45495.89 6268 200387 45501.89 40971 50328 15691590 15691590 0.00%
crit 51.15% 361.17 267 474 98235.58 12787 414891 98257.76 89100 110656 35478522 35478522 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    aoe
    [M]:1.39
  • if_expr:buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
    aoe
    [R]:115.86
  • if_expr:spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Solar)4851710.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Sunfire16481550.283Mastery
Sunfire 52768 7.0% 1.0 0.00s 15848782 16824610 Direct 1.0 4630 9442 5946 27.4%
Periodic 1813.3 6161 13194 8737 36.6% 100.0%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 1813.30 1813.30 0.00 0.9425 0.9938 15848782.39 15848782.39 0.00% 8790.36 16824609.76
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.63% 0.73 0 1 4629.92 4602 4659 3362.54 0 4659 3363 3363 0.00%
crit 27.37% 0.27 0 1 9441.95 9389 9503 2584.61 0 9503 2585 2585 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 63.37% 1149.08 845 1418 6160.83 4621 10568 6163.86 5987 6370 7078932 7078932 0.00%
crit 36.63% 664.22 488 852 13194.48 9426 21560 13201.61 12703 13710 8763903 8763903 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    aoe
    [I]:1.00
  • target_if_expr:refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (5334) 0.0% (0.7%) 8.4 33.38s 191259 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.38 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy3
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 2785 0.4% 8.4 33.38s 99860 0 Direct 50.3 13003 26502 16644 27.0%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.38 50.31 0.00 0.00 0.00 0.0000 0.0000 837259.97 837259.97 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.04% 36.74 8 82 13003.26 12852 14739 13002.59 12852 13811 477787 477787 0.00%
crit 26.96% 13.56 1 38 26502.08 26219 30068 26504.58 26219 28528 359473 359473 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:39522.22
  • base_dd_max:39522.22
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 2549 0.3% 16.1 16.09s 47559 0 Direct 96.7 6186 12611 7927 27.1%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.11 96.68 0.00 0.00 0.00 0.0000 0.0000 766314.65 766314.65 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.92% 70.50 13 173 6186.38 6116 7013 6186.18 6116 6609 436141 436141 0.00%
crit 27.08% 26.18 4 66 12610.80 12476 14308 12612.36 12476 13583 330174 330174 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18805.57
  • base_dd_max:18805.57
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 3448 0.5% 26.0 10.57s 40068 51789 Direct 25.9 28704 58464 40269 38.8%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.01 25.89 0.00 0.00 0.00 0.7737 0.0000 1042350.20 1042350.20 0.00% 51788.65 51788.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.16% 15.83 6 26 28703.92 12761 51954 28655.01 20963 35331 454552 454552 0.00%
crit 38.84% 10.06 1 20 58463.54 26032 110065 58316.76 32605 77945 587798 587798 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    aoe
    [O]:24.09
  • if_expr:!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.800Spell Data
Eclipse (Solar)4851710.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Lunar)4851810.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
460 T31 4p
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31 4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31 4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31 4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 181.15s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    aoe
    [N]:2.00
  • if_expr:variable.cd_condition_aoe

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.2 90.00s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.18 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31 4p
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:57075.72
  • base_dd_max:57075.72
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.41s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31 4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.75
Elemental Potion of Ultimate Power 1.5 304.85s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.46 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.46
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 17.7 5.4 17.5s 13.7s 9.5s 55.64% 57.42% 5.4 (17.3) 17.1

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 44.6s
  • trigger_min/max:0.0s / 36.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:51.01% / 58.69%

Stack Uptimes

  • balance_of_all_things_arcane_1:5.80%
  • balance_of_all_things_arcane_2:6.20%
  • balance_of_all_things_arcane_3:6.66%
  • balance_of_all_things_arcane_4:7.03%
  • balance_of_all_things_arcane_5:7.28%
  • balance_of_all_things_arcane_6:7.47%
  • balance_of_all_things_arcane_7:7.57%
  • balance_of_all_things_arcane_8:7.63%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 10.2 0.0 30.2s 30.1s 7.9s 26.79% 29.77% 0.0 (0.0) 9.9

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.4s / 47.3s
  • trigger_min/max:6.8s / 46.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.9s
  • uptime_min/max:24.45% / 29.96%

Stack Uptimes

  • balance_of_all_things_nature_1:3.31%
  • balance_of_all_things_nature_2:3.32%
  • balance_of_all_things_nature_3:3.34%
  • balance_of_all_things_nature_4:3.35%
  • balance_of_all_things_nature_5:3.36%
  • balance_of_all_things_nature_6:3.36%
  • balance_of_all_things_nature_7:3.37%
  • balance_of_all_things_nature_8:3.38%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 14.8 85.3 20.8s 3.0s 17.9s 88.27% 0.00% 35.7 (35.7) 0.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.1s / 57.9s
  • trigger_min/max:0.8s / 13.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 53.2s
  • uptime_min/max:81.54% / 91.83%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:13.13%
  • balance_t31_4pc_buff_lunar_2:13.68%
  • balance_t31_4pc_buff_lunar_3:14.14%
  • balance_t31_4pc_buff_lunar_4:11.64%
  • balance_t31_4pc_buff_lunar_5:35.68%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 8.2 55.7 38.5s 4.5s 18.8s 51.33% 0.00% 25.6 (25.6) 0.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 81.3s
  • trigger_min/max:0.8s / 37.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 53.2s
  • uptime_min/max:45.57% / 58.94%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:7.58%
  • balance_t31_4pc_buff_solar_2:6.40%
  • balance_t31_4pc_buff_solar_3:6.36%
  • balance_t31_4pc_buff_solar_4:6.58%
  • balance_t31_4pc_buff_solar_5:24.41%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 69.8s 69.8s 10.8s 10.15% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 289.5s
  • trigger_min/max:12.0s / 289.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 29.52%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.91%
  • best_friends_with_aerwynn_2:0.91%
  • best_friends_with_aerwynn_3:0.91%
  • best_friends_with_aerwynn_4:0.92%
  • best_friends_with_aerwynn_5:0.92%
  • best_friends_with_aerwynn_6:0.92%
  • best_friends_with_aerwynn_7:0.93%
  • best_friends_with_aerwynn_8:0.93%
  • best_friends_with_aerwynn_9:0.93%
  • best_friends_with_aerwynn_10:0.94%
  • best_friends_with_aerwynn_11:0.94%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 112.7s 69.8s 45.5s 33.49% 0.00% 70.5 (70.5) 0.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:13.2s / 327.5s
  • trigger_min/max:12.0s / 289.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 258.5s
  • uptime_min/max:0.00% / 93.38%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.49%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.4s 70.4s 10.8s 10.01% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 317.0s
  • trigger_min/max:12.0s / 317.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 31.25%

Stack Uptimes

  • best_friends_with_pip_1:0.89%
  • best_friends_with_pip_2:0.90%
  • best_friends_with_pip_3:0.90%
  • best_friends_with_pip_4:0.90%
  • best_friends_with_pip_5:0.91%
  • best_friends_with_pip_6:0.91%
  • best_friends_with_pip_7:0.91%
  • best_friends_with_pip_8:0.92%
  • best_friends_with_pip_9:0.92%
  • best_friends_with_pip_10:0.92%
  • best_friends_with_pip_11:0.93%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 113.2s 70.4s 45.9s 33.48% 0.00% 69.4 (69.4) 0.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:13.3s / 355.6s
  • trigger_min/max:12.0s / 317.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 270.3s
  • uptime_min/max:0.00% / 99.26%

Stack Uptimes

  • best_friends_with_pip_static_1:33.48%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 69.4s 69.4s 10.8s 10.10% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 356.4s
  • trigger_min/max:12.0s / 356.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 11.0s
  • uptime_min/max:0.00% / 32.94%

Stack Uptimes

  • best_friends_with_urctos_1:0.90%
  • best_friends_with_urctos_2:0.91%
  • best_friends_with_urctos_3:0.91%
  • best_friends_with_urctos_4:0.91%
  • best_friends_with_urctos_5:0.92%
  • best_friends_with_urctos_6:0.92%
  • best_friends_with_urctos_7:0.92%
  • best_friends_with_urctos_8:0.92%
  • best_friends_with_urctos_9:0.93%
  • best_friends_with_urctos_10:0.93%
  • best_friends_with_urctos_11:0.93%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 112.1s 69.4s 44.8s 33.03% 0.00% 69.2 (69.2) 0.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 356.4s
  • trigger_min/max:12.0s / 356.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 323.3s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.03%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.48%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.8 0.0 62.5s 59.1s 50.5s 80.34% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 313.0s
  • trigger_min/max:15.0s / 295.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 353.5s
  • uptime_min/max:53.71% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.34%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dreamstate 15.0 0.2 20.8s 21.5s 2.2s 10.86% 20.43% 0.2 (0.4) 0.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 54.0s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.3s
  • uptime_min/max:7.62% / 14.65%

Stack Uptimes

  • dreamstate_1:7.24%
  • dreamstate_2:3.62%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 13.2 7.9 23.9s 15.1s 21.3s 92.96% 93.64% 7.9 (7.9) 12.2

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.7s / 67.0s
  • trigger_min/max:0.0s / 56.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 65.6s
  • uptime_min/max:89.82% / 95.50%

Stack Uptimes

  • eclipse_lunar_1:92.96%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 8.2 0.0 38.6s 38.6s 19.1s 52.07% 54.02% 0.0 (0.0) 7.8

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 83.1s
  • trigger_min/max:12.0s / 83.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.67% / 59.33%

Stack Uptimes

  • eclipse_solar_1:52.07%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 306.0s 306.0s 27.2s 12.99% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 325.3s
  • trigger_min/max:300.0s / 325.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.78% / 17.84%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.99%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Fury of Elune 5.1 0.0 64.6s 64.6s 7.9s 13.49% 0.00% 76.0 (76.0) 5.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:60.0s / 87.6s
  • trigger_min/max:60.0s / 87.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:11.33% / 15.47%

Stack Uptimes

  • fury_of_elune_1:13.49%

Spelldata

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 8.2 0.0 38.6s 38.6s 19.1s 52.07% 54.73% 0.0 (0.0) 7.8

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 83.1s
  • trigger_min/max:12.0s / 83.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.67% / 59.33%

Stack Uptimes

  • incarnation_chosen_of_elune_1:52.07%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.7 0.0 91.0s 91.0s 19.6s 24.02% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:55.09

Trigger Details

  • interval_min/max:90.0s / 121.3s
  • trigger_min/max:90.0s / 121.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:21.26% / 26.93%

Stack Uptimes

  • kindled_soul_5:1.17%
  • kindled_soul_10:1.18%
  • kindled_soul_15:1.18%
  • kindled_soul_20:1.18%
  • kindled_soul_25:1.19%
  • kindled_soul_30:1.19%
  • kindled_soul_35:1.19%
  • kindled_soul_40:1.19%
  • kindled_soul_45:1.20%
  • kindled_soul_50:1.20%
  • kindled_soul_55:1.20%
  • kindled_soul_60:1.21%
  • kindled_soul_65:1.21%
  • kindled_soul_70:1.21%
  • kindled_soul_75:1.21%
  • kindled_soul_80:1.22%
  • kindled_soul_85:1.22%
  • kindled_soul_90:1.22%
  • kindled_soul_95:1.22%
  • kindled_soul_100:1.23%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Vigil 3.7 0.0 90.4s 90.4s 14.8s 18.41% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.6s
  • trigger_min/max:90.0s / 91.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s
  • uptime_min/max:16.52% / 21.01%

Stack Uptimes

  • natures_vigil_1:18.41%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.0 71.1s 70.4s 0.9s 0.77% 1.18% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.3s / 317.1s
  • trigger_min/max:0.1s / 317.1s
  • trigger_pct:15.08%
  • duration_min/max:0.0s / 6.2s
  • uptime_min/max:0.00% / 3.84%

Stack Uptimes

  • owlkin_frenzy_1:0.77%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 9.1 95.3 34.5s 34.5s 30.3s 91.24% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:21.8s / 46.6s
  • trigger_min/max:21.8s / 46.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.7s
  • uptime_min/max:87.65% / 94.25%

Stack Uptimes

  • primordial_arcanic_pulsar_5:7.17%
  • primordial_arcanic_pulsar_10:6.73%
  • primordial_arcanic_pulsar_15:7.77%
  • primordial_arcanic_pulsar_20:8.22%
  • primordial_arcanic_pulsar_25:8.43%
  • primordial_arcanic_pulsar_30:8.18%
  • primordial_arcanic_pulsar_35:8.72%
  • primordial_arcanic_pulsar_40:9.17%
  • primordial_arcanic_pulsar_45:9.00%
  • primordial_arcanic_pulsar_50:8.92%
  • primordial_arcanic_pulsar_55:8.93%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 19.9 3.2 15.5s 13.7s 6.6s 43.64% 42.82% 3.2 (3.2) 19.4

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 36.7s
  • trigger_min/max:0.0s / 36.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:39.58% / 46.69%

Stack Uptimes

  • solstice_1:43.64%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starfall 103.5 0.0 143.6s 2.9s 296.6s 98.86% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_starfall
  • max_stacks:20
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:asynchronous
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.9s / 357.4s
  • trigger_min/max:0.7s / 8.5s
  • trigger_pct:99.99%
  • duration_min/max:23.4s / 358.1s
  • uptime_min/max:98.40% / 99.47%

Stack Uptimes

  • starfall_1:5.74%
  • starfall_2:33.84%
  • starfall_3:41.87%
  • starfall_4:14.14%
  • starfall_5:2.96%
  • starfall_6:0.31%
  • starfall_7:0.00%

Spelldata

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]
  • max_stacks:20
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Starlord 21.0 82.4 14.5s 2.9s 14.0s 97.49% 0.00% 41.1 (41.1) 5.9

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 18.2s
  • trigger_min/max:0.8s / 8.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:94.86% / 99.31%

Stack Uptimes

  • starlord_1:12.85%
  • starlord_2:17.98%
  • starlord_3:66.66%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Umbral Embrace 22.8 2.6 12.9s 11.5s 1.6s 12.35% 0.00% 2.6 (2.6) 0.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_umbral_embrace
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 51.0s
  • trigger_min/max:0.0s / 51.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.8s
  • uptime_min/max:4.91% / 23.30%

Stack Uptimes

  • umbral_embrace_1:12.35%

Spelldata

  • id:393763
  • name:Umbral Embrace
  • tooltip:Your next Wrath or Starfire cast during an Eclipse deals Astral damage and deals {$=}w1% additional damage.
  • description:{$@spelldesc393760=Dealing Astral damage has a chance to cause your next Wrath or Starfire cast during an Eclipse to become Astral and deal {$s1=25}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Wafting Devotion 4.3 1.2 61.1s 45.7s 16.4s 23.67% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 195.3s
  • trigger_min/max:0.0s / 195.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 70.6s
  • uptime_min/max:5.46% / 54.45%

Stack Uptimes

  • wafting_devotion_1:23.67%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Primordial Arcanic Pulsar 8.2 6.0 10.0 35.7s 23.3s 46.4s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.05% 0.00% 0.53% 0.0s 0.0s 1.0s
Astral Smolder 73.66% 64.92% 84.11% 4.1s 0.0s 42.0s
Incarnation (Total) 52.07% 46.67% 59.33% 19.1s 0.0s 54.0s
Incarnation (Pulsar) 31.86% 29.14% 34.58% 11.7s 0.0s 12.0s
Lunar Eclipse Only 40.89% 34.12% 47.10% 9.6s 0.0s 15.0s
No Eclipse 7.00% 4.50% 10.18% 1.7s 0.0s 4.4s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Fury of Elune4.8700.00027.57424.9607.49071.428

Eclipse Utilization

NoneSolarLunarBoth
Wrath24.01100.0%0.000.0%0.000.0%0.000.0%
Starfire2.412.0%0.000.0%50.0742.5%65.2055.4%
Starfall21.447.2%0.000.0%119.7940.3%155.7852.4%
Fury of Elune22.122.9%0.000.0%142.0018.8%589.8578.2%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
460 T31 4p
Fury of EluneAstral Power80.99242.685.87%3.000.270.11%
MoonfireAstral Power3.0018.000.44%6.000.000.00%
Orbit BreakerAstral Power15.54464.2611.23%29.871.990.43%
Shooting Stars (Moonfire)Astral Power232.19464.1611.23%2.000.220.05%
Shooting Stars (Sunfire)Astral Power234.18468.1311.33%2.000.230.05%
StarfireAstral Power117.682208.9453.46%18.7733.271.48%
SunfireAstral Power1.006.000.15%6.000.000.00%
WrathAstral Power26.01260.136.30%10.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
460 T31 4p
StarfallAstral Power 104.834132.75100.00%39.4239.9418163.59
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 709820.0 3277.23 3793.74 2867343.6 554415.1 -141946.8 709820.0
Astral Power 20.0 13.73 13.56 36.0 53.3 2.0 100.0

Statistics & Data Analysis

Fight Length
460 T31 4p Fight Length
Count 2433
Mean 300.88
Minimum 240.00
Maximum 359.99
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 19.94%
Standard Deviation 34.8646
5th Percentile 245.44
95th Percentile 354.67
( 95th Percentile - 5th Percentile ) 109.24
Mean Distribution
Standard Deviation 0.7068
95.00% Confidence Interval ( 299.49 - 302.26 )
Normalized 95.00% Confidence Interval ( 99.54% - 100.46% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 516
0.1% Error 51582
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1038
DPS
460 T31 4p Damage Per Second
Count 2433
Mean 753285.44
Minimum 691792.29
Maximum 820485.78
Spread ( max - min ) 128693.49
Range [ ( max - min ) / 2 * 100% ] 8.54%
Standard Deviation 18577.0101
5th Percentile 724163.89
95th Percentile 785761.10
( 95th Percentile - 5th Percentile ) 61597.20
Mean Distribution
Standard Deviation 376.6212
95.00% Confidence Interval ( 752547.28 - 754023.60 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2337
0.1 Scale Factor Error with Delta=300 2946018
0.05 Scale Factor Error with Delta=300 11784070
0.01 Scale Factor Error with Delta=300 294601738
Priority Target DPS
460 T31 4p Priority Target Damage Per Second
Count 2433
Mean 137274.46
Minimum 124058.55
Maximum 154239.89
Spread ( max - min ) 30181.35
Range [ ( max - min ) / 2 * 100% ] 10.99%
Standard Deviation 4444.3847
5th Percentile 130064.84
95th Percentile 144598.68
( 95th Percentile - 5th Percentile ) 14533.84
Mean Distribution
Standard Deviation 90.1033
95.00% Confidence Interval ( 137097.86 - 137451.06 )
Normalized 95.00% Confidence Interval ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4027
0.1 Scale Factor Error with Delta=300 168620
0.05 Scale Factor Error with Delta=300 674477
0.01 Scale Factor Error with Delta=300 16861918
DPS(e)
460 T31 4p Damage Per Second (Effective)
Count 2433
Mean 753285.44
Minimum 691792.29
Maximum 820485.78
Spread ( max - min ) 128693.49
Range [ ( max - min ) / 2 * 100% ] 8.54%
Damage
460 T31 4p Damage
Count 2433
Mean 226268450.10
Minimum 178551081.66
Maximum 278165519.08
Spread ( max - min ) 99614437.43
Range [ ( max - min ) / 2 * 100% ] 22.01%
DTPS
460 T31 4p Damage Taken Per Second
Count 2433
Mean 3792.02
Minimum 1060.10
Maximum 7210.28
Spread ( max - min ) 6150.18
Range [ ( max - min ) / 2 * 100% ] 81.09%
HPS
460 T31 4p Healing Per Second
Count 2433
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
460 T31 4p Healing Per Second (Effective)
Count 2433
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
460 T31 4p Heal
Count 2433
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
460 T31 4p Healing Taken Per Second
Count 2433
Mean 3266.93
Minimum 701.14
Maximum 6950.71
Spread ( max - min ) 6249.58
Range [ ( max - min ) / 2 * 100% ] 95.65%
TMI
460 T31 4p Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
460 T31 4pTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
460 T31 4p Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.46 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.69 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.75 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.aoe
# count action,conditions
0.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
0.00 variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
I 1.00 sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
J 3.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
0.00 variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
K 14.12 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
L 69.12 starfall,if=variable.starfall_condition1
M 1.39 starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
0.00 celestial_alignment,if=variable.cd_condition_aoe
N 2.00 incarnation,if=variable.cd_condition_aoe
0.00 warrior_of_elune
0.00 variable,name=enter_solar,value=spell_targets.starfire<3
0.00 starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
O 24.09 wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
0.00 wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
P 5.13 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
Q 34.35 starfall,if=variable.starfall_condition2
0.00 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+50
0.00 convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 new_moon,if=astral_power.deficit>variable.passive_asp+10
0.00 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
R 115.86 starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
0.00 wrath
S 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFIJLJJMLNDEPQRRLRLLRLRKLQRQRRRRLRLRLRKLQQRRRLRLRRLRKLQRQROOLRRLRRLQQRRROLOPLRKLRLQRRRLROORLQRFLRRLRELRKLQOORQRRLRLRRLROOLRQRRRLKLPQRQRRLRLOKOLLRQRRRLRRKLOOQRQRRLRRKLQQRRROLFOMLRKLNQERQRPRRLRLRKLQQRRLRRLRLRRLQRQRRRRLRKLLOOQRRLRRL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask 460 T31 4p 0.0/100: 0% astral_power
Pre precombat 1 food 460 T31 4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 2 augmentation 460 T31 4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 4 no_cd_talent 460 T31 4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 5 on_use_trinket 460 T31 4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 6 on_use_trinket 460 T31 4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 7 on_use_trinket 460 T31 4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 10.0/100: 10% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil 460 T31 4p 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.000 aoe I sunfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.943 aoe J moonfire Fluffy_Pillow 47.2/100: 47% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:01.885 aoe L starfall Fluffy_Pillow 57.2/100: 57% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:02.826 aoe J moonfire enemy2 46.2/100: 46% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, dreamstate, corrupting_rage
0:03.733 aoe J moonfire enemy4 56.2/100: 56% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, dreamstate, corrupting_rage
0:04.639 aoe M starfire Fluffy_Pillow 66.2/100: 66% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, wafting_devotion, corrupting_rage
0:05.394 aoe L starfall Fluffy_Pillow 89.4/100: 89% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, wafting_devotion, corrupting_rage
0:06.232 aoe N incarnation_chosen_of_elune Fluffy_Pillow 50.4/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(10), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), wafting_devotion, corrupting_rage
0:06.232 default D potion Fluffy_Pillow 50.4/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), wafting_devotion, corrupting_rage
0:06.232 default E use_items Fluffy_Pillow 50.4/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:06.232 aoe P fury_of_elune Fluffy_Pillow 50.4/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:06.986 aoe Q starfall Fluffy_Pillow 55.4/100: 55% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:07.741 aoe R starfire Fluffy_Pillow 32.4/100: 32% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:08.496 aoe R starfire Fluffy_Pillow 58.6/100: 59% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:09.249 aoe L starfall Fluffy_Pillow 91.8/100: 92% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:10.002 aoe R starfire Fluffy_Pillow 65.8/100: 66% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:11.064 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
0:11.818 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(11), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:12.570 aoe R starfire Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(5), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(10), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
0:13.631 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(9), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:14.384 aoe R starfire Fluffy_Pillow 71.0/100: 71% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:15.447 aoe K cancel_buff Fluffy_Pillow 92.2/100: 92% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:15.447 aoe L starfall Fluffy_Pillow 92.2/100: 92% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:16.240 aoe Q starfall Fluffy_Pillow 61.2/100: 61% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(5), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:17.003 aoe R starfire Fluffy_Pillow 28.2/100: 28% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(6), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(6), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:18.103 aoe Q starfall Fluffy_Pillow 51.4/100: 51% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(5), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:18.859 aoe R starfire Fluffy_Pillow 16.4/100: 16% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(6), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:19.922 aoe R starfire Fluffy_Pillow 35.6/100: 36% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:20.984 aoe R starfire Fluffy_Pillow 54.8/100: 55% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:22.046 aoe R starfire Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:23.108 aoe L starfall Fluffy_Pillow 99.2/100: 99% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:23.864 aoe R starfire Fluffy_Pillow 66.2/100: 66% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:24.926 aoe L starfall Fluffy_Pillow 87.4/100: 87% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(10)
0:25.679 aoe R starfire Fluffy_Pillow 58.4/100: 58% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(5)
0:26.739 aoe L starfall Fluffy_Pillow 83.6/100: 84% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(11), best_friends_with_pip_static, elemental_potion_of_ultimate_power
0:27.502 aoe R starfire Fluffy_Pillow 54.6/100: 55% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(11), best_friends_with_pip_static, elemental_potion_of_ultimate_power
0:28.649 aoe K cancel_buff Fluffy_Pillow 79.8/100: 80% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, elemental_potion_of_ultimate_power
0:28.649 aoe L starfall Fluffy_Pillow 79.8/100: 80% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, elemental_potion_of_ultimate_power
0:29.506 aoe Q starfall Fluffy_Pillow 80.8/100: 81% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, elemental_potion_of_ultimate_power
0:30.331 aoe Q starfall Fluffy_Pillow 49.8/100: 50% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), solstice, starfall(5), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(8), best_friends_with_pip_static, elemental_potion_of_ultimate_power
0:31.125 aoe R starfire Fluffy_Pillow 22.8/100: 23% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(6), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(7), best_friends_with_pip_static, elemental_potion_of_ultimate_power
0:32.272 aoe R starfire Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(6), best_friends_with_pip_static, elemental_potion_of_ultimate_power
0:33.419 aoe R starfire Fluffy_Pillow 73.2/100: 73% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(5), best_friends_with_pip_static, elemental_potion_of_ultimate_power
0:34.564 aoe L starfall Fluffy_Pillow 96.4/100: 96% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(3), best_friends_with_pip_static, elemental_potion_of_ultimate_power
0:35.332 aoe R starfire Fluffy_Pillow 63.4/100: 63% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(3), best_friends_with_pip_static, elemental_potion_of_ultimate_power
0:36.479 aoe L starfall Fluffy_Pillow 84.6/100: 85% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(2), best_friends_with_pip_static
0:37.244 aoe R starfire Fluffy_Pillow 49.6/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip, best_friends_with_pip_static
0:38.389 aoe R starfire Fluffy_Pillow 74.8/100: 75% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static
0:39.536 aoe L starfall Fluffy_Pillow 98.0/100: 98% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
0:40.301 aoe R starfire Fluffy_Pillow 65.0/100: 65% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
0:41.791 aoe K cancel_buff Fluffy_Pillow 84.2/100: 84% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
0:41.791 aoe L starfall Fluffy_Pillow 84.2/100: 84% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
0:42.905 aoe Q starfall Fluffy_Pillow 51.2/100: 51% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
0:43.976 aoe R starfire Fluffy_Pillow 16.2/100: 16% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
0:45.520 aoe Q starfall Fluffy_Pillow 39.4/100: 39% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
0:46.551 aoe R starfire Fluffy_Pillow 8.4/100: 8% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
0:48.038 aoe O wrath Fluffy_Pillow 29.6/100: 30% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
0:49.032 aoe O wrath Fluffy_Pillow 39.6/100: 40% astral_power primordial_arcanic_pulsar(50), starfall(3), starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage
0:49.787 aoe L starfall Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage
0:50.880 aoe R starfire Fluffy_Pillow 40.6/100: 41% astral_power balance_of_all_things_arcane(7), eclipse_lunar, owlkin_frenzy, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
0:51.635 aoe R starfire Fluffy_Pillow 61.8/100: 62% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
0:53.273 aoe L starfall Fluffy_Pillow 91.0/100: 91% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
0:54.367 aoe R starfire Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
0:55.857 aoe R starfire Fluffy_Pillow 73.2/100: 73% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
0:57.345 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
0:58.458 aoe Q starfall Fluffy_Pillow 69.0/100: 69% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
0:59.529 aoe Q starfall Fluffy_Pillow 36.0/100: 36% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(2), umbral_embrace, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
1:00.560 aoe R starfire Fluffy_Pillow 1.0/100: 1% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
1:02.048 aoe R starfire Fluffy_Pillow 22.2/100: 22% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
1:03.537 aoe R starfire Fluffy_Pillow 43.4/100: 43% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
1:05.026 aoe O wrath Fluffy_Pillow 64.6/100: 65% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
1:06.020 aoe L starfall Fluffy_Pillow 76.6/100: 77% astral_power primordial_arcanic_pulsar(15), starfall(2), starlord(3), dreamstate(2), best_friends_with_pip_static, corrupting_rage
1:07.115 aoe O wrath Fluffy_Pillow 31.6/100: 32% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage
1:07.870 aoe P fury_of_elune Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall, starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage
1:08.964 aoe L starfall Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_arcane(7), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall, starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage
1:10.056 aoe R starfire Fluffy_Pillow 18.6/100: 19% astral_power balance_of_all_things_arcane(6), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
1:11.040 aoe K cancel_buff Fluffy_Pillow 77.8/100: 78% astral_power balance_of_all_things_arcane(5), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
1:11.040 aoe L starfall Fluffy_Pillow 77.8/100: 78% astral_power balance_of_all_things_arcane(5), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(2), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
1:12.265 aoe R starfire Fluffy_Pillow 42.8/100: 43% astral_power balance_of_all_things_arcane(4), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:13.899 aoe L starfall Fluffy_Pillow 80.0/100: 80% astral_power balance_of_all_things_arcane(2), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(3), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:14.988 aoe Q starfall Fluffy_Pillow 45.0/100: 45% astral_power balance_of_all_things_arcane, eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(35), starfall(3), starlord(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:16.038 aoe R starfire Fluffy_Pillow 8.0/100: 8% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:17.556 aoe R starfire Fluffy_Pillow 31.2/100: 31% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:19.073 aoe R starfire Fluffy_Pillow 50.4/100: 50% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:20.591 aoe L starfall Fluffy_Pillow 73.6/100: 74% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(11), best_friends_with_pip_static, wafting_devotion
1:21.603 aoe R starfire Fluffy_Pillow 30.6/100: 31% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(10), best_friends_with_pip_static, wafting_devotion
1:23.120 aoe O wrath Fluffy_Pillow 46.6/100: 47% astral_power primordial_arcanic_pulsar(45), starfall, starlord(3), dreamstate, best_friends_with_pip(9), best_friends_with_pip_static, wafting_devotion
1:23.874 aoe O wrath Fluffy_Pillow 58.6/100: 59% astral_power primordial_arcanic_pulsar(45), starfall, starlord(3), best_friends_with_pip(8), best_friends_with_pip_static, wafting_devotion
1:24.626 aoe R starfire Fluffy_Pillow 68.6/100: 69% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), best_friends_with_pip(7), best_friends_with_pip_static, wafting_devotion
1:26.144 aoe L starfall Fluffy_Pillow 93.8/100: 94% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, best_friends_with_pip(6), best_friends_with_pip_static
1:27.370 aoe Q starfall Fluffy_Pillow 58.8/100: 59% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, best_friends_with_pip(5), best_friends_with_pip_static
1:28.549 aoe R starfire Fluffy_Pillow 17.8/100: 18% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(4), best_friends_with_pip_static
1:30.248 default F natures_vigil 460 T31 4p 73.0/100: 73% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(2), best_friends_with_pip_static
1:30.248 aoe L starfall Fluffy_Pillow 73.0/100: 73% astral_power natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(2), best_friends_with_pip_static
1:31.382 aoe R starfire Fluffy_Pillow 38.0/100: 38% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip, best_friends_with_pip_static
1:32.872 aoe R starfire Fluffy_Pillow 65.2/100: 65% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static
1:34.361 aoe L starfall Fluffy_Pillow 94.4/100: 94% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static
1:35.357 aoe R starfire Fluffy_Pillow 63.4/100: 63% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
1:36.848 default E use_items Fluffy_Pillow 90.6/100: 91% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
1:36.848 aoe L starfall Fluffy_Pillow 90.6/100: 91% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
1:37.842 aoe R starfire Fluffy_Pillow 55.6/100: 56% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
1:39.333 aoe K cancel_buff Fluffy_Pillow 74.8/100: 75% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(90)
1:39.333 aoe L starfall Fluffy_Pillow 74.8/100: 75% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(90)
1:40.447 aoe Q starfall Fluffy_Pillow 39.8/100: 40% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord, umbral_embrace, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(85)
1:41.517 aoe O wrath Fluffy_Pillow 4.8/100: 5% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(80)
1:42.548 aoe O wrath Fluffy_Pillow 16.8/100: 17% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(3), starlord(2), umbral_embrace, dreamstate, best_friends_with_pip_static, corrupting_rage, kindled_soul(75)
1:43.302 aoe R starfire Fluffy_Pillow 26.8/100: 27% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(2), umbral_embrace, best_friends_with_pip_static, corrupting_rage, kindled_soul(70)
1:44.322 aoe Q starfall Fluffy_Pillow 52.0/100: 52% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(65)
1:45.373 aoe R starfire Fluffy_Pillow 11.0/100: 11% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(60)
1:46.891 aoe R starfire Fluffy_Pillow 36.2/100: 36% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(50)
1:48.408 aoe L starfall Fluffy_Pillow 95.4/100: 95% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(45)
1:49.422 aoe R starfire Fluffy_Pillow 54.4/100: 54% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(40)
1:50.938 aoe L starfall Fluffy_Pillow 77.6/100: 78% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(30)
1:51.950 aoe R starfire Fluffy_Pillow 32.6/100: 33% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(25)
1:53.466 aoe R starfire Fluffy_Pillow 53.8/100: 54% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(20)
1:54.982 aoe L starfall Fluffy_Pillow 77.0/100: 77% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(10)
1:56.114 aoe R starfire Fluffy_Pillow 36.0/100: 36% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(5)
1:57.746 aoe O wrath Fluffy_Pillow 55.2/100: 55% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
1:58.835 aoe O wrath Fluffy_Pillow 67.2/100: 67% astral_power primordial_arcanic_pulsar(40), starfall(2), starlord, dreamstate, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
1:59.590 aoe L starfall Fluffy_Pillow 77.2/100: 77% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(40), solstice, starfall, starlord, dreamstate, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:00.680 aoe R starfire Fluffy_Pillow 36.2/100: 36% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:01.625 aoe Q starfall Fluffy_Pillow 59.4/100: 59% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, corrupting_rage
2:02.757 aoe R starfire Fluffy_Pillow 18.4/100: 18% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, corrupting_rage
2:04.396 aoe R starfire Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, corrupting_rage
2:06.035 aoe R starfire Fluffy_Pillow 70.8/100: 71% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(50), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, corrupting_rage
2:07.672 aoe L starfall Fluffy_Pillow 94.0/100: 94% astral_power eclipse_lunar, primordial_arcanic_pulsar(50), starfall, starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, corrupting_rage
2:08.765 aoe K cancel_buff Fluffy_Pillow 81.0/100: 81% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, corrupting_rage
2:08.765 aoe L starfall Fluffy_Pillow 81.0/100: 81% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, corrupting_rage
2:09.988 aoe P fury_of_elune Fluffy_Pillow 44.0/100: 44% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, corrupting_rage
2:11.059 aoe Q starfall Fluffy_Pillow 54.0/100: 54% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord, umbral_embrace, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage
2:12.130 aoe R starfire Fluffy_Pillow 33.0/100: 33% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), umbral_embrace, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage
2:13.675 aoe Q starfall Fluffy_Pillow 69.2/100: 69% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage
2:14.708 aoe R starfire Fluffy_Pillow 46.2/100: 46% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage
2:16.197 aoe R starfire Fluffy_Pillow 76.4/100: 76% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage
2:17.685 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage
2:18.681 aoe R starfire Fluffy_Pillow 68.0/100: 68% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage
2:20.169 aoe L starfall Fluffy_Pillow 93.2/100: 93% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage
2:21.162 aoe O wrath Fluffy_Pillow 62.2/100: 62% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(3), umbral_embrace, dreamstate, best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage
2:21.917 aoe K cancel_buff Fluffy_Pillow 72.2/100: 72% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), umbral_embrace, dreamstate, best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage
2:21.917 aoe O wrath Fluffy_Pillow 72.2/100: 72% astral_power primordial_arcanic_pulsar(20), starfall(2), umbral_embrace, best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage
2:22.672 aoe L starfall Fluffy_Pillow 84.2/100: 84% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), umbral_embrace, best_friends_with_urctos_static, corrupting_rage
2:23.895 aoe L starfall Fluffy_Pillow 45.2/100: 45% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord, umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, corrupting_rage
2:25.073 aoe R starfire Fluffy_Pillow 34.2/100: 34% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(4), starlord(2), umbral_embrace, balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, corrupting_rage
2:26.771 aoe Q starfall Fluffy_Pillow 61.4/100: 61% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, corrupting_rage
2:27.904 aoe R starfire Fluffy_Pillow 20.4/100: 20% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, corrupting_rage
2:29.543 aoe R starfire Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, corrupting_rage
2:31.181 aoe R starfire Fluffy_Pillow 64.8/100: 65% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, corrupting_rage
2:32.821 aoe L starfall Fluffy_Pillow 84.0/100: 84% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, corrupting_rage
2:33.915 aoe R starfire Fluffy_Pillow 39.0/100: 39% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage
2:35.552 aoe R starfire Fluffy_Pillow 62.2/100: 62% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage
2:37.189 aoe K cancel_buff Fluffy_Pillow 81.4/100: 81% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage
2:37.189 aoe L starfall Fluffy_Pillow 81.4/100: 81% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage
2:38.413 aoe O wrath Fluffy_Pillow 38.4/100: 38% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord, dreamstate, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, corrupting_rage
2:39.168 aoe O wrath Fluffy_Pillow 50.4/100: 50% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage
2:39.922 aoe Q starfall Fluffy_Pillow 60.4/100: 60% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord, best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage
2:41.099 aoe R starfire Fluffy_Pillow 23.4/100: 23% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, corrupting_rage
2:42.797 aoe Q starfall Fluffy_Pillow 52.6/100: 53% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, corrupting_rage
2:43.932 aoe R starfire Fluffy_Pillow 11.6/100: 12% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, corrupting_rage
2:45.570 aoe R starfire Fluffy_Pillow 40.8/100: 41% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, corrupting_rage
2:47.207 aoe L starfall Fluffy_Pillow 92.0/100: 92% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, corrupting_rage
2:48.299 aoe R starfire Fluffy_Pillow 51.0/100: 51% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static, corrupting_rage
2:49.789 aoe R starfire Fluffy_Pillow 78.2/100: 78% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, corrupting_rage
2:51.280 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, corrupting_rage
2:51.280 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, corrupting_rage
2:52.393 aoe Q starfall Fluffy_Pillow 71.0/100: 71% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, corrupting_rage
2:53.465 aoe Q starfall Fluffy_Pillow 40.0/100: 40% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
2:54.497 aoe R starfire Fluffy_Pillow 5.0/100: 5% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
2:55.988 aoe R starfire Fluffy_Pillow 26.2/100: 26% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
2:57.477 aoe R starfire Fluffy_Pillow 47.4/100: 47% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
2:58.966 aoe O wrath Fluffy_Pillow 68.6/100: 69% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
2:59.961 aoe L starfall Fluffy_Pillow 78.6/100: 79% astral_power primordial_arcanic_pulsar(15), starfall(2), starlord(3), dreamstate(2), best_friends_with_aerwynn_static, corrupting_rage
3:01.054 default F natures_vigil 460 T31 4p 35.6/100: 36% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), umbral_embrace, dreamstate(2), best_friends_with_aerwynn_static, corrupting_rage
3:01.054 aoe O wrath Fluffy_Pillow 35.6/100: 36% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(2), starlord(3), umbral_embrace, dreamstate, best_friends_with_aerwynn_static, corrupting_rage
3:01.808 aoe M starfire Fluffy_Pillow 47.6/100: 48% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall, starlord(3), umbral_embrace, best_friends_with_aerwynn_static, corrupting_rage
3:02.794 aoe L starfall Fluffy_Pillow 72.8/100: 73% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall, starlord(3), best_friends_with_aerwynn_static, corrupting_rage
3:03.888 aoe R starfire Fluffy_Pillow 31.8/100: 32% astral_power natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, corrupting_rage
3:05.526 aoe K cancel_buff Fluffy_Pillow 91.0/100: 91% astral_power natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, corrupting_rage
3:05.526 aoe L starfall Fluffy_Pillow 91.0/100: 91% astral_power natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, corrupting_rage
3:06.750 aoe N incarnation_chosen_of_elune Fluffy_Pillow 50.0/100: 50% astral_power natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, corrupting_rage
3:06.750 aoe Q starfall Fluffy_Pillow 50.0/100: 50% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, dreamstate(2), best_friends_with_aerwynn_static, corrupting_rage
3:07.822 default E use_items Fluffy_Pillow 19.0/100: 19% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(4), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), best_friends_with_pip(11), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:07.822 aoe R starfire Fluffy_Pillow 19.0/100: 19% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(4), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_pip(11), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(100)
3:08.681 aoe Q starfall Fluffy_Pillow 40.2/100: 40% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_pip(10), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(100)
3:09.635 aoe R starfire Fluffy_Pillow 9.2/100: 9% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(9), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(95)
3:10.466 aoe P fury_of_elune Fluffy_Pillow 34.4/100: 34% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(9), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(90)
3:11.384 aoe R starfire Fluffy_Pillow 43.4/100: 43% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(40), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(8), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(85)
3:12.761 aoe R starfire Fluffy_Pillow 81.6/100: 82% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(6), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(80)
3:14.138 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(70)
3:15.059 aoe R starfire Fluffy_Pillow 73.0/100: 73% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(65)
3:16.439 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(60)
3:17.360 aoe R starfire Fluffy_Pillow 73.0/100: 73% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(55)
3:18.739 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(50)
3:18.739 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(50)
3:19.770 aoe Q starfall Fluffy_Pillow 65.0/100: 65% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(3), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(45)
3:20.759 aoe Q starfall Fluffy_Pillow 36.0/100: 36% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(40)
3:21.713 aoe R starfire Fluffy_Pillow 35.0/100: 35% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(5), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(35)
3:23.090 aoe R starfire Fluffy_Pillow 58.2/100: 58% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(25)
3:24.580 aoe L starfall Fluffy_Pillow 89.4/100: 89% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(20)
3:25.574 aoe R starfire Fluffy_Pillow 58.4/100: 58% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(15)
3:27.061 aoe R starfire Fluffy_Pillow 79.6/100: 80% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(5)
3:28.551 aoe L starfall Fluffy_Pillow 98.8/100: 99% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:29.545 aoe R starfire Fluffy_Pillow 65.8/100: 66% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:31.034 aoe L starfall Fluffy_Pillow 87.0/100: 87% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:32.030 aoe R starfire Fluffy_Pillow 56.0/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:33.521 aoe R starfire Fluffy_Pillow 75.2/100: 75% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:35.012 aoe L starfall Fluffy_Pillow 96.4/100: 96% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:36.125 aoe Q starfall Fluffy_Pillow 65.4/100: 65% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(3), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:37.196 aoe R starfire Fluffy_Pillow 30.4/100: 30% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:38.739 aoe Q starfall Fluffy_Pillow 51.6/100: 52% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:39.771 aoe R starfire Fluffy_Pillow 18.6/100: 19% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:41.260 aoe R starfire Fluffy_Pillow 39.8/100: 40% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:42.751 aoe R starfire Fluffy_Pillow 63.0/100: 63% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:44.241 aoe R starfire Fluffy_Pillow 82.2/100: 82% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:45.729 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:46.724 aoe R starfire Fluffy_Pillow 67.0/100: 67% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:48.213 aoe K cancel_buff Fluffy_Pillow 90.2/100: 90% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:48.213 aoe L starfall Fluffy_Pillow 90.2/100: 90% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:49.326 aoe L starfall Fluffy_Pillow 87.2/100: 87% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord, dreamstate(2), best_friends_with_pip_static, corrupting_rage
3:50.502 aoe O wrath Fluffy_Pillow 46.2/100: 46% astral_power primordial_arcanic_pulsar(50), starfall(3), starlord(2), umbral_embrace, dreamstate, best_friends_with_pip_static, corrupting_rage
3:51.258 aoe O wrath Fluffy_Pillow 56.2/100: 56% astral_power primordial_arcanic_pulsar(50), starfall(3), starlord(2), umbral_embrace, best_friends_with_pip_static, corrupting_rage
3:52.013 aoe Q starfall Fluffy_Pillow 70.2/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(2), umbral_embrace, best_friends_with_pip_static, corrupting_rage
3:53.146 aoe R starfire Fluffy_Pillow 31.2/100: 31% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_pip_static
3:54.784 aoe R starfire Fluffy_Pillow 54.4/100: 54% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static
3:56.423 aoe L starfall Fluffy_Pillow 83.6/100: 84% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static
3:57.517 aoe R starfire Fluffy_Pillow 44.6/100: 45% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static
3:59.005 aoe R starfire Fluffy_Pillow 67.8/100: 68% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static
4:00.494 aoe L starfall Fluffy_Pillow 97.0/100: 97% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static

Stats

Level Bonus (70) Race Bonus (tauren) Raid-Buffed Unbuffed Gear Amount
Strength 898 2 986 900 0
Agility 2089 -2 2173 2087 0
Stamina 3848 2 35491 33801 29884
Intellect 2089 -2 13479 12668 9978 (6103)
Spirit 0 0 0 0 0
Health 709820 709820 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13479 12668 0
Crit 27.03% 20.82% 2847
Haste 22.93% 22.93% 3898
Versatility 6.19% 1.19% 243
Mana Regen 2560 2560 0
Attack Power 14018 13175 0
Mastery 29.05% 29.05% 7518
Armor 4485 4485 4485
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 468.00
Local Head Benevolent Embersage's Casque
ilevel: 470, stats: { 585 Armor, +3163 Sta, +655 Crit, +307 Haste, +786 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }, enchant: incandescent_essence
Local Neck Eye of the Rising Flame
ilevel: 470, stats: { +1779 Sta, +233 Haste, +1397 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Life-Bound Shoulderpads
ilevel: 460, stats: { 499 Armor, +2103 Sta, +346 Mastery, +346 Haste, +537 AgiInt }
item effects: { equip: Toxified }
Local Chest Benevolent Embersage's Robe
ilevel: 460, stats: { 727 Armor, +2804 Sta, +639 Crit, +284 Mastery, +716 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 470, stats: { 439 Armor, +2372 Sta, +497 Haste, +224 Mastery, +590 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 460, stats: { 636 Armor, +2804 Sta, +630 Haste, +293 Mastery, +716 AgiInt }, enchant: { +155 StrAgiInt, +41 Vers (lambent_armor_kit_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 470, stats: { 488 Armor, +2372 Sta, +257 Crit, +412 Haste, +590 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Thermal Bindings
ilevel: 470, stats: { 390 Armor, +1779 Sta, +178 Crit, +363 Mastery, +442 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Benevolent Embersage's Talons
ilevel: 460, stats: { 409 Armor, +2103 Sta, +202 Vers, +491 Mastery, +537 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 470, stats: { +1779 Sta, +466 Haste, +1165 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 470, stats: { +1779 Sta, +1118 Crit, +512 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 470, stats: { +747 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 470, stats: { +687 Mastery }
item effects: { use: Balefire Branch }
Local Back Drape of the Loyal Vassal
ilevel: 470, stats: { 312 Armor, +1779 Sta, +305 Haste, +236 Mastery, +442 StrAgiInt }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 470, weapon: { 508 - 654, 2.6 }, stats: { +393 Int, +1896 Int, +1581 Sta, +145 Haste, +335 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 470, stats: { +1206 Int, +1581 Sta, +162 Haste, +319 Mastery }

Profile

druid="460 T31 4p"
source=default
spec=balance
level=70
race=tauren
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:hissing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Balance APL can be found at https://balance-simc.github.io/Balance-SimC/balance.txt

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=470,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=470,gem_id=192961/192961/192961
shoulders=lifebound_shoulderpads,id=193406,bonus_id=8836/1576/8797/8960,ilevel=460,crafted_stats=49/36
back=drape_of_the_loyal_vassal,id=158375,bonus_id=4795,ilevel=470
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=460,enchant_id=6625
wrists=thermal_bindings,id=134461,bonus_id=4795,ilevel=470,gem_id=192961
hands=benevolent_embersages_talons,id=207255,bonus_id=4795,ilevel=460
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=460,enchant_id=6830
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=470
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=470
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=470
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=470,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=470

# Gear Summary
# gear_ilvl=467.50
# gear_stamina=29884
# gear_intellect=9978
# gear_crit_rating=2847
# gear_haste_rating=3898
# gear_mastery_rating=7518
# gear_versatility_rating=243
# gear_armor=4485
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

470 T31 2p : 712052 dps, 130326 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
712051.6 712051.6 700.1 / 0.098% 63308.8 / 8.9% 52316.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.6 13.8 Astral Power 0.00% 55.7 100.0% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
470 T31 2p 712052
Astral Smolder 101024 14.2% 372.8 0.86s 81194 0 Periodic 734.5 41215 0 41215 0.0% 81.5%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 372.83 0.00 734.46 734.46 284.85 0.0000 2.0000 30272129.14 30272129.14 0.00% 20608.55 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 734.46 562 919 41215.10 3486 202940 41270.68 35860 48579 30272129 30272129 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Fury of Elune 20814 2.9% 5.1 64.83s 1214226 1239047 Direct 755.4 5171 11210 8255 51.1%

Stats Details: Fury Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.13 755.44 0.00 0.00 0.00 0.9801 0.0000 6234883.26 6234883.26 0.00% 1239046.75 1239046.75
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.95% 369.76 238 510 5171.31 2786 16339 5179.16 4619 5942 1911623 1911623 0.00%
crit 51.05% 385.68 275 534 11210.49 5683 33331 11215.03 10163 12707 4323260 4323260 0.00%

Action Details: Fury Of Elune

  • id:202770
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:astral_power
  • energize_amount:3.0

Spelldata

  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r

Action Details: Fury Of Elune Tick

  • id:211545
  • school:astral
  • range:105.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.149000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:211545
  • name:Fury of Elune
  • school:astral
  • tooltip:
  • description:{$@spelldesc202770=Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r}

Action Priority List

    aoe
    [P]:5.13
  • if_expr:target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Hungering Shadowflame 2900 0.4% 16.9 16.87s 51512 0 Direct 16.9 39936 82578 51507 27.1%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.89 16.89 0.00 0.00 0.00 0.0000 0.0000 869942.23 869942.23 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.87% 12.31 4 25 39935.50 26983 154715 39808.77 26983 88403 491534 491534 0.00%
crit 27.13% 4.58 0 13 82577.63 55045 315618 81751.98 0 289809 378409 378409 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24191.79
  • base_dd_max:24191.79
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 5566 0.8% 33.7 8.88s 49508 0 Direct 33.7 38627 78717 49624 27.4%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.74 33.66 0.00 0.00 0.00 0.0000 0.0000 1670342.66 1670342.66 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.55% 24.42 9 42 38627.06 38195 43801 38626.72 38195 40082 943203 943203 0.00%
crit 27.45% 9.24 1 22 78717.26 77919 89355 78719.61 77919 83875 727140 727140 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy3
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:34245.43
  • base_dd_max:34245.43
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 61130 8.6% 3.0 1.06s 6112120 6558068 Direct 6.0 6010 12248 9068 49.0%
Periodic 1799.9 7083 14658 10158 40.6% 99.1%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.00 6.00 1799.90 1799.90 0.00 0.9322 0.9922 18336359.25 18336359.25 0.00% 10251.24 6558068.40
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 50.99% 3.06 0 6 6010.12 5948 6821 5957.33 0 6821 18387 18387 0.00%
crit 49.01% 2.94 0 6 12248.48 12134 13915 12082.49 0 13915 36020 36020 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 59.41% 1069.28 809 1344 7082.93 5716 11402 7082.17 6921 7238 7573349 7573349 0.00%
crit 40.59% 730.61 543 952 14657.80 11660 23260 14657.60 14304 15091 10708604 10708604 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    aoe
    [J]:3.00
  • if_expr:!fight_style.dungeonroute
  • target_if_expr:refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (61730) 0.0% (8.7%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 15304 2.2% 233.2 1.49s 19687 0 Direct 232.5 12524 26894 19742 50.2%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 233.17 232.54 0.00 0.00 0.00 0.0000 0.0000 4590416.88 4590416.88 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.78% 115.76 68 164 12523.91 9388 22480 12524.26 11885 13289 1449693 1449693 0.00%
crit 50.22% 116.79 73 168 26893.99 19151 45858 26907.92 25449 28902 3140724 3140724 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy3
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 15334 2.2% 234.4 1.48s 19622 0 Direct 233.7 12483 26807 19677 50.2%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 234.36 233.74 0.00 0.00 0.00 0.0000 0.0000 4598746.15 4598746.15 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.79% 116.38 72 168 12483.14 8500 22480 12484.62 11780 13244 1452817 1452817 0.00%
crit 50.21% 117.36 73 170 26806.51 17339 45858 26820.19 25434 28557 3145930 3145930 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 31093 4.4% 15.6 19.48s 598531 0 Direct 93.2 63638 136616 100086 49.9%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.58 93.20 0.00 0.00 0.00 0.0000 0.0000 9324736.29 9324736.29 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 50.09% 46.68 23 75 63637.68 35038 220818 63664.34 51969 77362 2970581 2970581 0.00%
crit 49.91% 46.52 25 73 136616.11 71477 456313 136623.62 112471 162696 6354155 6354155 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:enemy4
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfall 232033 32.6% 103.5 2.88s 671800 655278 Direct 1770.5 25973 56241 39285 44.0%

Stats Details: Starfall

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 103.52 1770.49 0.00 0.00 0.00 1.0252 0.0000 69547923.74 69547923.74 0.00% 655277.94 655277.94
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.02% 991.75 733 1257 25973.14 6353 90724 26017.24 23737 28779 25755142 25755142 0.00%
crit 43.98% 778.74 586 985 56241.39 12959 182540 56315.00 52546 60824 43792782 43792782 0.00%

Action Details: Starfall

  • id:191034
  • school:astral
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:45.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]

Action Details: Starfall Damage

  • id:191037
  • school:astral
  • range:200.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.114000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.41

Spelldata

  • id:191037
  • name:Starfall
  • school:astral
  • tooltip:
  • description:{$@spelldesc191034=Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]}

Action Priority List

    aoe
    [L]:69.27
  • if_expr:variable.starfall_condition1
    aoe
    [Q]:34.26
  • if_expr:variable.starfall_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountLunar Shrapnel4151691PCT0.200
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 166002 23.3% 116.6 2.54s 426824 301951 Direct 705.6 44102 95508 70529 51.4%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 116.59 705.56 0.00 0.00 0.00 1.4136 0.0000 49764783.66 49764783.66 0.00% 301950.62 301950.62
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.60% 342.88 249 448 44102.16 6408 199764 44117.85 39742 49456 15123432 15123432 0.00%
crit 51.40% 362.68 270 463 95508.30 13072 407518 95541.75 86241 105763 34641351 34641351 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    aoe
    [M]:1.36
  • if_expr:buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
    aoe
    [R]:115.76
  • if_expr:spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Solar)4851710.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Sunfire16481550.283Mastery
Sunfire 51966 7.3% 1.0 0.00s 15578582 16572960 Direct 1.0 4729 9646 6161 29.0%
Periodic 1812.8 6071 12913 8591 36.8% 99.8%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 1812.82 1812.82 0.00 0.9404 0.9919 15578581.95 15578581.95 0.00% 8659.46 16572959.53
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.01% 0.71 0 1 4729.09 4702 4760 3358.18 0 4760 3358 3358 0.00%
crit 28.99% 0.29 0 1 9645.90 9592 9709 2796.41 0 9709 2796 2796 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 63.18% 1145.31 866 1420 6071.49 4724 10366 6072.92 5921 6260 6953408 6953408 0.00%
crit 36.82% 667.51 499 879 12912.73 9636 21146 12916.89 12571 13419 8619020 8619020 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    aoe
    [I]:1.00
  • target_if_expr:refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (5330) 0.0% (0.7%) 8.3 32.52s 191919 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.34 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 2788 0.4% 8.3 32.52s 100394 0 Direct 50.0 13008 26515 16734 27.6%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.34 50.03 0.00 0.00 0.00 0.0000 0.0000 837095.48 837095.48 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.44% 36.24 8 95 13008.18 12857 14744 13008.89 12857 13903 471435 471435 0.00%
crit 27.56% 13.79 1 37 26515.16 26228 30078 26519.59 26228 29062 365661 365661 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:39522.22
  • base_dd_max:39522.22
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 2541 0.4% 16.0 15.90s 47590 0 Direct 96.2 6188 12614 7932 27.1%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.04 96.21 0.00 0.00 0.00 0.0000 0.0000 763142.95 763142.95 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.88% 70.12 19 184 6188.40 6118 7016 6189.00 6118 6690 433933 433933 0.00%
crit 27.12% 26.10 2 74 12613.82 12480 14312 12616.16 12480 13549 329210 329210 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18805.57
  • base_dd_max:18805.57
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 3556 0.5% 26.1 10.51s 41183 53303 Direct 25.9 29294 60099 41405 39.3%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.05 25.91 0.00 0.00 0.00 0.7726 0.0000 1072825.58 1072825.58 0.00% 53302.81 53302.81
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 60.67% 15.72 4 27 29294.05 13038 55420 29243.43 22230 35157 460503 460503 0.00%
crit 39.33% 10.19 2 21 60098.73 26597 108687 59912.30 34951 76892 612323 612323 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    aoe
    [O]:24.13
  • if_expr:!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.800Spell Data
Eclipse (Solar)4851710.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Lunar)4851810.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
470 T31 2p
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31 2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31 2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31 2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 180.99s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    aoe
    [N]:2.00
  • if_expr:variable.cd_condition_aoe

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.2 182.00s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.18 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31 2p
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:57075.72
  • base_dd_max:57075.72
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.38s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31 2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.75
Elemental Potion of Ultimate Power 1.4 307.29s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.45 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.44
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 17.7 5.4 17.5s 13.6s 9.5s 55.72% 57.52% 5.4 (17.7) 17.1

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 43.6s
  • trigger_min/max:0.0s / 36.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:51.18% / 58.96%

Stack Uptimes

  • balance_of_all_things_arcane_1:5.80%
  • balance_of_all_things_arcane_2:6.18%
  • balance_of_all_things_arcane_3:6.65%
  • balance_of_all_things_arcane_4:7.04%
  • balance_of_all_things_arcane_5:7.30%
  • balance_of_all_things_arcane_6:7.49%
  • balance_of_all_things_arcane_7:7.60%
  • balance_of_all_things_arcane_8:7.66%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 10.2 0.0 30.1s 30.1s 7.9s 26.86% 29.85% 0.0 (0.0) 9.9

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.3s / 47.2s
  • trigger_min/max:4.6s / 46.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:24.48% / 29.83%

Stack Uptimes

  • balance_of_all_things_nature_1:3.32%
  • balance_of_all_things_nature_2:3.33%
  • balance_of_all_things_nature_3:3.34%
  • balance_of_all_things_nature_4:3.36%
  • balance_of_all_things_nature_5:3.36%
  • balance_of_all_things_nature_6:3.37%
  • balance_of_all_things_nature_7:3.38%
  • balance_of_all_things_nature_8:3.39%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Best Friends with Aerwynn 2.8 0.0 70.1s 70.1s 10.8s 10.13% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 331.0s
  • trigger_min/max:12.0s / 331.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 29.14%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.90%
  • best_friends_with_aerwynn_2:0.91%
  • best_friends_with_aerwynn_3:0.91%
  • best_friends_with_aerwynn_4:0.92%
  • best_friends_with_aerwynn_5:0.92%
  • best_friends_with_aerwynn_6:0.92%
  • best_friends_with_aerwynn_7:0.92%
  • best_friends_with_aerwynn_8:0.93%
  • best_friends_with_aerwynn_9:0.93%
  • best_friends_with_aerwynn_10:0.93%
  • best_friends_with_aerwynn_11:0.94%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 114.2s 70.1s 45.1s 33.42% 0.00% 69.9 (69.9) 0.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:14.4s / 331.0s
  • trigger_min/max:12.0s / 331.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 256.2s
  • uptime_min/max:0.00% / 95.92%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.42%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.9 0.0 70.4s 70.4s 10.8s 10.36% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 321.6s
  • trigger_min/max:12.0s / 321.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 38.45%

Stack Uptimes

  • best_friends_with_pip_1:0.93%
  • best_friends_with_pip_2:0.93%
  • best_friends_with_pip_3:0.93%
  • best_friends_with_pip_4:0.94%
  • best_friends_with_pip_5:0.94%
  • best_friends_with_pip_6:0.94%
  • best_friends_with_pip_7:0.94%
  • best_friends_with_pip_8:0.95%
  • best_friends_with_pip_9:0.95%
  • best_friends_with_pip_10:0.96%
  • best_friends_with_pip_11:0.96%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.3 0.9 112.8s 70.4s 45.2s 34.03% 0.00% 71.2 (71.2) 0.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 343.3s
  • trigger_min/max:12.0s / 321.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 277.2s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:34.03%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 69.2s 69.2s 10.8s 9.96% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 312.8s
  • trigger_min/max:12.0s / 312.8s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 11.0s
  • uptime_min/max:0.00% / 28.80%

Stack Uptimes

  • best_friends_with_urctos_1:0.89%
  • best_friends_with_urctos_2:0.89%
  • best_friends_with_urctos_3:0.90%
  • best_friends_with_urctos_4:0.90%
  • best_friends_with_urctos_5:0.90%
  • best_friends_with_urctos_6:0.91%
  • best_friends_with_urctos_7:0.91%
  • best_friends_with_urctos_8:0.91%
  • best_friends_with_urctos_9:0.91%
  • best_friends_with_urctos_10:0.92%
  • best_friends_with_urctos_11:0.92%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 112.6s 69.2s 45.0s 32.55% 0.00% 67.6 (67.6) 0.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:14.4s / 332.3s
  • trigger_min/max:12.0s / 312.8s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 280.9s
  • uptime_min/max:0.00% / 94.11%

Stack Uptimes

  • best_friends_with_urctos_static_1:32.55%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.51% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.66%

Stack Uptimes

  • bloodlust_1:13.51%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 61.9s 58.3s 50.1s 80.19% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 328.0s
  • trigger_min/max:15.0s / 313.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 350.0s
  • uptime_min/max:54.43% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.19%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dreamstate 15.1 0.2 20.6s 21.5s 2.2s 10.80% 20.50% 0.2 (0.3) 0.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.6s / 54.0s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.4s
  • uptime_min/max:7.76% / 16.15%

Stack Uptimes

  • dreamstate_1:7.26%
  • dreamstate_2:3.54%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 13.1 8.0 23.9s 15.0s 21.3s 93.02% 93.70% 8.0 (8.0) 12.2

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.7s / 70.3s
  • trigger_min/max:0.0s / 56.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 68.4s
  • uptime_min/max:90.00% / 95.85%

Stack Uptimes

  • eclipse_lunar_1:93.02%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 8.2 0.0 38.5s 38.5s 19.1s 52.21% 54.10% 0.0 (0.0) 7.8

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 85.4s
  • trigger_min/max:12.0s / 85.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.74% / 59.71%

Stack Uptimes

  • eclipse_solar_1:52.21%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 306.3s 306.3s 27.4s 12.95% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 325.0s
  • trigger_min/max:300.0s / 325.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.77% / 17.86%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.95%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Fury of Elune 5.1 0.0 64.7s 64.7s 7.9s 13.52% 0.00% 76.0 (76.0) 5.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:60.0s / 87.2s
  • trigger_min/max:60.0s / 87.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s
  • uptime_min/max:11.18% / 15.44%

Stack Uptimes

  • fury_of_elune_1:13.52%

Spelldata

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 8.2 0.0 38.5s 38.5s 19.1s 52.21% 54.82% 0.0 (0.0) 7.8

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 85.4s
  • trigger_min/max:12.0s / 85.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.74% / 59.71%

Stack Uptimes

  • incarnation_chosen_of_elune_1:52.21%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.7 0.0 90.9s 90.9s 19.5s 23.94% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:55.09

Trigger Details

  • interval_min/max:90.0s / 121.8s
  • trigger_min/max:90.0s / 121.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:21.43% / 26.99%

Stack Uptimes

  • kindled_soul_5:1.17%
  • kindled_soul_10:1.17%
  • kindled_soul_15:1.18%
  • kindled_soul_20:1.18%
  • kindled_soul_25:1.18%
  • kindled_soul_30:1.18%
  • kindled_soul_35:1.19%
  • kindled_soul_40:1.19%
  • kindled_soul_45:1.19%
  • kindled_soul_50:1.19%
  • kindled_soul_55:1.20%
  • kindled_soul_60:1.20%
  • kindled_soul_65:1.20%
  • kindled_soul_70:1.21%
  • kindled_soul_75:1.21%
  • kindled_soul_80:1.21%
  • kindled_soul_85:1.22%
  • kindled_soul_90:1.22%
  • kindled_soul_95:1.22%
  • kindled_soul_100:1.23%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Vigil 3.7 0.0 90.4s 90.4s 14.7s 18.39% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.5s
  • trigger_min/max:90.0s / 91.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.56% / 21.02%

Stack Uptimes

  • natures_vigil_1:18.39%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.0 69.9s 69.2s 0.9s 0.76% 1.17% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 308.3s
  • trigger_min/max:0.1s / 308.3s
  • trigger_pct:15.05%
  • duration_min/max:0.0s / 6.4s
  • uptime_min/max:0.00% / 4.28%

Stack Uptimes

  • owlkin_frenzy_1:0.76%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 9.1 95.4 34.4s 34.4s 30.2s 91.22% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:21.9s / 46.1s
  • trigger_min/max:21.9s / 46.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.7s
  • uptime_min/max:87.84% / 94.17%

Stack Uptimes

  • primordial_arcanic_pulsar_5:7.18%
  • primordial_arcanic_pulsar_10:6.70%
  • primordial_arcanic_pulsar_15:7.75%
  • primordial_arcanic_pulsar_20:8.26%
  • primordial_arcanic_pulsar_25:8.49%
  • primordial_arcanic_pulsar_30:8.18%
  • primordial_arcanic_pulsar_35:8.70%
  • primordial_arcanic_pulsar_40:9.12%
  • primordial_arcanic_pulsar_45:9.03%
  • primordial_arcanic_pulsar_50:8.89%
  • primordial_arcanic_pulsar_55:8.93%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 19.8 3.3 15.6s 13.6s 6.6s 43.74% 42.96% 3.3 (3.3) 19.4

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 41.8s
  • trigger_min/max:0.0s / 36.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:39.53% / 46.41%

Stack Uptimes

  • solstice_1:43.74%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starfall 103.5 0.0 143.3s 2.9s 296.3s 98.87% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_starfall
  • max_stacks:20
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:asynchronous
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.9s / 357.1s
  • trigger_min/max:0.7s / 8.5s
  • trigger_pct:99.99%
  • duration_min/max:26.8s / 358.0s
  • uptime_min/max:98.42% / 99.47%

Stack Uptimes

  • starfall_1:5.65%
  • starfall_2:33.62%
  • starfall_3:42.02%
  • starfall_4:14.24%
  • starfall_5:3.04%
  • starfall_6:0.31%
  • starfall_7:0.00%

Spelldata

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]
  • max_stacks:20
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Starlord 21.0 82.5 14.5s 2.9s 13.9s 97.50% 0.00% 41.2 (41.2) 5.9

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 18.5s
  • trigger_min/max:0.8s / 8.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:95.22% / 99.17%

Stack Uptimes

  • starlord_1:12.79%
  • starlord_2:18.00%
  • starlord_3:66.71%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Umbral Embrace 22.8 2.6 12.9s 11.5s 1.6s 12.38% 0.00% 2.6 (2.6) 0.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_umbral_embrace
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 52.1s
  • trigger_min/max:0.0s / 52.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.5s
  • uptime_min/max:3.41% / 22.54%

Stack Uptimes

  • umbral_embrace_1:12.38%

Spelldata

  • id:393763
  • name:Umbral Embrace
  • tooltip:Your next Wrath or Starfire cast during an Eclipse deals Astral damage and deals {$=}w1% additional damage.
  • description:{$@spelldesc393760=Dealing Astral damage has a chance to cause your next Wrath or Starfire cast during an Eclipse to become Astral and deal {$s1=25}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Wafting Devotion 4.3 1.2 61.0s 45.5s 16.5s 23.49% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 205.3s
  • trigger_min/max:0.0s / 200.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.6s
  • uptime_min/max:5.26% / 54.08%

Stack Uptimes

  • wafting_devotion_1:23.49%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Primordial Arcanic Pulsar 8.2 6.0 10.0 35.6s 24.3s 46.6s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.05% 0.00% 0.66% 0.0s 0.0s 1.1s
Astral Smolder 73.81% 62.60% 83.58% 4.1s 0.0s 42.0s
Incarnation (Total) 52.21% 46.74% 59.71% 19.1s 0.0s 54.0s
Incarnation (Pulsar) 31.94% 28.60% 34.86% 11.7s 0.0s 12.0s
Lunar Eclipse Only 40.81% 33.18% 47.17% 9.5s 0.0s 15.0s
No Eclipse 6.95% 4.15% 9.59% 1.7s 0.0s 4.4s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Fury of Elune4.9570.00027.20325.3916.04982.659

Eclipse Utilization

NoneSolarLunarBoth
Wrath24.05100.0%0.000.0%0.000.0%0.000.0%
Starfire2.442.1%0.000.0%49.8742.4%65.2855.5%
Starfall21.197.2%0.000.0%119.3440.3%155.8452.6%
Fury of Elune20.752.7%0.000.0%145.3419.2%589.3578.0%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
470 T31 2p
Fury of EluneAstral Power80.98242.175.86%2.990.760.31%
MoonfireAstral Power3.0018.000.44%6.000.000.00%
Orbit BreakerAstral Power15.58465.3611.26%29.872.010.43%
Shooting Stars (Moonfire)Astral Power233.19466.1211.28%2.000.250.05%
Shooting Stars (Sunfire)Astral Power234.37468.5111.33%2.000.230.05%
StarfireAstral Power117.592206.8953.39%18.7733.221.48%
SunfireAstral Power1.006.000.15%6.000.000.00%
WrathAstral Power26.05260.516.30%10.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
470 T31 2p
StarfallAstral Power 105.054140.09100.00%39.4139.9916798.63
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 736200.0 3364.79 3889.72 2626960.8 578612.4 18949.9 736200.0
Astral Power 20.0 13.77 13.59 36.5 53.4 2.4 100.0

Statistics & Data Analysis

Fight Length
470 T31 2p Fight Length
Count 2180
Mean 300.21
Minimum 240.16
Maximum 359.90
Spread ( max - min ) 119.73
Range [ ( max - min ) / 2 * 100% ] 19.94%
Standard Deviation 34.7848
5th Percentile 246.44
95th Percentile 354.36
( 95th Percentile - 5th Percentile ) 107.92
Mean Distribution
Standard Deviation 0.7450
95.00% Confidence Interval ( 298.75 - 301.67 )
Normalized 95.00% Confidence Interval ( 99.51% - 100.49% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 516
0.1% Error 51573
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1033
DPS
470 T31 2p Damage Per Second
Count 2180
Mean 712051.62
Minimum 659009.59
Maximum 775377.83
Spread ( max - min ) 116368.24
Range [ ( max - min ) / 2 * 100% ] 8.17%
Standard Deviation 16678.3800
5th Percentile 685561.09
95th Percentile 739664.02
( 95th Percentile - 5th Percentile ) 54102.93
Mean Distribution
Standard Deviation 357.2117
95.00% Confidence Interval ( 711351.49 - 712751.74 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2108
0.1 Scale Factor Error with Delta=300 2374606
0.05 Scale Factor Error with Delta=300 9498421
0.01 Scale Factor Error with Delta=300 237460511
Priority Target DPS
470 T31 2p Priority Target Damage Per Second
Count 2180
Mean 130326.05
Minimum 115940.58
Maximum 144660.26
Spread ( max - min ) 28719.68
Range [ ( max - min ) / 2 * 100% ] 11.02%
Standard Deviation 4109.7732
5th Percentile 123861.95
95th Percentile 137404.54
( 95th Percentile - 5th Percentile ) 13542.59
Mean Distribution
Standard Deviation 88.0217
95.00% Confidence Interval ( 130153.53 - 130498.57 )
Normalized 95.00% Confidence Interval ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3821
0.1 Scale Factor Error with Delta=300 144185
0.05 Scale Factor Error with Delta=300 576740
0.01 Scale Factor Error with Delta=300 14418477
DPS(e)
470 T31 2p Damage Per Second (Effective)
Count 2180
Mean 712051.62
Minimum 659009.59
Maximum 775377.83
Spread ( max - min ) 116368.24
Range [ ( max - min ) / 2 * 100% ] 8.17%
Damage
470 T31 2p Damage
Count 2180
Mean 213461909.22
Minimum 163599439.79
Maximum 260302249.05
Spread ( max - min ) 96702809.26
Range [ ( max - min ) / 2 * 100% ] 22.65%
DTPS
470 T31 2p Damage Taken Per Second
Count 2180
Mean 3891.14
Minimum 1077.94
Maximum 7202.39
Spread ( max - min ) 6124.45
Range [ ( max - min ) / 2 * 100% ] 78.70%
HPS
470 T31 2p Healing Per Second
Count 2180
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
470 T31 2p Healing Per Second (Effective)
Count 2180
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
470 T31 2p Heal
Count 2180
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
470 T31 2p Healing Taken Per Second
Count 2180
Mean 3357.59
Minimum 809.57
Maximum 6459.05
Spread ( max - min ) 5649.48
Range [ ( max - min ) / 2 * 100% ] 84.13%
TMI
470 T31 2p Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
470 T31 2pTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
470 T31 2p Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.44 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.68 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.75 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.aoe
# count action,conditions
0.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
0.00 variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
I 1.00 sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
J 3.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
0.00 variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
K 14.14 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
L 69.27 starfall,if=variable.starfall_condition1
M 1.36 starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
0.00 celestial_alignment,if=variable.cd_condition_aoe
N 2.00 incarnation,if=variable.cd_condition_aoe
0.00 warrior_of_elune
0.00 variable,name=enter_solar,value=spell_targets.starfire<3
0.00 starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
O 24.13 wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
0.00 wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
P 5.13 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
Q 34.26 starfall,if=variable.starfall_condition2
0.00 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+50
0.00 convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 new_moon,if=astral_power.deficit>variable.passive_asp+10
0.00 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
R 115.76 starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
0.00 wrath
S 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFIJJLJMLNDEPQRRLLRLRLRLRKLQRQRRRRLRLLRLRRLQRQRRRLRRLRLRKLOLOQRRRLRLRKLOOQPRLRLRLRRLOOQRQRRLRFRKLQRQERRRLRLOORLLRQRRRLRLOOQRRQRLPRLRKLQQRROOLRLRKLRQRRQOORRKLRQRQRRLRLRKLQRFOOQRRLNERRLRKLPQQRRLRLLRKQQRQRRRRLRKLQRLRRLRLOORKLQRQRRLRLRLOOQRQRRQRRRKLLOOQRRRFLRLPRLELQRRLRLOORLRKLRQRRLRLOOR

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask 470 T31 2p 0.0/100: 0% astral_power
Pre precombat 1 food 470 T31 2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 2 augmentation 470 T31 2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 4 no_cd_talent 470 T31 2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 5 on_use_trinket 470 T31 2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 6 on_use_trinket 470 T31 2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 7 on_use_trinket 470 T31 2p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 10.0/100: 10% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil 470 T31 2p 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.000 aoe I sunfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.940 aoe J moonfire Fluffy_Pillow 79.2/100: 79% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:01.879 aoe J moonfire enemy2 87.2/100: 87% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:02.821 aoe L starfall Fluffy_Pillow 97.2/100: 97% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, dreamstate, wafting_devotion, corrupting_rage
0:03.691 aoe J moonfire enemy3 58.2/100: 58% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate, wafting_devotion, corrupting_rage
0:04.529 aoe M starfire Fluffy_Pillow 68.2/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, wafting_devotion, corrupting_rage
0:05.283 aoe L starfall Fluffy_Pillow 91.4/100: 91% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, wafting_devotion, corrupting_rage
0:06.120 aoe N incarnation_chosen_of_elune Fluffy_Pillow 50.4/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(10), starfall(2), starlord(2), wafting_devotion, corrupting_rage
0:06.120 default D potion Fluffy_Pillow 50.4/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), wafting_devotion, corrupting_rage
0:06.120 default E use_items Fluffy_Pillow 50.4/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:06.120 aoe P fury_of_elune Fluffy_Pillow 50.4/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:06.875 aoe Q starfall Fluffy_Pillow 57.4/100: 57% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:07.630 aoe R starfire Fluffy_Pillow 32.4/100: 32% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), dreamstate, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:08.384 aoe R starfire Fluffy_Pillow 62.6/100: 63% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(90)
0:09.140 aoe L starfall Fluffy_Pillow 93.8/100: 94% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(85)
0:09.895 aoe L starfall Fluffy_Pillow 67.8/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(85)
0:10.649 aoe R starfire Fluffy_Pillow 74.8/100: 75% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(5), starlord(3), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(80)
0:11.709 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(4), starlord(3), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(75)
0:12.462 aoe R starfire Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(5), starlord(3), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(70)
0:13.521 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(4), starlord(3), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(65)
0:14.274 aoe R starfire Fluffy_Pillow 73.0/100: 73% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(5), starlord(3), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(60)
0:15.334 aoe L starfall Fluffy_Pillow 92.2/100: 92% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(55)
0:16.088 aoe R starfire Fluffy_Pillow 59.2/100: 59% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(5), starlord(3), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(55)
0:17.150 aoe K cancel_buff Fluffy_Pillow 82.4/100: 82% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(5), starlord(3), elemental_potion_of_ultimate_power, kindled_soul(45)
0:17.150 aoe L starfall Fluffy_Pillow 82.4/100: 82% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(5), elemental_potion_of_ultimate_power, kindled_soul(45)
0:18.007 aoe Q starfall Fluffy_Pillow 51.4/100: 51% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord, elemental_potion_of_ultimate_power, kindled_soul(45)
0:18.829 aoe R starfire Fluffy_Pillow 16.4/100: 16% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(5), starlord(2), elemental_potion_of_ultimate_power, kindled_soul(40)
0:20.017 aoe Q starfall Fluffy_Pillow 39.6/100: 40% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(2), elemental_potion_of_ultimate_power, kindled_soul(35)
0:20.810 aoe R starfire Fluffy_Pillow 4.6/100: 5% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(5), starlord(3), elemental_potion_of_ultimate_power, kindled_soul(30)
0:21.953 aoe R starfire Fluffy_Pillow 25.8/100: 26% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(4), starlord(3), elemental_potion_of_ultimate_power, kindled_soul(25)
0:23.098 aoe R starfire Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(4), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:24.243 aoe R starfire Fluffy_Pillow 70.2/100: 70% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(3), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:25.387 aoe L starfall Fluffy_Pillow 93.4/100: 93% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:26.150 aoe R starfire Fluffy_Pillow 62.4/100: 62% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:27.294 aoe L starfall Fluffy_Pillow 85.6/100: 86% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:28.057 aoe L starfall Fluffy_Pillow 86.6/100: 87% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:28.821 aoe R starfire Fluffy_Pillow 55.6/100: 56% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:29.965 aoe L starfall Fluffy_Pillow 82.8/100: 83% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), best_friends_with_urctos(8), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:30.718 aoe R starfire Fluffy_Pillow 53.8/100: 54% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), solstice, starfall(4), starlord(3), best_friends_with_urctos(7), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:31.778 aoe R starfire Fluffy_Pillow 79.0/100: 79% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), best_friends_with_urctos(6), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:32.838 aoe L starfall Fluffy_Pillow 98.2/100: 98% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), best_friends_with_urctos(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:33.630 aoe Q starfall Fluffy_Pillow 65.2/100: 65% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord, umbral_embrace, best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:34.392 aoe R starfire Fluffy_Pillow 30.2/100: 30% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(5), starlord(2), umbral_embrace, best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:35.491 aoe Q starfall Fluffy_Pillow 53.4/100: 53% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(2), best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:36.247 aoe R starfire Fluffy_Pillow 20.4/100: 20% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:37.306 aoe R starfire Fluffy_Pillow 41.6/100: 42% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:38.365 aoe R starfire Fluffy_Pillow 64.8/100: 65% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:39.424 aoe L starfall Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:40.179 aoe R starfire Fluffy_Pillow 53.0/100: 53% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:41.556 aoe R starfire Fluffy_Pillow 74.2/100: 74% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:42.933 aoe L starfall Fluffy_Pillow 95.4/100: 95% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:43.851 aoe R starfire Fluffy_Pillow 62.4/100: 62% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:45.228 aoe L starfall Fluffy_Pillow 85.6/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage
0:46.218 aoe R starfire Fluffy_Pillow 50.6/100: 51% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), umbral_embrace, best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage
0:47.705 aoe K cancel_buff Fluffy_Pillow 73.8/100: 74% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage
0:47.705 aoe L starfall Fluffy_Pillow 73.8/100: 74% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(2), best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage
0:48.816 aoe O wrath Fluffy_Pillow 40.8/100: 41% astral_power primordial_arcanic_pulsar(50), starfall(3), starlord, dreamstate, best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage
0:49.571 aoe L starfall Fluffy_Pillow 82.8/100: 83% astral_power primordial_arcanic_pulsar(50), starfall(3), starlord, dreamstate, best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage
0:50.747 aoe O wrath Fluffy_Pillow 37.8/100: 38% astral_power primordial_arcanic_pulsar(55), starfall(4), starlord(2), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage
0:51.500 aoe Q starfall Fluffy_Pillow 53.8/100: 54% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage
0:52.632 aoe R starfire Fluffy_Pillow 14.8/100: 15% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(4), starlord(3), best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage
0:54.119 aoe R starfire Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage
0:55.605 aoe R starfire Fluffy_Pillow 67.2/100: 67% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), best_friends_with_urctos_static, corrupting_rage
0:57.092 aoe L starfall Fluffy_Pillow 92.4/100: 92% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_urctos_static, corrupting_rage
0:58.085 aoe R starfire Fluffy_Pillow 59.4/100: 59% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), best_friends_with_urctos_static, corrupting_rage
0:59.572 aoe L starfall Fluffy_Pillow 86.6/100: 87% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall, starlord(3), best_friends_with_urctos_static, corrupting_rage
1:00.565 aoe R starfire Fluffy_Pillow 53.6/100: 54% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_urctos_static, corrupting_rage
1:02.050 aoe K cancel_buff Fluffy_Pillow 72.8/100: 73% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_urctos_static, corrupting_rage
1:02.050 aoe L starfall Fluffy_Pillow 72.8/100: 73% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), best_friends_with_urctos_static, corrupting_rage
1:03.162 aoe O wrath Fluffy_Pillow 37.8/100: 38% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord, best_friends_with_urctos_static, corrupting_rage
1:04.229 aoe O wrath Fluffy_Pillow 49.8/100: 50% astral_power primordial_arcanic_pulsar(15), starfall(3), starlord, dreamstate, best_friends_with_urctos_static, corrupting_rage
1:04.982 aoe Q starfall Fluffy_Pillow 59.8/100: 60% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord, dreamstate, best_friends_with_urctos_static, corrupting_rage
1:06.157 aoe P fury_of_elune Fluffy_Pillow 20.8/100: 21% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(2), umbral_embrace, dreamstate, best_friends_with_urctos_static, corrupting_rage
1:07.289 aoe R starfire Fluffy_Pillow 32.8/100: 33% astral_power balance_of_all_things_arcane(6), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(2), umbral_embrace, best_friends_with_urctos_static, corrupting_rage
1:08.307 aoe L starfall Fluffy_Pillow 94.0/100: 94% astral_power balance_of_all_things_arcane(5), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(2), best_friends_with_urctos_static, corrupting_rage
1:09.438 aoe R starfire Fluffy_Pillow 59.0/100: 59% astral_power balance_of_all_things_arcane(4), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), best_friends_with_urctos_static
1:11.073 aoe L starfall Fluffy_Pillow 91.2/100: 91% astral_power balance_of_all_things_arcane(2), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), starfall(2), starlord(3), best_friends_with_urctos_static
1:12.165 aoe R starfire Fluffy_Pillow 55.2/100: 55% astral_power balance_of_all_things_arcane, eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(3), starlord(3), best_friends_with_urctos_static
1:13.801 aoe L starfall Fluffy_Pillow 83.4/100: 83% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(2), starlord(3), best_friends_with_urctos_static
1:14.892 aoe R starfire Fluffy_Pillow 41.4/100: 41% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), best_friends_with_urctos_static
1:16.527 aoe R starfire Fluffy_Pillow 62.6/100: 63% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_urctos_static
1:18.162 aoe L starfall Fluffy_Pillow 89.8/100: 90% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), best_friends_with_urctos(11), best_friends_with_urctos_static
1:19.385 aoe O wrath Fluffy_Pillow 44.8/100: 45% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord, best_friends_with_urctos(10), best_friends_with_urctos_static
1:20.561 aoe O wrath Fluffy_Pillow 56.8/100: 57% astral_power primordial_arcanic_pulsar(40), starfall(2), starlord, dreamstate, best_friends_with_urctos(9), best_friends_with_urctos_static
1:21.314 aoe Q starfall Fluffy_Pillow 68.8/100: 69% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(40), solstice, starfall(2), starlord, dreamstate, best_friends_with_urctos(8), best_friends_with_urctos_static
1:22.490 aoe R starfire Fluffy_Pillow 31.8/100: 32% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), best_friends_with_urctos(7), best_friends_with_urctos_static
1:23.509 aoe Q starfall Fluffy_Pillow 55.0/100: 55% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), best_friends_with_urctos(6), best_friends_with_urctos_static
1:24.642 aoe R starfire Fluffy_Pillow 14.0/100: 14% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage
1:26.277 aoe R starfire Fluffy_Pillow 43.2/100: 43% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage
1:27.911 aoe L starfall Fluffy_Pillow 66.4/100: 66% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(50), starfall(2), starlord(3), best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage
1:29.002 aoe R starfire Fluffy_Pillow 21.4/100: 21% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(3), starlord(3), best_friends_with_urctos_static, corrupting_rage
1:30.639 default F natures_vigil 470 T31 2p 40.6/100: 41% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage
1:30.639 aoe R starfire Fluffy_Pillow 40.6/100: 41% astral_power natures_vigil, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage
1:32.276 aoe K cancel_buff Fluffy_Pillow 59.8/100: 60% astral_power natures_vigil, eclipse_lunar, primordial_arcanic_pulsar(55), starfall, starlord(3), best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage
1:32.276 aoe L starfall Fluffy_Pillow 59.8/100: 60% astral_power natures_vigil, eclipse_lunar, primordial_arcanic_pulsar(55), starfall, best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage
1:33.497 aoe Q starfall Fluffy_Pillow 48.8/100: 49% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord, best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage
1:34.567 aoe R starfire Fluffy_Pillow 19.8/100: 20% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage
1:36.107 aoe Q starfall Fluffy_Pillow 43.0/100: 43% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(2), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage
1:37.135 default E use_items Fluffy_Pillow 12.0/100: 12% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage
1:37.135 aoe R starfire Fluffy_Pillow 12.0/100: 12% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage, kindled_soul(100)
1:38.621 aoe R starfire Fluffy_Pillow 39.2/100: 39% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(95)
1:40.109 aoe R starfire Fluffy_Pillow 60.4/100: 60% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage, kindled_soul(90)
1:41.596 aoe L starfall Fluffy_Pillow 81.6/100: 82% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall, starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(80)
1:42.587 aoe R starfire Fluffy_Pillow 50.6/100: 51% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage, kindled_soul(75)
1:44.074 aoe L starfall Fluffy_Pillow 73.8/100: 74% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_pip(9), best_friends_with_pip_static, kindled_soul(70)
1:45.066 aoe O wrath Fluffy_Pillow 40.8/100: 41% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(2), starlord(3), dreamstate, best_friends_with_pip(8), best_friends_with_pip_static, kindled_soul(65)
1:45.822 aoe O wrath Fluffy_Pillow 54.8/100: 55% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), best_friends_with_pip(7), best_friends_with_pip_static, kindled_soul(60)
1:46.576 aoe R starfire Fluffy_Pillow 66.8/100: 67% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), best_friends_with_pip(7), best_friends_with_pip_static, kindled_soul(55)
1:48.212 aoe L starfall Fluffy_Pillow 94.0/100: 94% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), best_friends_with_pip(5), best_friends_with_pip_static, kindled_soul(45)
1:49.434 aoe L starfall Fluffy_Pillow 53.0/100: 53% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord, best_friends_with_pip(4), best_friends_with_pip_static, kindled_soul(40)
1:50.609 aoe R starfire Fluffy_Pillow 12.0/100: 12% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(2), best_friends_with_pip(3), best_friends_with_pip_static, kindled_soul(35)
1:52.305 aoe Q starfall Fluffy_Pillow 67.2/100: 67% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(2), best_friends_with_pip, best_friends_with_pip_static, kindled_soul(25)
1:53.436 aoe R starfire Fluffy_Pillow 26.2/100: 26% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), umbral_embrace, best_friends_with_pip_static, kindled_soul(20)
1:55.071 aoe R starfire Fluffy_Pillow 47.4/100: 47% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), best_friends_with_pip_static, kindled_soul(15)
1:56.707 aoe R starfire Fluffy_Pillow 70.6/100: 71% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_pip_static, kindled_soul(5)
1:58.343 aoe L starfall Fluffy_Pillow 91.8/100: 92% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, starlord(3), best_friends_with_pip_static
1:59.434 aoe R starfire Fluffy_Pillow 50.8/100: 51% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
2:01.070 aoe L starfall Fluffy_Pillow 74.0/100: 74% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage
2:02.160 aoe O wrath Fluffy_Pillow 29.0/100: 29% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(3), dreamstate, best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage
2:02.915 aoe O wrath Fluffy_Pillow 41.0/100: 41% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage
2:03.669 aoe Q starfall Fluffy_Pillow 53.0/100: 53% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), best_friends_with_pip(8), best_friends_with_pip_static, corrupting_rage
2:04.889 aoe R starfire Fluffy_Pillow 12.0/100: 12% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord, best_friends_with_pip(7), best_friends_with_pip_static, corrupting_rage
2:06.649 aoe R starfire Fluffy_Pillow 37.2/100: 37% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, best_friends_with_pip(5), best_friends_with_pip_static, corrupting_rage
2:08.411 aoe Q starfall Fluffy_Pillow 62.4/100: 62% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage
2:09.585 aoe R starfire Fluffy_Pillow 25.4/100: 25% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(2), best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage
2:11.278 aoe L starfall Fluffy_Pillow 48.6/100: 49% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(2), best_friends_with_pip, best_friends_with_pip_static, corrupting_rage
2:12.410 aoe P fury_of_elune Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
2:13.404 aoe R starfire Fluffy_Pillow 48.6/100: 49% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
2:14.890 aoe L starfall Fluffy_Pillow 84.8/100: 85% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
2:15.882 aoe R starfire Fluffy_Pillow 63.8/100: 64% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), umbral_embrace, best_friends_with_pip_static, corrupting_rage
2:17.368 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
2:17.368 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), starfall(2), best_friends_with_pip_static, corrupting_rage
2:18.481 aoe Q starfall Fluffy_Pillow 74.0/100: 74% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(3), starlord, best_friends_with_pip_static, corrupting_rage
2:19.550 aoe Q starfall Fluffy_Pillow 47.0/100: 47% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(2), best_friends_with_pip_static, corrupting_rage
2:20.579 aoe R starfire Fluffy_Pillow 20.0/100: 20% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), best_friends_with_pip_static, corrupting_rage
2:22.067 aoe R starfire Fluffy_Pillow 41.2/100: 41% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), best_friends_with_pip_static, corrupting_rage
2:23.553 aoe O wrath Fluffy_Pillow 55.2/100: 55% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage
2:24.308 aoe O wrath Fluffy_Pillow 67.2/100: 67% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage
2:25.062 aoe L starfall Fluffy_Pillow 77.2/100: 77% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage
2:26.154 aoe R starfire Fluffy_Pillow 38.2/100: 38% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage
2:27.789 aoe L starfall Fluffy_Pillow 63.4/100: 63% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall, starlord(3), best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage
2:28.881 aoe R starfire Fluffy_Pillow 22.4/100: 22% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), umbral_embrace, best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage
2:30.517 aoe K cancel_buff Fluffy_Pillow 79.6/100: 80% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage
2:30.517 aoe L starfall Fluffy_Pillow 79.6/100: 80% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage
2:31.739 aoe R starfire Fluffy_Pillow 36.6/100: 37% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord, best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage
2:33.500 aoe Q starfall Fluffy_Pillow 55.8/100: 56% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord, best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage
2:34.676 aoe R starfire Fluffy_Pillow 12.8/100: 13% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage
2:36.373 aoe R starfire Fluffy_Pillow 36.0/100: 36% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage
2:38.066 aoe Q starfall Fluffy_Pillow 55.2/100: 55% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), best_friends_with_urctos_static, corrupting_rage
2:39.199 aoe O wrath Fluffy_Pillow 10.2/100: 10% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_urctos_static, corrupting_rage
2:40.293 aoe O wrath Fluffy_Pillow 20.2/100: 20% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(3), dreamstate, best_friends_with_urctos_static, corrupting_rage
2:41.049 aoe R starfire Fluffy_Pillow 32.2/100: 32% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, corrupting_rage
2:42.030 aoe R starfire Fluffy_Pillow 53.4/100: 53% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), best_friends_with_urctos_static, corrupting_rage
2:43.665 aoe K cancel_buff Fluffy_Pillow 84.6/100: 85% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), best_friends_with_urctos_static, corrupting_rage
2:43.665 aoe L starfall Fluffy_Pillow 84.6/100: 85% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, best_friends_with_urctos_static, corrupting_rage
2:44.888 aoe R starfire Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, best_friends_with_urctos_static, corrupting_rage
2:46.649 aoe Q starfall Fluffy_Pillow 70.8/100: 71% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord, best_friends_with_urctos_static, corrupting_rage
2:47.826 aoe R starfire Fluffy_Pillow 31.8/100: 32% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(2), best_friends_with_urctos_static, corrupting_rage
2:49.520 aoe Q starfall Fluffy_Pillow 55.0/100: 55% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(2), best_friends_with_urctos_static, corrupting_rage
2:50.651 aoe R starfire Fluffy_Pillow 48.0/100: 48% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), best_friends_with_urctos_static, corrupting_rage
2:52.140 aoe R starfire Fluffy_Pillow 75.2/100: 75% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:53.516 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:54.435 aoe R starfire Fluffy_Pillow 69.0/100: 69% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:55.812 aoe L starfall Fluffy_Pillow 92.2/100: 92% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:56.731 aoe R starfire Fluffy_Pillow 59.2/100: 59% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:58.108 aoe K cancel_buff Fluffy_Pillow 82.4/100: 82% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:58.108 aoe L starfall Fluffy_Pillow 82.4/100: 82% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:59.135 aoe Q starfall Fluffy_Pillow 49.4/100: 49% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:00.124 aoe R starfire Fluffy_Pillow 16.4/100: 16% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:01.552 default F natures_vigil 470 T31 2p 34.4/100: 34% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(2), dreamstate(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:01.552 aoe O wrath Fluffy_Pillow 34.4/100: 34% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(3), starlord(2), dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:02.308 aoe O wrath Fluffy_Pillow 44.4/100: 44% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(3), starlord(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:03.062 aoe Q starfall Fluffy_Pillow 56.4/100: 56% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:04.109 aoe R starfire Fluffy_Pillow 17.4/100: 17% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), umbral_embrace, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:05.621 aoe R starfire Fluffy_Pillow 44.6/100: 45% astral_power natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:07.134 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, corrupting_rage
3:08.225 aoe N incarnation_chosen_of_elune Fluffy_Pillow 59.0/100: 59% astral_power natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), umbral_embrace, best_friends_with_urctos_static, corrupting_rage
3:08.225 default E use_items Fluffy_Pillow 59.0/100: 59% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), umbral_embrace, dreamstate(2), best_friends_with_urctos_static, corrupting_rage
3:08.225 aoe R starfire Fluffy_Pillow 59.0/100: 59% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), umbral_embrace, dreamstate, best_friends_with_urctos_static, corrupting_rage, kindled_soul(100)
3:09.119 aoe R starfire Fluffy_Pillow 82.2/100: 82% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(100)
3:10.014 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(95)
3:11.005 aoe R starfire Fluffy_Pillow 71.0/100: 71% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(90)
3:12.491 aoe K cancel_buff Fluffy_Pillow 96.2/100: 96% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, kindled_soul(80)
3:12.491 aoe L starfall Fluffy_Pillow 96.2/100: 96% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(2), best_friends_with_urctos_static, kindled_soul(80)
3:13.603 aoe P fury_of_elune Fluffy_Pillow 65.2/100: 65% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starfall(3), starlord, best_friends_with_urctos_static, kindled_soul(75)
3:14.673 aoe Q starfall Fluffy_Pillow 73.2/100: 73% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(40), starfall(3), starlord, best_friends_with_urctos_static, kindled_soul(70)
3:15.742 aoe Q starfall Fluffy_Pillow 48.2/100: 48% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), starfall(3), starlord(2), best_friends_with_urctos_static, kindled_soul(65)
3:16.771 aoe R starfire Fluffy_Pillow 21.2/100: 21% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(4), starlord(3), best_friends_with_urctos_static, kindled_soul(60)
3:18.256 aoe R starfire Fluffy_Pillow 55.4/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(3), starlord(3), best_friends_with_urctos_static, kindled_soul(50)
3:19.744 aoe L starfall Fluffy_Pillow 87.6/100: 88% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(3), starlord(3), best_friends_with_urctos_static, kindled_soul(45)
3:20.735 aoe R starfire Fluffy_Pillow 60.6/100: 61% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(3), starlord(3), best_friends_with_urctos_static, kindled_soul(40)
3:22.223 aoe L starfall Fluffy_Pillow 85.8/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(3), starlord(3), best_friends_with_urctos_static, kindled_soul(35)
3:23.215 aoe L starfall Fluffy_Pillow 88.8/100: 89% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), best_friends_with_urctos(11), best_friends_with_urctos_static, kindled_soul(30)
3:24.207 aoe R starfire Fluffy_Pillow 57.8/100: 58% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), umbral_embrace, best_friends_with_urctos(10), best_friends_with_urctos_static, kindled_soul(25)
3:25.694 aoe K cancel_buff Fluffy_Pillow 83.0/100: 83% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_urctos(8), best_friends_with_urctos_static, kindled_soul(15)
3:25.694 aoe Q starfall Fluffy_Pillow 83.0/100: 83% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), best_friends_with_urctos(8), best_friends_with_urctos_static, kindled_soul(15)
3:26.803 aoe Q starfall Fluffy_Pillow 52.0/100: 52% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord, best_friends_with_urctos(7), best_friends_with_urctos_static, kindled_soul(10)
3:27.873 aoe R starfire Fluffy_Pillow 25.0/100: 25% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), solstice, starfall(4), starlord(2), best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage, kindled_soul(5)
3:29.414 aoe Q starfall Fluffy_Pillow 48.2/100: 48% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(2), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage
3:30.444 aoe R starfire Fluffy_Pillow 15.2/100: 15% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage
3:31.930 aoe R starfire Fluffy_Pillow 36.4/100: 36% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage
3:33.415 aoe R starfire Fluffy_Pillow 59.6/100: 60% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), best_friends_with_urctos_static, corrupting_rage
3:34.903 aoe R starfire Fluffy_Pillow 80.8/100: 81% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall, starlord(3), best_friends_with_urctos_static, corrupting_rage
3:36.389 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall, starlord(3), best_friends_with_urctos_static, corrupting_rage
3:37.383 aoe R starfire Fluffy_Pillow 69.0/100: 69% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(2), starlord(3), best_friends_with_urctos_static, corrupting_rage
3:38.869 aoe K cancel_buff Fluffy_Pillow 90.2/100: 90% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall, starlord(3), best_friends_with_urctos_static, corrupting_rage
3:38.869 aoe L starfall Fluffy_Pillow 90.2/100: 90% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall, best_friends_with_urctos_static, corrupting_rage
3:39.981 aoe Q starfall Fluffy_Pillow 57.2/100: 57% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord, best_friends_with_urctos_static, corrupting_rage
3:41.049 aoe R starfire Fluffy_Pillow 24.2/100: 24% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(2), best_friends_with_urctos_static, corrupting_rage
3:42.592 aoe L starfall Fluffy_Pillow 47.4/100: 47% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(2), best_friends_with_urctos_static, corrupting_rage
3:43.621 aoe R starfire Fluffy_Pillow 12.4/100: 12% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord(3), best_friends_with_urctos_static, corrupting_rage
3:45.108 aoe R starfire Fluffy_Pillow 33.6/100: 34% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), best_friends_with_urctos_static, corrupting_rage
3:46.594 aoe L starfall Fluffy_Pillow 86.8/100: 87% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), best_friends_with_urctos_static, corrupting_rage
3:47.588 aoe R starfire Fluffy_Pillow 51.8/100: 52% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), best_friends_with_urctos_static, corrupting_rage
3:49.075 aoe L starfall Fluffy_Pillow 75.0/100: 75% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_urctos_static, corrupting_rage
3:50.068 aoe O wrath Fluffy_Pillow 42.0/100: 42% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(3), starlord(3), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage
3:51.059 aoe O wrath Fluffy_Pillow 56.0/100: 56% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord(3), dreamstate, best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage
3:51.813 aoe R starfire Fluffy_Pillow 68.0/100: 68% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage
3:52.794 aoe K cancel_buff Fluffy_Pillow 93.2/100: 93% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage
3:52.794 aoe L starfall Fluffy_Pillow 93.2/100: 93% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage
3:54.015 aoe Q starfall Fluffy_Pillow 52.2/100: 52% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord, best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage
3:55.188 aoe R starfire Fluffy_Pillow 11.2/100: 11% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(2), umbral_embrace, best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage
3:56.728 aoe Q starfall Fluffy_Pillow 40.4/100: 40% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(2), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage
3:57.756 aoe R starfire Fluffy_Pillow 9.4/100: 9% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage
3:59.242 aoe R starfire Fluffy_Pillow 40.6/100: 41% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage
4:00.729 aoe L starfall Fluffy_Pillow 63.8/100: 64% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(3), starlord(3), best_friends_with_urctos_static, corrupting_rage
4:01.722 aoe R starfire Fluffy_Pillow 62.8/100: 63% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), best_friends_with_urctos_static, corrupting_rage
4:03.209 aoe L starfall Fluffy_Pillow 86.0/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), best_friends_with_urctos_static, corrupting_rage
4:04.203 aoe R starfire Fluffy_Pillow 53.0/100: 53% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_urctos_static, corrupting_rage
4:05.689 aoe L starfall Fluffy_Pillow 72.2/100: 72% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_urctos_static, corrupting_rage
4:06.682 aoe O wrath Fluffy_Pillow 37.2/100: 37% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(3), dreamstate, best_friends_with_urctos_static, corrupting_rage
4:07.437 aoe O wrath Fluffy_Pillow 47.2/100: 47% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(3), best_friends_with_urctos_static, corrupting_rage
4:08.192 aoe Q starfall Fluffy_Pillow 57.2/100: 57% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), best_friends_with_urctos_static, corrupting_rage
4:09.414 aoe R starfire Fluffy_Pillow 18.2/100: 18% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord, best_friends_with_urctos_static, corrupting_rage
4:11.174 aoe Q starfall Fluffy_Pillow 47.4/100: 47% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord, best_friends_with_urctos_static, corrupting_rage
4:12.350 aoe R starfire Fluffy_Pillow 10.4/100: 10% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(2), best_friends_with_urctos_static, corrupting_rage
4:14.047 aoe R starfire Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(2), best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage
4:15.744 aoe Q starfall Fluffy_Pillow 62.8/100: 63% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(2), best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage
4:16.876 aoe R starfire Fluffy_Pillow 19.8/100: 20% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_pip(8), best_friends_with_pip_static, corrupting_rage
4:18.512 aoe R starfire Fluffy_Pillow 41.0/100: 41% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage
4:20.147 aoe R starfire Fluffy_Pillow 64.2/100: 64% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, starlord(3), best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage
4:21.783 aoe K cancel_buff Fluffy_Pillow 87.4/100: 87% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, starlord(3), best_friends_with_pip(3), best_friends_with_pip_static, corrupting_rage
4:21.783 aoe L starfall Fluffy_Pillow 87.4/100: 87% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, best_friends_with_pip(3), best_friends_with_pip_static, corrupting_rage
4:23.004 aoe L starfall Fluffy_Pillow 74.4/100: 74% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord, best_friends_with_pip(2), best_friends_with_pip_static
4:24.178 aoe O wrath Fluffy_Pillow 31.4/100: 31% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(2), dreamstate, best_friends_with_pip_static
4:24.931 aoe O wrath Fluffy_Pillow 41.4/100: 41% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(2), best_friends_with_pip_static
4:25.687 aoe Q starfall Fluffy_Pillow 53.4/100: 53% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), umbral_embrace, best_friends_with_pip_static
4:26.819 aoe R starfire Fluffy_Pillow 14.4/100: 14% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), umbral_embrace, best_friends_with_pip_static
4:28.454 aoe R starfire Fluffy_Pillow 39.6/100: 40% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static
4:30.087 aoe R starfire Fluffy_Pillow 64.8/100: 65% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static
4:31.722 default F natures_vigil 470 T31 2p 94.0/100: 94% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(50), starfall, starlord(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, wafting_devotion
4:31.722 aoe L starfall Fluffy_Pillow 94.0/100: 94% astral_power natures_vigil, balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(50), starfall, starlord(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, wafting_devotion
4:32.733 aoe R starfire Fluffy_Pillow 53.0/100: 53% astral_power natures_vigil, balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, wafting_devotion
4:34.246 aoe L starfall Fluffy_Pillow 72.2/100: 72% astral_power natures_vigil, eclipse_lunar, primordial_arcanic_pulsar(55), starfall, starlord(3), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, wafting_devotion
4:35.257 aoe P fury_of_elune Fluffy_Pillow 33.2/100: 33% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, wafting_devotion
4:36.176 aoe R starfire Fluffy_Pillow 40.2/100: 40% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, wafting_devotion
4:37.553 aoe L starfall Fluffy_Pillow 74.4/100: 74% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
4:38.581 default E use_items Fluffy_Pillow 49.4/100: 49% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord, best_friends_with_aerwynn, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
4:38.581 aoe L starfall Fluffy_Pillow 49.4/100: 49% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord, best_friends_with_aerwynn, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(100)
4:39.570 aoe Q starfall Fluffy_Pillow 56.4/100: 56% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(100)
4:40.522 aoe R starfire Fluffy_Pillow 29.4/100: 29% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(4), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(95)
4:41.898 aoe R starfire Fluffy_Pillow 61.6/100: 62% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(4), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(85)
4:43.274 aoe L starfall Fluffy_Pillow 93.8/100: 94% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(80)
4:44.193 aoe R starfire Fluffy_Pillow 58.8/100: 59% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(75)
4:45.570 aoe L starfall Fluffy_Pillow 82.0/100: 82% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(70)
4:46.562 aoe O wrath Fluffy_Pillow 49.0/100: 49% astral_power natures_vigil, primordial_arcanic_pulsar(25), starfall(4), starlord(3), dreamstate, best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(65)
4:47.316 aoe O wrath Fluffy_Pillow 59.0/100: 59% astral_power primordial_arcanic_pulsar(25), starfall(3), starlord(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(60)
4:48.070 aoe R starfire Fluffy_Pillow 71.0/100: 71% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(55)
4:49.705 aoe L starfall Fluffy_Pillow 94.2/100: 94% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(45)
4:50.797 aoe R starfire Fluffy_Pillow 53.2/100: 53% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(40)
4:52.433 aoe K cancel_buff Fluffy_Pillow 82.4/100: 82% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(35)
4:52.433 aoe L starfall Fluffy_Pillow 82.4/100: 82% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(35)
4:53.655 aoe R starfire Fluffy_Pillow 41.4/100: 41% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(2), starlord, best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(25)
4:55.415 aoe Q starfall Fluffy_Pillow 64.6/100: 65% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord, best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(20)
4:56.590 aoe R starfire Fluffy_Pillow 23.6/100: 24% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(10)
4:58.286 aoe R starfire Fluffy_Pillow 44.8/100: 45% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(5)
4:59.981 aoe L starfall Fluffy_Pillow 68.0/100: 68% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), best_friends_with_aerwynn_static, corrupting_rage
5:01.111 aoe R starfire Fluffy_Pillow 25.0/100: 25% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
5:02.746 aoe L starfall Fluffy_Pillow 76.2/100: 76% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
5:03.838 aoe O wrath Fluffy_Pillow 33.2/100: 33% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord(3), dreamstate, best_friends_with_aerwynn_static, corrupting_rage
5:04.590 aoe O wrath Fluffy_Pillow 43.2/100: 43% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
5:05.343 aoe R starfire Fluffy_Pillow 53.2/100: 53% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage

Stats

Level Bonus (70) Race Bonus (tauren) Raid-Buffed Unbuffed Gear Amount
Strength 898 2 986 900 0
Agility 2089 -2 2173 2087 0
Stamina 3848 2 36810 35057 31140
Intellect 2089 -2 13750 12926 10224 (6349)
Spirit 0 0 0 0 0
Health 736200 736200 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13750 12926 0
Crit 27.17% 20.96% 2873
Haste 23.17% 23.17% 3938
Versatility 6.22% 1.22% 251
Mana Regen 2560 2560 0
Attack Power 14300 13443 0
Mastery 29.20% 29.20% 7576
Armor 4652 4652 4652
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 470.00
Local Head Benevolent Embersage's Casque
ilevel: 470, stats: { 585 Armor, +3163 Sta, +655 Crit, +307 Haste, +786 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }, enchant: incandescent_essence
Local Neck Eye of the Rising Flame
ilevel: 470, stats: { +1779 Sta, +233 Haste, +1397 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Life-Bound Shoulderpads
ilevel: 470, stats: { 536 Armor, +2372 Sta, +360 Mastery, +360 Haste, +590 AgiInt }
item effects: { equip: Toxified }
Local Chest Benevolent Embersage's Robe
ilevel: 470, stats: { 780 Armor, +3163 Sta, +665 Crit, +296 Mastery, +786 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 470, stats: { 439 Armor, +2372 Sta, +497 Haste, +224 Mastery, +590 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 470, stats: { 683 Armor, +3163 Sta, +656 Haste, +305 Mastery, +786 AgiInt }, enchant: { +155 StrAgiInt, +41 Vers (lambent_armor_kit_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 470, stats: { 488 Armor, +2372 Sta, +257 Crit, +412 Haste, +590 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Thermal Bindings
ilevel: 470, stats: { 390 Armor, +1779 Sta, +178 Crit, +363 Mastery, +442 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Benevolent Embersage's Talons
ilevel: 470, stats: { 439 Armor, +2372 Sta, +210 Vers, +511 Mastery, +590 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 470, stats: { +1779 Sta, +466 Haste, +1165 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 470, stats: { +1779 Sta, +1118 Crit, +512 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 470, stats: { +747 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 470, stats: { +687 Mastery }
item effects: { use: Balefire Branch }
Local Back Drape of the Loyal Vassal
ilevel: 470, stats: { 312 Armor, +1779 Sta, +305 Haste, +236 Mastery, +442 StrAgiInt }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 470, weapon: { 508 - 654, 2.6 }, stats: { +393 Int, +1896 Int, +1581 Sta, +145 Haste, +335 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 470, stats: { +1206 Int, +1581 Sta, +162 Haste, +319 Mastery }

Profile

druid="470 T31 2p"
source=default
spec=balance
level=70
race=tauren
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:hissing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Balance APL can be found at https://balance-simc.github.io/Balance-SimC/balance.txt

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=470,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=470,gem_id=192961/192961/192961
shoulders=lifebound_shoulderpads,id=193406,bonus_id=8836/1576/8797/8960,ilevel=470,crafted_stats=49/36
back=drape_of_the_loyal_vassal,id=158375,bonus_id=4795,ilevel=470
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=470,enchant_id=6625
wrists=thermal_bindings,id=134461,bonus_id=4795,ilevel=470,gem_id=192961
hands=benevolent_embersages_talons,id=207255,bonus_id=4795,ilevel=470
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=470,enchant_id=6830
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=470
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=470
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=470
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=470,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=470

# Gear Summary
# gear_ilvl=470.00
# gear_stamina=31140
# gear_intellect=10224
# gear_crit_rating=2873
# gear_haste_rating=3938
# gear_mastery_rating=7576
# gear_versatility_rating=251
# gear_armor=4652
# set_bonus=tier31_2pc=1

470 T31 4p : 771809 dps, 140845 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
771809.1 771809.1 760.8 / 0.099% 73788.5 / 9.6% 56722.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.6 13.8 Astral Power 0.00% 55.7 100.1% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
470 T31 4p 771809
Astral Smolder 115323 14.9% 372.7 0.86s 92820 0 Periodic 734.6 47092 0 47092 0.0% 81.5%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 372.66 0.00 734.59 734.59 284.67 0.0000 2.0000 34590031.52 34590031.52 0.00% 23543.78 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 734.59 545 914 47091.58 4009 219353 47150.66 41249 54811 34590032 34590032 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Fury of Elune 22879 3.0% 5.1 64.82s 1339151 1367671 Direct 755.1 5746 12297 9088 51.0%

Stats Details: Fury Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.12 755.13 0.00 0.00 0.00 0.9792 0.0000 6861607.73 6861607.73 0.00% 1367671.46 1367671.46
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.99% 369.94 205 509 5746.43 2786 18103 5757.02 5097 6605 2125152 2125152 0.00%
crit 51.01% 385.19 262 539 12297.25 5683 36930 12302.14 11022 13970 4736456 4736456 0.00%

Action Details: Fury Of Elune

  • id:202770
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:astral_power
  • energize_amount:3.0

Spelldata

  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r

Action Details: Fury Of Elune Tick

  • id:211545
  • school:astral
  • range:105.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.149000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:211545
  • name:Fury of Elune
  • school:astral
  • tooltip:
  • description:{$@spelldesc202770=Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r}

Action Priority List

    aoe
    [P]:5.12
  • if_expr:target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Hungering Shadowflame 2907 0.4% 16.8 16.96s 51968 0 Direct 16.8 40449 82238 51925 27.4%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.80 16.80 0.00 0.00 0.00 0.0000 0.0000 872976.19 872976.19 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.59% 12.19 4 25 40449.03 26983 154715 40424.91 26983 89161 493866 493866 0.00%
crit 27.41% 4.60 0 13 82237.89 55045 315618 81858.28 0 292053 379110 379110 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24191.79
  • base_dd_max:24191.79
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 5589 0.7% 33.8 8.59s 49565 0 Direct 33.8 38637 78764 49691 27.5%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.85 33.76 0.00 0.00 0.00 0.0000 0.0000 1677542.27 1677542.27 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.45% 24.46 11 43 38636.62 38195 43801 38637.62 38195 40701 945043 945043 0.00%
crit 27.55% 9.30 1 21 78763.93 77919 89355 78768.56 77919 83909 732499 732499 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:34245.43
  • base_dd_max:34245.43
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 64572 8.4% 3.0 1.09s 6462062 6933543 Direct 6.0 6032 12297 9038 47.9%
Periodic 1802.0 7485 15473 10729 40.6% 99.2%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.00 6.00 1801.97 1801.97 0.00 0.9321 0.9921 19386185.75 19386185.75 0.00% 10826.75 6933542.83
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.06% 3.12 0 6 6031.72 5948 6940 5966.11 0 6940 18842 18842 0.00%
crit 47.94% 2.88 0 6 12297.06 12134 14157 12095.85 0 14157 35366 35366 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 59.40% 1070.29 799 1353 7485.26 5716 11811 7485.11 7274 7679 8011157 8011157 0.00%
crit 40.60% 731.68 539 931 15473.32 11660 24095 15474.56 15051 15893 11320820 11320820 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    aoe
    [J]:3.00
  • if_expr:!fight_style.dungeonroute
  • target_if_expr:refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (66858) 0.0% (8.7%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 16575 2.1% 232.8 1.48s 21372 0 Direct 232.2 13551 29192 21427 50.4%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 232.78 232.16 0.00 0.00 0.00 0.0000 0.0000 4974785.83 4974785.83 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.63% 115.22 73 160 13550.56 9388 24925 13557.32 12757 14770 1561225 1561225 0.00%
crit 50.37% 116.95 77 162 29191.74 19151 50809 29209.09 27336 31064 3413561 3413561 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 16620 2.2% 234.2 1.49s 21296 0 Direct 233.6 13511 29102 21354 50.3%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 234.23 233.63 0.00 0.00 0.00 0.0000 0.0000 4988207.68 4988207.68 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.71% 116.15 74 163 13511.01 8500 24925 13516.68 12624 14406 1569332 1569332 0.00%
crit 50.29% 117.49 77 167 29102.33 17339 50033 29119.73 27243 31294 3418875 3418875 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 33664 4.4% 15.6 19.51s 648934 0 Direct 93.1 68816 148675 108469 49.6%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.57 93.14 0.00 0.00 0.00 0.0000 0.0000 10101382.13 10101382.13 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 50.35% 46.90 26 74 68816.16 35038 251678 68828.61 52998 85875 3226588 3226588 0.00%
crit 49.65% 46.24 25 80 148675.36 71477 506041 148762.16 112635 186380 6874794 6874794 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfall 256382 33.2% 103.5 2.88s 742573 724326 Direct 1772.2 28700 62109 43394 44.0%

Stats Details: Starfall

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 103.55 1772.19 0.00 0.00 0.00 1.0252 0.0000 76892967.85 76892967.85 0.00% 724325.70 724325.70
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.02% 992.79 710 1249 28699.72 6463 105192 28760.65 26319 31731 28489429 28489429 0.00%
crit 43.98% 779.40 589 989 62108.97 13185 214591 62210.68 56752 70401 48403539 48403539 0.00%

Action Details: Starfall

  • id:191034
  • school:astral
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:45.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]

Action Details: Starfall Damage

  • id:191037
  • school:astral
  • range:200.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.114000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.41

Spelldata

  • id:191037
  • name:Starfall
  • school:astral
  • tooltip:
  • description:{$@spelldesc191034=Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]}

Action Priority List

    aoe
    [L]:69.27
  • if_expr:variable.starfall_condition1
    aoe
    [Q]:34.28
  • if_expr:variable.starfall_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountLunar Shrapnel4151691PCT0.200
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 174322 22.6% 116.8 2.54s 447947 316941 Direct 706.6 46418 100239 74034 51.3%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 116.76 706.58 0.00 0.00 0.00 1.4134 0.0000 52303577.06 52303577.06 0.00% 316941.43 316941.43
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.70% 344.07 249 462 46417.99 6408 203858 46427.12 41909 51494 15968826 15968826 0.00%
crit 51.30% 362.51 272 461 100239.16 13072 415346 100278.63 89857 112297 36334751 36334751 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    aoe
    [M]:1.38
  • if_expr:buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
    aoe
    [R]:115.95
  • if_expr:spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Solar)4851710.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Sunfire16481550.283Mastery
Sunfire 54030 7.0% 1.0 0.00s 16209559 17244212 Direct 1.0 4729 9653 5992 25.6%
Periodic 1814.8 6292 13466 8929 36.8% 99.9%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 1814.80 1814.80 0.00 0.9405 0.9918 16209559.47 16209559.47 0.00% 9001.18 17244212.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 74.39% 0.74 0 1 4729.50 4702 4760 3518.37 0 4760 3518 3518 0.00%
crit 25.61% 0.26 0 1 9652.67 9592 9709 2471.77 0 9709 2472 2472 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 63.24% 1147.71 848 1424 6292.04 4724 10738 6294.99 6083 6560 7221087 7221087 0.00%
crit 36.76% 667.09 504 845 13465.77 9636 21905 13472.29 13046 13971 8982483 8982483 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    aoe
    [I]:1.00
  • target_if_expr:refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (5398) 0.0% (0.7%) 8.4 30.78s 191777 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.45 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 2821 0.4% 8.4 30.78s 100221 0 Direct 50.7 13011 26518 16705 27.3%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.45 50.68 0.00 0.00 0.00 0.0000 0.0000 846551.38 846551.38 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.66% 36.83 7 86 13011.37 12857 14744 13010.42 12857 13794 479141 479141 0.00%
crit 27.34% 13.86 1 34 26517.54 26228 30078 26521.43 26228 28875 367411 367411 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:39522.22
  • base_dd_max:39522.22
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 2577 0.3% 16.2 15.07s 47677 0 Direct 97.3 6191 12619 7947 27.3%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.22 97.33 0.00 0.00 0.00 0.0000 0.0000 773361.77 773361.77 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.69% 70.75 15 159 6190.55 6118 7016 6190.22 6118 6553 437957 437957 0.00%
crit 27.31% 26.58 2 65 12618.92 12480 14312 12620.21 12480 13931 335405 335405 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18805.57
  • base_dd_max:18805.57
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 3552 0.5% 26.1 10.42s 41089 53153 Direct 26.0 29334 59832 41298 39.3%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.09 25.96 0.00 0.00 0.00 0.7730 0.0000 1072207.48 1072207.48 0.00% 53153.26 53153.26
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 60.74% 15.77 5 28 29333.92 13038 52836 29279.29 19989 37514 462525 462525 0.00%
crit 39.26% 10.19 1 21 59832.17 26597 113056 59726.40 32252 81376 609682 609682 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    aoe
    [O]:24.16
  • if_expr:!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.800Spell Data
Eclipse (Solar)4851710.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Lunar)4851810.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
470 T31 4p
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31 4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31 4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31 4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 180.97s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    aoe
    [N]:2.00
  • if_expr:variable.cd_condition_aoe

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.2 41.00s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.17 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31 4p
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:57075.72
  • base_dd_max:57075.72
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.42s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.75 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31 4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.75
Elemental Potion of Ultimate Power 1.5 306.00s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.45 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.45
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 17.6 5.5 17.6s 13.6s 9.5s 55.68% 57.48% 5.5 (17.8) 17.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.5s
  • trigger_min/max:0.0s / 37.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.8s
  • uptime_min/max:51.39% / 59.20%

Stack Uptimes

  • balance_of_all_things_arcane_1:5.79%
  • balance_of_all_things_arcane_2:6.18%
  • balance_of_all_things_arcane_3:6.64%
  • balance_of_all_things_arcane_4:7.04%
  • balance_of_all_things_arcane_5:7.29%
  • balance_of_all_things_arcane_6:7.49%
  • balance_of_all_things_arcane_7:7.60%
  • balance_of_all_things_arcane_8:7.66%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 10.2 0.0 30.1s 30.1s 7.9s 26.84% 29.85% 0.0 (0.0) 9.9

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.4s / 47.3s
  • trigger_min/max:4.7s / 47.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.8s
  • uptime_min/max:24.52% / 29.90%

Stack Uptimes

  • balance_of_all_things_nature_1:3.32%
  • balance_of_all_things_nature_2:3.33%
  • balance_of_all_things_nature_3:3.34%
  • balance_of_all_things_nature_4:3.35%
  • balance_of_all_things_nature_5:3.36%
  • balance_of_all_things_nature_6:3.37%
  • balance_of_all_things_nature_7:3.38%
  • balance_of_all_things_nature_8:3.39%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 14.9 85.4 20.7s 3.0s 17.8s 88.26% 0.00% 35.6 (35.6) 0.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.1s / 58.3s
  • trigger_min/max:0.8s / 13.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:82.71% / 92.48%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:13.10%
  • balance_t31_4pc_buff_lunar_2:13.69%
  • balance_t31_4pc_buff_lunar_3:14.21%
  • balance_t31_4pc_buff_lunar_4:11.60%
  • balance_t31_4pc_buff_lunar_5:35.67%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 8.2 55.8 38.4s 4.5s 18.8s 51.41% 0.00% 25.7 (25.7) 0.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.2s / 81.5s
  • trigger_min/max:0.8s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:45.66% / 58.39%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:7.63%
  • balance_t31_4pc_buff_solar_2:6.40%
  • balance_t31_4pc_buff_solar_3:6.30%
  • balance_t31_4pc_buff_solar_4:6.55%
  • balance_t31_4pc_buff_solar_5:24.52%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 70.2s 70.2s 10.8s 10.12% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 306.8s
  • trigger_min/max:12.0s / 306.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 11.0s
  • uptime_min/max:0.00% / 29.92%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.90%
  • best_friends_with_aerwynn_2:0.91%
  • best_friends_with_aerwynn_3:0.91%
  • best_friends_with_aerwynn_4:0.91%
  • best_friends_with_aerwynn_5:0.92%
  • best_friends_with_aerwynn_6:0.92%
  • best_friends_with_aerwynn_7:0.92%
  • best_friends_with_aerwynn_8:0.93%
  • best_friends_with_aerwynn_9:0.93%
  • best_friends_with_aerwynn_10:0.93%
  • best_friends_with_aerwynn_11:0.94%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 113.9s 70.2s 45.5s 33.64% 0.00% 70.2 (70.2) 0.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:14.0s / 339.5s
  • trigger_min/max:12.0s / 306.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 287.7s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.64%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.9 0.0 69.2s 69.2s 10.8s 10.26% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 336.0s
  • trigger_min/max:12.0s / 336.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 36.02%

Stack Uptimes

  • best_friends_with_pip_1:0.92%
  • best_friends_with_pip_2:0.92%
  • best_friends_with_pip_3:0.92%
  • best_friends_with_pip_4:0.93%
  • best_friends_with_pip_5:0.93%
  • best_friends_with_pip_6:0.93%
  • best_friends_with_pip_7:0.94%
  • best_friends_with_pip_8:0.94%
  • best_friends_with_pip_9:0.94%
  • best_friends_with_pip_10:0.94%
  • best_friends_with_pip_11:0.95%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 1.0 111.9s 69.2s 45.4s 33.45% 0.00% 69.6 (69.6) 0.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:13.7s / 336.0s
  • trigger_min/max:12.0s / 336.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 265.8s
  • uptime_min/max:0.00% / 91.91%

Stack Uptimes

  • best_friends_with_pip_static_1:33.45%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 70.3s 70.3s 10.8s 10.11% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 327.4s
  • trigger_min/max:12.0s / 327.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 11.0s
  • uptime_min/max:0.00% / 32.44%

Stack Uptimes

  • best_friends_with_urctos_1:0.90%
  • best_friends_with_urctos_2:0.91%
  • best_friends_with_urctos_3:0.91%
  • best_friends_with_urctos_4:0.91%
  • best_friends_with_urctos_5:0.92%
  • best_friends_with_urctos_6:0.92%
  • best_friends_with_urctos_7:0.92%
  • best_friends_with_urctos_8:0.92%
  • best_friends_with_urctos_9:0.93%
  • best_friends_with_urctos_10:0.93%
  • best_friends_with_urctos_11:0.94%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 1.0 114.9s 70.3s 44.7s 32.91% 0.00% 68.7 (68.7) 0.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:13.9s / 338.0s
  • trigger_min/max:12.0s / 327.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 266.4s
  • uptime_min/max:0.00% / 92.07%

Stack Uptimes

  • best_friends_with_urctos_static_1:32.91%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.66%

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 62.4s 58.5s 50.1s 80.16% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 329.0s
  • trigger_min/max:15.0s / 297.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 356.6s
  • uptime_min/max:53.49% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.16%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dreamstate 15.1 0.2 20.7s 21.5s 2.2s 10.85% 20.48% 0.2 (0.4) 0.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 54.0s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.4s
  • uptime_min/max:7.56% / 15.05%

Stack Uptimes

  • dreamstate_1:7.29%
  • dreamstate_2:3.56%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 13.2 8.0 23.9s 15.0s 21.2s 92.99% 93.66% 8.0 (8.0) 12.2

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.7s / 69.4s
  • trigger_min/max:0.0s / 56.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.2s
  • uptime_min/max:89.91% / 95.69%

Stack Uptimes

  • eclipse_lunar_1:92.99%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 8.2 0.0 38.5s 38.5s 19.1s 52.17% 54.10% 0.0 (0.0) 7.8

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 82.0s
  • trigger_min/max:12.0s / 82.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.80% / 59.29%

Stack Uptimes

  • eclipse_solar_1:52.17%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 305.8s 305.8s 27.2s 12.92% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 325.4s
  • trigger_min/max:300.0s / 325.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.76% / 17.82%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.92%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Fury of Elune 5.1 0.0 64.7s 64.7s 7.9s 13.49% 0.00% 75.9 (75.9) 5.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:60.0s / 88.1s
  • trigger_min/max:60.0s / 88.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:11.14% / 15.41%

Stack Uptimes

  • fury_of_elune_1:13.49%

Spelldata

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 8.2 0.0 38.5s 38.5s 19.1s 52.17% 54.81% 0.0 (0.0) 7.8

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 82.0s
  • trigger_min/max:12.0s / 82.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.80% / 59.29%

Stack Uptimes

  • incarnation_chosen_of_elune_1:52.17%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.7 0.0 91.0s 91.0s 19.5s 24.01% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:55.09

Trigger Details

  • interval_min/max:90.0s / 116.9s
  • trigger_min/max:90.0s / 116.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:21.28% / 26.91%

Stack Uptimes

  • kindled_soul_5:1.17%
  • kindled_soul_10:1.18%
  • kindled_soul_15:1.18%
  • kindled_soul_20:1.18%
  • kindled_soul_25:1.19%
  • kindled_soul_30:1.19%
  • kindled_soul_35:1.19%
  • kindled_soul_40:1.19%
  • kindled_soul_45:1.20%
  • kindled_soul_50:1.20%
  • kindled_soul_55:1.20%
  • kindled_soul_60:1.21%
  • kindled_soul_65:1.21%
  • kindled_soul_70:1.21%
  • kindled_soul_75:1.21%
  • kindled_soul_80:1.22%
  • kindled_soul_85:1.22%
  • kindled_soul_90:1.22%
  • kindled_soul_95:1.23%
  • kindled_soul_100:1.23%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Vigil 3.7 0.0 90.4s 90.4s 14.8s 18.42% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.6s
  • trigger_min/max:90.0s / 91.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s
  • uptime_min/max:16.54% / 21.04%

Stack Uptimes

  • natures_vigil_1:18.42%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.6 0.0 69.9s 69.1s 0.9s 0.77% 1.19% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.3s / 303.3s
  • trigger_min/max:0.1s / 303.3s
  • trigger_pct:15.53%
  • duration_min/max:0.0s / 6.5s
  • uptime_min/max:0.00% / 5.00%

Stack Uptimes

  • owlkin_frenzy_1:0.77%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 9.1 95.4 34.4s 34.4s 30.3s 91.21% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:21.9s / 47.3s
  • trigger_min/max:21.9s / 47.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.7s
  • uptime_min/max:87.90% / 94.51%

Stack Uptimes

  • primordial_arcanic_pulsar_5:7.17%
  • primordial_arcanic_pulsar_10:6.70%
  • primordial_arcanic_pulsar_15:7.74%
  • primordial_arcanic_pulsar_20:8.26%
  • primordial_arcanic_pulsar_25:8.47%
  • primordial_arcanic_pulsar_30:8.18%
  • primordial_arcanic_pulsar_35:8.75%
  • primordial_arcanic_pulsar_40:9.11%
  • primordial_arcanic_pulsar_45:9.00%
  • primordial_arcanic_pulsar_50:8.92%
  • primordial_arcanic_pulsar_55:8.89%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 19.8 3.3 15.6s 13.6s 6.6s 43.71% 42.90% 3.3 (3.3) 19.4

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 39.5s
  • trigger_min/max:0.0s / 37.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:39.66% / 46.34%

Stack Uptimes

  • solstice_1:43.71%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starfall 103.5 0.0 143.3s 2.9s 296.4s 98.87% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_starfall
  • max_stacks:20
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:asynchronous
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.9s / 357.1s
  • trigger_min/max:0.7s / 8.5s
  • trigger_pct:99.99%
  • duration_min/max:50.6s / 357.6s
  • uptime_min/max:98.42% / 99.48%

Stack Uptimes

  • starfall_1:5.65%
  • starfall_2:33.75%
  • starfall_3:41.92%
  • starfall_4:14.18%
  • starfall_5:3.05%
  • starfall_6:0.32%
  • starfall_7:0.00%

Spelldata

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]
  • max_stacks:20
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Starlord 21.0 82.6 14.5s 2.9s 14.0s 97.47% 0.00% 41.2 (41.2) 6.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 18.8s
  • trigger_min/max:0.8s / 8.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:95.16% / 99.24%

Stack Uptimes

  • starlord_1:12.79%
  • starlord_2:17.99%
  • starlord_3:66.70%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Umbral Embrace 22.8 2.6 12.9s 11.5s 1.6s 12.33% 0.00% 2.6 (2.6) 0.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_umbral_embrace
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 50.4s
  • trigger_min/max:0.0s / 49.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.2s
  • uptime_min/max:3.88% / 22.36%

Stack Uptimes

  • umbral_embrace_1:12.33%

Spelldata

  • id:393763
  • name:Umbral Embrace
  • tooltip:Your next Wrath or Starfire cast during an Eclipse deals Astral damage and deals {$=}w1% additional damage.
  • description:{$@spelldesc393760=Dealing Astral damage has a chance to cause your next Wrath or Starfire cast during an Eclipse to become Astral and deal {$s1=25}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Wafting Devotion 4.3 1.2 61.7s 45.7s 16.5s 23.67% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 215.4s
  • trigger_min/max:0.0s / 215.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.1s
  • uptime_min/max:5.02% / 56.55%

Stack Uptimes

  • wafting_devotion_1:23.67%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Primordial Arcanic Pulsar 8.2 6.0 10.0 35.7s 24.1s 47.3s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.05% 0.00% 0.59% 0.0s 0.0s 1.1s
Astral Smolder 73.83% 62.72% 82.70% 4.2s 0.0s 48.3s
Incarnation (Total) 52.17% 46.80% 59.29% 19.1s 0.0s 54.0s
Incarnation (Pulsar) 31.93% 29.10% 34.56% 11.7s 0.0s 12.0s
Lunar Eclipse Only 40.82% 33.34% 46.86% 9.5s 0.0s 15.0s
No Eclipse 6.98% 4.31% 10.09% 1.7s 0.0s 4.4s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Fury of Elune4.9330.00028.09525.2407.72476.221

Eclipse Utilization

NoneSolarLunarBoth
Wrath24.09100.0%0.000.0%0.000.0%0.000.0%
Starfire2.422.1%0.000.0%49.9542.4%65.4055.5%
Starfall21.377.2%0.000.0%119.4140.2%155.8852.5%
Fury of Elune21.252.8%0.000.0%143.2519.0%590.6278.2%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
470 T31 4p
Fury of EluneAstral Power80.86241.865.85%2.990.730.30%
MoonfireAstral Power3.0018.000.44%6.000.000.00%
Orbit BreakerAstral Power15.57464.9311.24%29.872.040.44%
Shooting Stars (Moonfire)Astral Power232.77465.2811.25%2.000.270.06%
Shooting Stars (Sunfire)Astral Power234.20468.1211.32%2.000.280.06%
StarfireAstral Power117.762210.4753.45%18.7733.111.48%
SunfireAstral Power1.006.000.15%6.000.000.00%
WrathAstral Power26.09260.946.31%10.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
470 T31 4p
StarfallAstral Power 104.944136.84100.00%39.4239.9518587.38
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 736200.0 3344.17 3876.30 2928548.1 576286.6 -34680.9 736200.0
Astral Power 20.0 13.76 13.58 36.5 53.5 0.8 100.0

Statistics & Data Analysis

Fight Length
470 T31 4p Fight Length
Count 2390
Mean 300.52
Minimum 240.03
Maximum 359.99
Spread ( max - min ) 119.97
Range [ ( max - min ) / 2 * 100% ] 19.96%
Standard Deviation 34.2618
5th Percentile 246.01
95th Percentile 353.59
( 95th Percentile - 5th Percentile ) 107.59
Mean Distribution
Standard Deviation 0.7008
95.00% Confidence Interval ( 299.14 - 301.89 )
Normalized 95.00% Confidence Interval ( 99.54% - 100.46% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 500
0.1% Error 49933
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1003
DPS
470 T31 4p Damage Per Second
Count 2390
Mean 771809.06
Minimum 712376.52
Maximum 845757.72
Spread ( max - min ) 133381.21
Range [ ( max - min ) / 2 * 100% ] 8.64%
Standard Deviation 18977.3745
5th Percentile 742818.15
95th Percentile 804193.09
( 95th Percentile - 5th Percentile ) 61374.94
Mean Distribution
Standard Deviation 388.1836
95.00% Confidence Interval ( 771048.24 - 772569.89 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2323
0.1 Scale Factor Error with Delta=300 3074369
0.05 Scale Factor Error with Delta=300 12297475
0.01 Scale Factor Error with Delta=300 307436851
Priority Target DPS
470 T31 4p Priority Target Damage Per Second
Count 2390
Mean 140844.51
Minimum 126986.88
Maximum 155943.75
Spread ( max - min ) 28956.87
Range [ ( max - min ) / 2 * 100% ] 10.28%
Standard Deviation 4522.7187
5th Percentile 133507.26
95th Percentile 148534.51
( 95th Percentile - 5th Percentile ) 15027.24
Mean Distribution
Standard Deviation 92.5125
95.00% Confidence Interval ( 140663.19 - 141025.84 )
Normalized 95.00% Confidence Interval ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3962
0.1 Scale Factor Error with Delta=300 174616
0.05 Scale Factor Error with Delta=300 698463
0.01 Scale Factor Error with Delta=300 17461552
DPS(e)
470 T31 4p Damage Per Second (Effective)
Count 2390
Mean 771809.06
Minimum 712376.52
Maximum 845757.72
Spread ( max - min ) 133381.21
Range [ ( max - min ) / 2 * 100% ] 8.64%
Damage
470 T31 4p Damage
Count 2390
Mean 231550944.11
Minimum 184453831.01
Maximum 282090110.07
Spread ( max - min ) 97636279.06
Range [ ( max - min ) / 2 * 100% ] 21.08%
DTPS
470 T31 4p Damage Taken Per Second
Count 2390
Mean 3879.46
Minimum 1199.56
Maximum 6930.97
Spread ( max - min ) 5731.41
Range [ ( max - min ) / 2 * 100% ] 73.87%
HPS
470 T31 4p Healing Per Second
Count 2390
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
470 T31 4p Healing Per Second (Effective)
Count 2390
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
470 T31 4p Heal
Count 2390
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
470 T31 4p Healing Taken Per Second
Count 2390
Mean 3337.73
Minimum 655.83
Maximum 6399.51
Spread ( max - min ) 5743.68
Range [ ( max - min ) / 2 * 100% ] 86.04%
TMI
470 T31 4p Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
470 T31 4pTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
470 T31 4p Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.45 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.70 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.75 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.aoe
# count action,conditions
0.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
0.00 variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
I 1.00 sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
J 3.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
0.00 variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
K 14.07 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
L 69.27 starfall,if=variable.starfall_condition1
M 1.38 starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
0.00 celestial_alignment,if=variable.cd_condition_aoe
N 2.00 incarnation,if=variable.cd_condition_aoe
0.00 warrior_of_elune
0.00 variable,name=enter_solar,value=spell_targets.starfire<3
0.00 starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
O 24.16 wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
0.00 wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
P 5.12 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
Q 34.28 starfall,if=variable.starfall_condition2
0.00 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+50
0.00 convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 new_moon,if=astral_power.deficit>variable.passive_asp+10
0.00 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
R 115.95 starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
0.00 wrath
S 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFIJJJLLMNDEPQRRLRLRLRLRKLLQRRRLRRLRLRLRKLQRQRRRLRRLRLRQOOQRRQRLRRKLQQRRPOOLRLLRKLRQRRQOORRLRFLRLQRERRLRLRKLOOQRLRRLRRKLQOORQRRRLRRLPLQRRLLRRLOORLRLQRRRLROOKLRQRQRLRRLRKLQFROOQRNERRLLRLRQQPRQRRRLRLRKLLQRRRLRLRRKLQRQRROOLRRKLLQRRRLRLROKLORQRLRRLRPKLROLORL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask 470 T31 4p 0.0/100: 0% astral_power
Pre precombat 1 food 470 T31 4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 2 augmentation 470 T31 4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 4 no_cd_talent 470 T31 4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 5 on_use_trinket 470 T31 4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 6 on_use_trinket 470 T31 4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 7 on_use_trinket 470 T31 4p 0.0/100: 0% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 10.0/100: 10% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil 470 T31 4p 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.000 aoe I sunfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.941 aoe J moonfire Fluffy_Pillow 49.2/100: 49% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:01.882 aoe J moonfire enemy3 63.2/100: 63% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:02.824 aoe J moonfire enemy4 75.2/100: 75% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:03.764 aoe L starfall Fluffy_Pillow 87.2/100: 87% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:04.703 aoe L starfall Fluffy_Pillow 80.2/100: 80% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, dreamstate, corrupting_rage
0:05.605 aoe M starfire Fluffy_Pillow 39.2/100: 39% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), corrupting_rage
0:06.389 aoe N incarnation_chosen_of_elune Fluffy_Pillow 58.4/100: 58% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(10), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), corrupting_rage
0:06.389 default D potion Fluffy_Pillow 58.4/100: 58% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), corrupting_rage
0:06.389 default E use_items Fluffy_Pillow 58.4/100: 58% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power
0:06.389 aoe P fury_of_elune Fluffy_Pillow 58.4/100: 58% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:07.182 aoe Q starfall Fluffy_Pillow 67.4/100: 67% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), umbral_embrace, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:07.974 aoe R starfire Fluffy_Pillow 42.4/100: 42% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:08.727 aoe R starfire Fluffy_Pillow 70.6/100: 71% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:09.481 aoe L starfall Fluffy_Pillow 99.8/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:10.247 aoe R starfire Fluffy_Pillow 73.8/100: 74% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:11.393 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:12.159 aoe R starfire Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:13.303 aoe L starfall Fluffy_Pillow 97.2/100: 97% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
0:14.068 aoe R starfire Fluffy_Pillow 72.2/100: 72% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:15.211 aoe L starfall Fluffy_Pillow 96.4/100: 96% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:15.977 aoe R starfire Fluffy_Pillow 65.4/100: 65% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:17.122 aoe K cancel_buff Fluffy_Pillow 88.6/100: 89% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(50)
0:17.122 aoe L starfall Fluffy_Pillow 88.6/100: 89% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(50)
0:17.975 aoe L starfall Fluffy_Pillow 87.6/100: 88% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(45)
0:18.797 aoe Q starfall Fluffy_Pillow 54.6/100: 55% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(5), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(40)
0:19.588 aoe R starfire Fluffy_Pillow 19.6/100: 20% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(35)
0:20.732 aoe R starfire Fluffy_Pillow 38.8/100: 39% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(30)
0:21.877 aoe R starfire Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(25)
0:23.021 aoe L starfall Fluffy_Pillow 81.2/100: 81% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(20)
0:23.787 aoe R starfire Fluffy_Pillow 46.2/100: 46% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(15)
0:24.931 aoe R starfire Fluffy_Pillow 67.4/100: 67% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(10)
0:26.075 aoe L starfall Fluffy_Pillow 88.6/100: 89% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(5)
0:26.841 aoe R starfire Fluffy_Pillow 59.6/100: 60% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:27.986 aoe L starfall Fluffy_Pillow 92.8/100: 93% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:28.750 aoe R starfire Fluffy_Pillow 63.8/100: 64% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:29.895 aoe L starfall Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:30.661 aoe R starfire Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:31.804 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:31.804 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:32.660 aoe Q starfall Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:33.483 aoe R starfire Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(5), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:34.670 aoe Q starfall Fluffy_Pillow 53.2/100: 53% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:35.463 aoe R starfire Fluffy_Pillow 20.2/100: 20% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:36.607 aoe R starfire Fluffy_Pillow 43.4/100: 43% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:37.753 aoe R starfire Fluffy_Pillow 64.6/100: 65% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:38.897 aoe L starfall Fluffy_Pillow 85.8/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:39.663 aoe R starfire Fluffy_Pillow 52.8/100: 53% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:40.808 aoe R starfire Fluffy_Pillow 74.0/100: 74% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:42.295 aoe L starfall Fluffy_Pillow 95.2/100: 95% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:43.288 aoe R starfire Fluffy_Pillow 62.2/100: 62% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:44.773 aoe L starfall Fluffy_Pillow 83.4/100: 83% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:45.765 aoe R starfire Fluffy_Pillow 48.4/100: 48% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5)
0:47.252 aoe Q starfall Fluffy_Pillow 67.6/100: 68% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5)
0:48.365 aoe O wrath Fluffy_Pillow 34.6/100: 35% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord, umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static
0:49.433 aoe O wrath Fluffy_Pillow 46.6/100: 47% astral_power primordial_arcanic_pulsar(45), starfall(3), starlord, umbral_embrace, dreamstate, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static
0:50.188 aoe Q starfall Fluffy_Pillow 56.6/100: 57% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(3), starlord, umbral_embrace, dreamstate, best_friends_with_aerwynn(9), best_friends_with_aerwynn_static
0:51.362 aoe R starfire Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(2), umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(8), best_friends_with_aerwynn_static
0:52.380 aoe R starfire Fluffy_Pillow 40.8/100: 41% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static
0:54.076 aoe Q starfall Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static
0:55.207 aoe R starfire Fluffy_Pillow 29.0/100: 29% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static
0:56.842 aoe L starfall Fluffy_Pillow 52.2/100: 52% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static
0:57.935 aoe R starfire Fluffy_Pillow 41.2/100: 41% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static
0:59.422 aoe R starfire Fluffy_Pillow 70.4/100: 70% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static
1:00.911 aoe K cancel_buff Fluffy_Pillow 97.6/100: 98% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, corrupting_rage
1:00.911 aoe L starfall Fluffy_Pillow 97.6/100: 98% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, corrupting_rage
1:02.022 aoe Q starfall Fluffy_Pillow 66.6/100: 67% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, corrupting_rage
1:03.089 aoe Q starfall Fluffy_Pillow 35.6/100: 36% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
1:04.118 aoe R starfire Fluffy_Pillow 4.6/100: 5% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
1:05.604 aoe R starfire Fluffy_Pillow 27.8/100: 28% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage
1:07.089 aoe P fury_of_elune Fluffy_Pillow 49.0/100: 49% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage
1:08.082 aoe O wrath Fluffy_Pillow 54.0/100: 54% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage
1:09.073 aoe O wrath Fluffy_Pillow 70.0/100: 70% astral_power fury_of_elune, primordial_arcanic_pulsar(15), starfall(2), starlord(3), dreamstate, best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage
1:09.829 aoe L starfall Fluffy_Pillow 86.0/100: 86% astral_power balance_of_all_things_arcane(8), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(2), starlord(3), dreamstate, best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage
1:10.919 aoe R starfire Fluffy_Pillow 53.0/100: 53% astral_power balance_of_all_things_arcane(7), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage
1:11.901 aoe L starfall Fluffy_Pillow 84.2/100: 84% astral_power balance_of_all_things_arcane(6), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage
1:12.993 aoe L starfall Fluffy_Pillow 51.2/100: 51% astral_power balance_of_all_things_arcane(5), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage
1:14.085 aoe R starfire Fluffy_Pillow 46.2/100: 46% astral_power balance_of_all_things_arcane(4), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage
1:15.721 aoe K cancel_buff Fluffy_Pillow 82.4/100: 82% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage
1:15.721 aoe L starfall Fluffy_Pillow 82.4/100: 82% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage
1:16.943 aoe R starfire Fluffy_Pillow 41.4/100: 41% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(4), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage
1:18.704 aoe Q starfall Fluffy_Pillow 62.6/100: 63% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage
1:19.879 aoe R starfire Fluffy_Pillow 19.6/100: 20% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(4), starlord(2), umbral_embrace, balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
1:21.577 aoe R starfire Fluffy_Pillow 40.8/100: 41% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
1:23.272 aoe Q starfall Fluffy_Pillow 62.0/100: 62% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:24.320 aoe O wrath Fluffy_Pillow 19.0/100: 19% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:25.330 aoe O wrath Fluffy_Pillow 31.0/100: 31% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(3), dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:26.084 aoe R starfire Fluffy_Pillow 43.0/100: 43% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:26.994 aoe R starfire Fluffy_Pillow 66.2/100: 66% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:28.509 aoe L starfall Fluffy_Pillow 97.4/100: 97% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:29.520 aoe R starfire Fluffy_Pillow 56.4/100: 56% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:31.033 default F natures_vigil 470 T31 4p 81.6/100: 82% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:31.033 aoe L starfall Fluffy_Pillow 81.6/100: 82% astral_power natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:32.165 aoe R starfire Fluffy_Pillow 42.6/100: 43% astral_power natures_vigil, balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:33.794 aoe L starfall Fluffy_Pillow 95.8/100: 96% astral_power natures_vigil, balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:34.883 aoe Q starfall Fluffy_Pillow 54.8/100: 55% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:35.836 aoe R starfire Fluffy_Pillow 27.8/100: 28% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:37.212 default E use_items Fluffy_Pillow 51.0/100: 51% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage
1:37.212 aoe R starfire Fluffy_Pillow 51.0/100: 51% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage, kindled_soul(100)
1:38.698 aoe R starfire Fluffy_Pillow 80.2/100: 80% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage, kindled_soul(95)
1:40.186 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage, kindled_soul(90)
1:41.179 aoe R starfire Fluffy_Pillow 67.0/100: 67% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(85)
1:42.666 aoe L starfall Fluffy_Pillow 88.2/100: 88% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(75)
1:43.659 aoe R starfire Fluffy_Pillow 57.2/100: 57% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(70)
1:45.146 aoe K cancel_buff Fluffy_Pillow 80.4/100: 80% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(65)
1:45.146 aoe L starfall Fluffy_Pillow 80.4/100: 80% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(65)
1:46.259 aoe O wrath Fluffy_Pillow 45.4/100: 45% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord, dreamstate, best_friends_with_urctos_static, corrupting_rage, kindled_soul(55)
1:47.013 aoe O wrath Fluffy_Pillow 57.4/100: 57% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord, best_friends_with_urctos_static, corrupting_rage, kindled_soul(55)
1:47.768 aoe Q starfall Fluffy_Pillow 67.4/100: 67% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord, best_friends_with_urctos_static, corrupting_rage, kindled_soul(50)
1:48.943 aoe R starfire Fluffy_Pillow 26.4/100: 26% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, corrupting_rage, kindled_soul(45)
1:50.638 aoe L starfall Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, corrupting_rage, kindled_soul(35)
1:51.772 aoe R starfire Fluffy_Pillow 8.6/100: 9% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, corrupting_rage, kindled_soul(30)
1:53.408 aoe R starfire Fluffy_Pillow 67.8/100: 68% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, corrupting_rage, kindled_soul(20)
1:55.045 aoe L starfall Fluffy_Pillow 89.0/100: 89% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, corrupting_rage, kindled_soul(15)
1:56.136 aoe R starfire Fluffy_Pillow 46.0/100: 46% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(10)
1:57.773 aoe R starfire Fluffy_Pillow 67.2/100: 67% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, corrupting_rage
1:59.409 aoe K cancel_buff Fluffy_Pillow 88.4/100: 88% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, corrupting_rage
1:59.409 aoe L starfall Fluffy_Pillow 88.4/100: 88% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, corrupting_rage
2:00.630 aoe Q starfall Fluffy_Pillow 47.4/100: 47% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage
2:01.805 aoe O wrath Fluffy_Pillow 4.4/100: 4% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(3), starlord(2), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
2:02.936 aoe O wrath Fluffy_Pillow 14.4/100: 14% astral_power primordial_arcanic_pulsar(45), starfall(3), starlord(2), dreamstate, best_friends_with_urctos_static, corrupting_rage
2:03.690 aoe R starfire Fluffy_Pillow 26.4/100: 26% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), best_friends_with_urctos_static, corrupting_rage
2:04.708 aoe Q starfall Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), best_friends_with_urctos_static, corrupting_rage
2:05.842 aoe R starfire Fluffy_Pillow 10.6/100: 11% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, corrupting_rage
2:07.476 aoe R starfire Fluffy_Pillow 33.8/100: 34% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, corrupting_rage
2:09.111 aoe R starfire Fluffy_Pillow 61.0/100: 61% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, corrupting_rage
2:10.746 aoe L starfall Fluffy_Pillow 80.2/100: 80% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(50), starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, corrupting_rage
2:11.836 aoe R starfire Fluffy_Pillow 37.2/100: 37% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, corrupting_rage
2:13.472 aoe R starfire Fluffy_Pillow 60.4/100: 60% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall, starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, corrupting_rage
2:15.108 aoe L starfall Fluffy_Pillow 83.6/100: 84% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall, balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, corrupting_rage
2:16.330 aoe P fury_of_elune Fluffy_Pillow 78.6/100: 79% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, corrupting_rage
2:17.401 aoe L starfall Fluffy_Pillow 90.6/100: 91% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage
2:18.470 aoe Q starfall Fluffy_Pillow 65.6/100: 66% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage
2:19.498 aoe R starfire Fluffy_Pillow 42.6/100: 43% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage
2:20.985 aoe R starfire Fluffy_Pillow 74.8/100: 75% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage
2:22.472 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage
2:23.465 aoe L starfall Fluffy_Pillow 73.0/100: 73% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage
2:24.458 aoe R starfire Fluffy_Pillow 44.0/100: 44% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage
2:25.945 aoe R starfire Fluffy_Pillow 65.2/100: 65% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage
2:27.433 aoe L starfall Fluffy_Pillow 81.2/100: 81% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), dreamstate(2), best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage
2:28.524 aoe O wrath Fluffy_Pillow 36.2/100: 36% astral_power primordial_arcanic_pulsar(25), starfall(3), starlord(3), dreamstate, best_friends_with_urctos_static, corrupting_rage
2:29.279 aoe O wrath Fluffy_Pillow 46.2/100: 46% astral_power primordial_arcanic_pulsar(25), starfall(3), starlord(3), best_friends_with_urctos_static
2:30.033 aoe R starfire Fluffy_Pillow 58.2/100: 58% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), best_friends_with_urctos_static
2:31.669 aoe L starfall Fluffy_Pillow 83.4/100: 83% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall, best_friends_with_urctos_static
2:32.891 aoe R starfire Fluffy_Pillow 42.4/100: 42% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, best_friends_with_urctos_static
2:34.651 aoe L starfall Fluffy_Pillow 71.6/100: 72% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, best_friends_with_urctos_static
2:35.827 aoe Q starfall Fluffy_Pillow 60.6/100: 61% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static
2:36.959 aoe R starfire Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static
2:38.595 aoe R starfire Fluffy_Pillow 36.8/100: 37% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static
2:40.229 aoe R starfire Fluffy_Pillow 58.0/100: 58% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, wafting_devotion
2:41.742 aoe L starfall Fluffy_Pillow 79.2/100: 79% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, wafting_devotion
2:42.754 aoe R starfire Fluffy_Pillow 34.2/100: 34% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, wafting_devotion
2:44.266 aoe O wrath Fluffy_Pillow 57.4/100: 57% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall, starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:45.279 aoe O wrath Fluffy_Pillow 69.4/100: 69% astral_power primordial_arcanic_pulsar(45), starfall, starlord(3), dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:46.031 aoe K cancel_buff Fluffy_Pillow 83.4/100: 83% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:46.031 aoe L starfall Fluffy_Pillow 83.4/100: 83% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:47.163 aoe R starfire Fluffy_Pillow 44.4/100: 44% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:48.141 aoe Q starfall Fluffy_Pillow 71.6/100: 72% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:49.229 aoe R starfire Fluffy_Pillow 30.6/100: 31% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:50.798 aoe Q starfall Fluffy_Pillow 53.8/100: 54% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:51.845 aoe R starfire Fluffy_Pillow 14.8/100: 15% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:53.221 aoe L starfall Fluffy_Pillow 46.0/100: 46% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:54.141 aoe R starfire Fluffy_Pillow 45.0/100: 45% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:55.517 aoe R starfire Fluffy_Pillow 70.2/100: 70% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage
2:57.006 aoe L starfall Fluffy_Pillow 99.4/100: 99% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage
2:57.997 aoe R starfire Fluffy_Pillow 64.4/100: 64% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
2:59.485 aoe K cancel_buff Fluffy_Pillow 83.6/100: 84% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
2:59.485 aoe L starfall Fluffy_Pillow 83.6/100: 84% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:00.597 aoe Q starfall Fluffy_Pillow 52.6/100: 53% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:01.664 default F natures_vigil 470 T31 4p 17.6/100: 18% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:01.664 aoe R starfire Fluffy_Pillow 17.6/100: 18% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:03.204 aoe O wrath Fluffy_Pillow 33.6/100: 34% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(3), starlord(2), dreamstate, best_friends_with_urctos_static, corrupting_rage
3:03.960 aoe O wrath Fluffy_Pillow 45.6/100: 46% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(3), starlord(2), best_friends_with_urctos_static, corrupting_rage
3:04.715 aoe Q starfall Fluffy_Pillow 55.6/100: 56% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(2), umbral_embrace, best_friends_with_urctos_static, corrupting_rage
3:05.847 aoe R starfire Fluffy_Pillow 14.6/100: 15% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, corrupting_rage
3:07.482 aoe N incarnation_chosen_of_elune Fluffy_Pillow 43.8/100: 44% astral_power natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:07.482 default E use_items Fluffy_Pillow 43.8/100: 44% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), dreamstate(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:07.482 aoe R starfire Fluffy_Pillow 43.8/100: 44% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(100)
3:08.308 aoe R starfire Fluffy_Pillow 69.0/100: 69% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(100)
3:09.136 aoe L starfall Fluffy_Pillow 92.2/100: 92% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), solstice, starfall, starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(95)
3:10.054 aoe L starfall Fluffy_Pillow 61.2/100: 61% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(90)
3:10.972 aoe R starfire Fluffy_Pillow 62.2/100: 62% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(85)
3:12.347 aoe L starfall Fluffy_Pillow 85.4/100: 85% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(80)
3:13.266 aoe R starfire Fluffy_Pillow 54.4/100: 54% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(75)
3:14.642 aoe Q starfall Fluffy_Pillow 75.6/100: 76% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(65)
3:15.672 aoe Q starfall Fluffy_Pillow 40.6/100: 41% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(60)
3:16.661 aoe P fury_of_elune Fluffy_Pillow 5.6/100: 6% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(5), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(55)
3:17.615 aoe R starfire Fluffy_Pillow 10.6/100: 11% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(50)
3:19.041 aoe Q starfall Fluffy_Pillow 42.8/100: 43% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(3), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(45)
3:19.993 aoe R starfire Fluffy_Pillow 13.8/100: 14% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(40)
3:21.370 aoe R starfire Fluffy_Pillow 48.0/100: 48% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(35)
3:22.745 aoe R starfire Fluffy_Pillow 76.2/100: 76% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(25)
3:24.122 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(20)
3:25.042 aoe R starfire Fluffy_Pillow 77.0/100: 77% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(15)
3:26.419 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(10)
3:27.337 aoe R starfire Fluffy_Pillow 69.0/100: 69% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(5)
3:28.716 aoe K cancel_buff Fluffy_Pillow 98.2/100: 98% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
3:28.716 aoe L starfall Fluffy_Pillow 98.2/100: 98% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
3:29.746 aoe L starfall Fluffy_Pillow 69.2/100: 69% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
3:30.735 aoe Q starfall Fluffy_Pillow 36.2/100: 36% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
3:31.687 aoe R starfire Fluffy_Pillow 3.2/100: 3% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
3:33.063 aoe R starfire Fluffy_Pillow 54.4/100: 54% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
3:34.439 aoe R starfire Fluffy_Pillow 75.6/100: 76% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
3:35.817 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
3:36.737 aoe R starfire Fluffy_Pillow 65.0/100: 65% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:38.223 aoe L starfall Fluffy_Pillow 86.2/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:39.215 aoe R starfire Fluffy_Pillow 55.2/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:40.703 aoe R starfire Fluffy_Pillow 78.4/100: 78% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:42.187 aoe K cancel_buff Fluffy_Pillow 99.6/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:42.187 aoe L starfall Fluffy_Pillow 99.6/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:43.298 aoe Q starfall Fluffy_Pillow 68.6/100: 69% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:44.366 aoe R starfire Fluffy_Pillow 33.6/100: 34% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:45.908 aoe Q starfall Fluffy_Pillow 52.8/100: 53% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:46.937 aoe R starfire Fluffy_Pillow 17.8/100: 18% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:48.424 aoe R starfire Fluffy_Pillow 37.0/100: 37% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:49.911 aoe O wrath Fluffy_Pillow 53.0/100: 53% astral_power primordial_arcanic_pulsar(45), starfall(3), starlord(3), dreamstate, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, corrupting_rage
3:50.663 aoe O wrath Fluffy_Pillow 63.0/100: 63% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage
3:51.418 aoe L starfall Fluffy_Pillow 75.0/100: 75% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage
3:52.510 aoe R starfire Fluffy_Pillow 36.0/100: 36% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, corrupting_rage
3:54.145 aoe R starfire Fluffy_Pillow 65.2/100: 65% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, corrupting_rage
3:55.781 aoe K cancel_buff Fluffy_Pillow 88.4/100: 88% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, corrupting_rage
3:55.781 aoe L starfall Fluffy_Pillow 88.4/100: 88% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, corrupting_rage
3:57.004 aoe L starfall Fluffy_Pillow 47.4/100: 47% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, corrupting_rage
3:58.182 aoe Q starfall Fluffy_Pillow 38.4/100: 38% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, corrupting_rage
3:59.213 aoe R starfire Fluffy_Pillow 7.4/100: 7% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn, best_friends_with_aerwynn_static, corrupting_rage
4:00.699 aoe R starfire Fluffy_Pillow 36.6/100: 37% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, corrupting_rage
4:02.186 aoe R starfire Fluffy_Pillow 61.8/100: 62% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, corrupting_rage
4:03.673 aoe L starfall Fluffy_Pillow 87.0/100: 87% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, corrupting_rage
4:04.666 aoe R starfire Fluffy_Pillow 54.0/100: 54% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
4:06.152 aoe L starfall Fluffy_Pillow 75.2/100: 75% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage
4:07.143 aoe R starfire Fluffy_Pillow 42.2/100: 42% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage
4:08.631 aoe O wrath Fluffy_Pillow 63.4/100: 63% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage
4:09.624 aoe K cancel_buff Fluffy_Pillow 73.4/100: 73% astral_power primordial_arcanic_pulsar(15), starfall(2), starlord(3), dreamstate(2), best_friends_with_pip(8), best_friends_with_pip_static, corrupting_rage
4:09.624 aoe L starfall Fluffy_Pillow 73.4/100: 73% astral_power primordial_arcanic_pulsar(15), starfall(2), dreamstate(2), best_friends_with_pip(8), best_friends_with_pip_static, corrupting_rage
4:10.844 aoe O wrath Fluffy_Pillow 28.4/100: 28% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord, dreamstate, best_friends_with_pip(7), best_friends_with_pip_static, corrupting_rage
4:11.600 aoe R starfire Fluffy_Pillow 40.4/100: 40% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord, best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage
4:12.659 aoe Q starfall Fluffy_Pillow 59.6/100: 60% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord, best_friends_with_pip(5), best_friends_with_pip_static, corrupting_rage
4:13.836 aoe R starfire Fluffy_Pillow 28.6/100: 29% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage
4:15.530 aoe L starfall Fluffy_Pillow 51.8/100: 52% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage
4:16.663 aoe R starfire Fluffy_Pillow 10.8/100: 11% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip, best_friends_with_pip_static, corrupting_rage
4:18.299 aoe R starfire Fluffy_Pillow 64.0/100: 64% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
4:19.935 aoe L starfall Fluffy_Pillow 83.2/100: 83% astral_power eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
4:21.027 aoe R starfire Fluffy_Pillow 38.2/100: 38% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
4:22.661 aoe P fury_of_elune Fluffy_Pillow 63.4/100: 63% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
4:23.753 aoe K cancel_buff Fluffy_Pillow 73.4/100: 73% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(35), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
4:23.753 aoe L starfall Fluffy_Pillow 73.4/100: 73% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(35), starfall, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
4:24.974 aoe R starfire Fluffy_Pillow 36.4/100: 36% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(40), starfall(2), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
4:26.736 aoe O wrath Fluffy_Pillow 62.4/100: 62% astral_power fury_of_elune, primordial_arcanic_pulsar(40), starfall(2), starlord, dreamstate, best_friends_with_pip_static, corrupting_rage
4:27.491 aoe L starfall Fluffy_Pillow 79.4/100: 79% astral_power fury_of_elune, primordial_arcanic_pulsar(40), starfall(2), starlord, dreamstate, best_friends_with_pip_static, corrupting_rage
4:28.666 aoe O wrath Fluffy_Pillow 43.4/100: 43% astral_power fury_of_elune, primordial_arcanic_pulsar(45), starfall(2), starlord(2), best_friends_with_pip_static, corrupting_rage
4:29.420 aoe R starfire Fluffy_Pillow 60.4/100: 60% astral_power balance_of_all_things_arcane(8), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), best_friends_with_pip_static, corrupting_rage
4:31.117 aoe L starfall Fluffy_Pillow 92.6/100: 93% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), best_friends_with_pip_static, corrupting_rage

Stats

Level Bonus (70) Race Bonus (tauren) Raid-Buffed Unbuffed Gear Amount
Strength 898 2 986 900 0
Agility 2089 -2 2173 2087 0
Stamina 3848 2 36810 35057 31140
Intellect 2089 -2 13750 12926 10224 (6349)
Spirit 0 0 0 0 0
Health 736200 701140 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13750 12926 0
Crit 27.17% 20.96% 2873
Haste 23.17% 23.17% 3938
Versatility 6.22% 1.22% 251
Mana Regen 2560 2560 0
Attack Power 14300 13443 0
Mastery 29.20% 29.20% 7576
Armor 4652 4652 4652
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 470.00
Local Head Benevolent Embersage's Casque
ilevel: 470, stats: { 585 Armor, +3163 Sta, +655 Crit, +307 Haste, +786 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }, enchant: incandescent_essence
Local Neck Eye of the Rising Flame
ilevel: 470, stats: { +1779 Sta, +233 Haste, +1397 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Life-Bound Shoulderpads
ilevel: 470, stats: { 536 Armor, +2372 Sta, +360 Mastery, +360 Haste, +590 AgiInt }
item effects: { equip: Toxified }
Local Chest Benevolent Embersage's Robe
ilevel: 470, stats: { 780 Armor, +3163 Sta, +665 Crit, +296 Mastery, +786 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 470, stats: { 439 Armor, +2372 Sta, +497 Haste, +224 Mastery, +590 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 470, stats: { 683 Armor, +3163 Sta, +656 Haste, +305 Mastery, +786 AgiInt }, enchant: { +155 StrAgiInt, +41 Vers (lambent_armor_kit_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 470, stats: { 488 Armor, +2372 Sta, +257 Crit, +412 Haste, +590 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Thermal Bindings
ilevel: 470, stats: { 390 Armor, +1779 Sta, +178 Crit, +363 Mastery, +442 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Benevolent Embersage's Talons
ilevel: 470, stats: { 439 Armor, +2372 Sta, +210 Vers, +511 Mastery, +590 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 470, stats: { +1779 Sta, +466 Haste, +1165 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 470, stats: { +1779 Sta, +1118 Crit, +512 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 470, stats: { +747 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 470, stats: { +687 Mastery }
item effects: { use: Balefire Branch }
Local Back Drape of the Loyal Vassal
ilevel: 470, stats: { 312 Armor, +1779 Sta, +305 Haste, +236 Mastery, +442 StrAgiInt }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 470, weapon: { 508 - 654, 2.6 }, stats: { +393 Int, +1896 Int, +1581 Sta, +145 Haste, +335 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 470, stats: { +1206 Int, +1581 Sta, +162 Haste, +319 Mastery }

Profile

druid="470 T31 4p"
source=default
spec=balance
level=70
race=tauren
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:hissing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Balance APL can be found at https://balance-simc.github.io/Balance-SimC/balance.txt

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=470,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=470,gem_id=192961/192961/192961
shoulders=lifebound_shoulderpads,id=193406,bonus_id=8836/1576/8797/8960,ilevel=470,crafted_stats=49/36
back=drape_of_the_loyal_vassal,id=158375,bonus_id=4795,ilevel=470
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=470,enchant_id=6625
wrists=thermal_bindings,id=134461,bonus_id=4795,ilevel=470,gem_id=192961
hands=benevolent_embersages_talons,id=207255,bonus_id=4795,ilevel=470
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=470,enchant_id=6830
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=470
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=470
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=470
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=470,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=470

# Gear Summary
# gear_ilvl=470.00
# gear_stamina=31140
# gear_intellect=10224
# gear_crit_rating=2873
# gear_haste_rating=3938
# gear_mastery_rating=7576
# gear_versatility_rating=251
# gear_armor=4652
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

Simulation & Raid Information

Iterations: 2422
Threads: 32
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.3 )

Performance:

Total Events Processed: 240633887
Max Event Queue: 106
Sim Seconds: 727405
CPU Seconds: 222.1824
Physical Seconds: 12.0782
Speed Up: 3274

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
447 T30 4p 447 T30 4p astral_smolder ticks -394061 23317189 77724 140.28 33251 0 340.2 701.4 0.0% 0.0% 0.0% 0.0% 0.95sec 23317189 300.83sec
447 T30 4p 447 T30 4p augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
447 T30 4p 447 T30 4p flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
447 T30 4p 447 T30 4p food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
447 T30 4p 447 T30 4p fury_of_elune 202770 5958184 19806 150.42 4943 10684 5.1 754.2 51.5% 0.0% 0.0% 0.0% 65.54sec 5958184 300.83sec
447 T30 4p 447 T30 4p hungering_shadowflame 424324 861362 2863 3.36 39910 81680 16.8 16.8 27.0% 0.0% 0.0% 0.0% 17.21sec 861362 300.83sec
447 T30 4p 447 T30 4p hungering_shadowflame_self 424324 504904 1678 3.36 23508 47934 16.8 16.8 26.6% 0.0% 0.0% 0.0% 17.21sec 557843 300.83sec
447 T30 4p 447 T30 4p incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.83sec 0 300.83sec
447 T30 4p 447 T30 4p launched_thorns 379403 1648430 5480 6.65 38600 78680 33.4 33.4 27.0% 0.0% 0.0% 0.0% 8.79sec 1648430 300.83sec
447 T30 4p 447 T30 4p launched_thorns_heal 379407 0 0 0.00 0 0 0.2 0.0 0.0% 0.0% 0.0% 0.0% 165.00sec 0 300.83sec
447 T30 4p 447 T30 4p moonfire 8921 62008 206 1.20 6874 14025 3.0 6.0 48.4% 0.0% 0.0% 0.0% 1.08sec 20793354 300.83sec
447 T30 4p 447 T30 4p moonfire ticks -8921 20731346 69104 359.13 8081 16722 3.0 1795.7 40.1% 0.0% 0.0% 0.0% 1.08sec 20793354 300.83sec
447 T30 4p 447 T30 4p moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
447 T30 4p 447 T30 4p natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.42sec 0 300.83sec
447 T30 4p 447 T30 4p overwhelming_rage ticks -374037 610493 2035 3.97 30771 0 4.1 19.8 0.0% 0.0% 0.0% 0.0% 58.75sec 674323 300.83sec
447 T30 4p 447 T30 4p potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 306.70sec 0 300.83sec
447 T30 4p 447 T30 4p shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.83sec
447 T30 4p 447 T30 4p shooting_stars_moonfire 202497 4110564 13664 36.43 14288 30669 183.1 182.6 50.2% 0.0% 0.0% 0.0% 1.83sec 4110564 300.83sec
447 T30 4p 447 T30 4p shooting_stars_sunfire 202497 4139677 13761 36.79 14246 30594 184.9 184.5 50.1% 0.0% 0.0% 0.0% 1.83sec 4139677 300.83sec
447 T30 4p 447 T30 4p orbit_breaker 274283 8724528 29002 18.30 60561 129744 15.3 91.8 49.9% 0.0% 0.0% 0.0% 19.84sec 8724528 300.83sec
447 T30 4p 447 T30 4p crashing_star 408310 7680129 25530 18.30 53310 114254 92.0 91.8 49.9% 0.0% 0.0% 0.0% 3.33sec 7680129 300.83sec
447 T30 4p 447 T30 4p starfall 191034 66705845 221742 353.91 24978 53967 105.1 1774.4 43.5% 0.0% 0.0% 0.0% 2.84sec 66705845 300.83sec
447 T30 4p 447 T30 4p starfire 194153 38886842 129267 129.01 38723 80673 106.8 646.8 51.0% 0.0% 0.0% 0.0% 2.76sec 38886842 300.83sec
447 T30 4p 447 T30 4p sunfire 93402 6954 23 0.20 5415 11043 1.0 1.0 27.3% 0.0% 0.0% 0.0% 0.00sec 17734289 300.83sec
447 T30 4p 447 T30 4p sunfire ticks -93402 17727336 59091 361.73 6956 14762 1.0 1808.7 36.5% 0.0% 0.0% 0.0% 0.00sec 17734289 300.83sec
447 T30 4p 447 T30 4p tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.3 0.0 0.0% 0.0% 0.0% 0.0% 33.39sec 0 300.83sec
447 T30 4p 447 T30 4p denizen_of_the_flame 426486 826839 2749 9.91 12999 26496 8.3 49.7 26.9% 0.0% 0.0% 0.0% 33.39sec 826839 300.83sec
447 T30 4p 447 T30 4p denizen_of_the_flame_secondary 426431 756337 2514 19.07 6183 12603 15.9 95.6 26.9% 0.0% 0.0% 0.0% 16.33sec 756337 300.83sec
447 T30 4p 447 T30 4p wrath 190984 618104 2055 5.23 16819 34180 26.4 26.2 39.0% 0.0% 0.0% 0.0% 10.43sec 618104 300.83sec
447+460 2p+2p 447+460 2p+2p astral_smolder ticks -394061 29160996 97203 146.45 39822 0 370.4 732.2 0.0% 0.0% 0.0% 0.0% 0.87sec 29160996 300.00sec
447+460 2p+2p 447+460 2p+2p augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
447+460 2p+2p 447+460 2p+2p flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
447+460 2p+2p 447+460 2p+2p food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
447+460 2p+2p 447+460 2p+2p fury_of_elune 202770 5971524 19905 150.66 4980 10827 5.1 753.3 50.4% 0.0% 0.0% 0.0% 64.37sec 5971524 300.00sec
447+460 2p+2p 447+460 2p+2p hungering_shadowflame 424324 864717 2882 3.38 40158 80776 16.9 16.9 27.0% 0.0% 0.0% 0.0% 17.49sec 864717 300.00sec
447+460 2p+2p 447+460 2p+2p hungering_shadowflame_self 424324 508577 1695 3.38 23509 47955 16.9 16.9 26.9% 0.0% 0.0% 0.0% 17.49sec 562060 300.00sec
447+460 2p+2p 447+460 2p+2p incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.08sec 0 300.00sec
447+460 2p+2p 447+460 2p+2p launched_thorns 379403 1662403 5541 6.72 38614 78737 33.7 33.6 27.0% 0.0% 0.0% 0.0% 8.58sec 1662403 300.00sec
447+460 2p+2p 447+460 2p+2p launched_thorns_heal 379407 0 0 0.00 0 0 0.2 0.0 0.0% 0.0% 0.0% 0.0% 98.50sec 0 300.00sec
447+460 2p+2p 447+460 2p+2p moonfire 8921 62869 210 1.20 6973 14218 3.0 6.0 48.4% 0.0% 0.0% 0.0% 1.11sec 21214783 300.00sec
447+460 2p+2p 447+460 2p+2p moonfire ticks -8921 21151914 70506 358.71 8233 17049 3.0 1793.6 40.4% 0.0% 0.0% 0.0% 1.11sec 21214783 300.00sec
447+460 2p+2p 447+460 2p+2p moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
447+460 2p+2p 447+460 2p+2p natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.47sec 0 300.00sec
447+460 2p+2p 447+460 2p+2p overwhelming_rage ticks -374037 610048 2033 3.87 31547 0 4.0 19.3 0.0% 0.0% 0.0% 0.0% 66.29sec 673830 300.00sec
447+460 2p+2p 447+460 2p+2p potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 304.53sec 0 300.00sec
447+460 2p+2p 447+460 2p+2p shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
447+460 2p+2p 447+460 2p+2p shooting_stars_moonfire 202497 5268081 17560 46.12 14503 31184 231.2 230.6 50.0% 0.0% 0.0% 0.0% 1.50sec 5268081 300.00sec
447+460 2p+2p 447+460 2p+2p shooting_stars_sunfire 202497 5308856 17696 46.58 14466 31095 233.5 232.9 50.1% 0.0% 0.0% 0.0% 1.49sec 5308856 300.00sec
447+460 2p+2p 447+460 2p+2p orbit_breaker 274283 8966207 29887 18.52 61392 132389 15.5 92.6 49.9% 0.0% 0.0% 0.0% 19.55sec 8966207 300.00sec
447+460 2p+2p 447+460 2p+2p starfall 191034 66838386 222794 353.80 24991 54230 103.1 1769.0 43.8% 0.0% 0.0% 0.0% 2.89sec 66838386 300.00sec
447+460 2p+2p 447+460 2p+2p starfire 194153 48015063 160050 140.67 42710 92590 116.2 703.4 51.2% 0.0% 0.0% 0.0% 2.54sec 48015063 300.00sec
447+460 2p+2p 447+460 2p+2p sunfire 93402 6967 23 0.20 5492 11202 1.0 1.0 25.8% 0.0% 0.0% 0.0% 0.00sec 18022102 300.00sec
447+460 2p+2p 447+460 2p+2p sunfire ticks -93402 18015135 60050 361.28 7058 15025 1.0 1806.4 36.6% 0.0% 0.0% 0.0% 0.00sec 18022102 300.00sec
447+460 2p+2p 447+460 2p+2p tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.3 0.0 0.0% 0.0% 0.0% 0.0% 32.88sec 0 300.00sec
447+460 2p+2p 447+460 2p+2p denizen_of_the_flame 426486 828052 2760 9.91 13007 26503 8.3 49.5 27.5% 0.0% 0.0% 0.0% 32.88sec 828052 300.00sec
447+460 2p+2p 447+460 2p+2p denizen_of_the_flame_secondary 426431 756658 2522 19.08 6187 12612 15.9 95.4 27.2% 0.0% 0.0% 0.0% 15.99sec 756658 300.00sec
447+460 2p+2p 447+460 2p+2p wrath 190984 1027359 3425 5.16 28313 57919 25.9 25.8 39.0% 0.0% 0.0% 0.0% 10.58sec 1027359 300.00sec
447+470 2p+2p 447+470 2p+2p astral_smolder ticks -394061 29584415 98615 146.73 40327 0 371.6 733.6 0.0% 0.0% 0.0% 0.0% 0.87sec 29584415 300.24sec
447+470 2p+2p 447+470 2p+2p augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.24sec
447+470 2p+2p 447+470 2p+2p flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.24sec
447+470 2p+2p 447+470 2p+2p food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.24sec
447+470 2p+2p 447+470 2p+2p fury_of_elune 202770 6076532 20239 150.71 5052 10963 5.1 754.1 50.9% 0.0% 0.0% 0.0% 64.61sec 6076532 300.24sec
447+470 2p+2p 447+470 2p+2p hungering_shadowflame 424324 863137 2875 3.36 40001 82350 16.8 16.8 26.8% 0.0% 0.0% 0.0% 17.79sec 863137 300.24sec
447+470 2p+2p 447+470 2p+2p hungering_shadowflame_self 424324 507350 1690 3.36 23505 47944 16.8 16.8 27.3% 0.0% 0.0% 0.0% 17.79sec 560545 300.24sec
447+470 2p+2p 447+470 2p+2p incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.01sec 0 300.24sec
447+470 2p+2p 447+470 2p+2p launched_thorns 379403 1661911 5535 6.70 38603 78681 33.6 33.5 27.3% 0.0% 0.0% 0.0% 8.71sec 1661911 300.24sec
447+470 2p+2p 447+470 2p+2p launched_thorns_heal 379407 0 0 0.00 0 0 0.2 0.0 0.0% 0.0% 0.0% 0.0% 103.00sec 0 300.24sec
447+470 2p+2p 447+470 2p+2p moonfire 8921 63609 212 1.20 7062 14400 3.0 6.0 48.2% 0.0% 0.0% 0.0% 1.06sec 21517087 300.24sec
447+470 2p+2p 447+470 2p+2p moonfire ticks -8921 21453477 71512 359.46 8328 17240 3.0 1797.3 40.5% 0.0% 0.0% 0.0% 1.06sec 21517087 300.24sec
447+470 2p+2p 447+470 2p+2p moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.24sec
447+470 2p+2p 447+470 2p+2p natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.41sec 0 300.24sec
447+470 2p+2p 447+470 2p+2p overwhelming_rage ticks -374037 643465 2145 3.99 32229 0 4.1 20.0 0.0% 0.0% 0.0% 0.0% 59.02sec 710710 300.24sec
447+470 2p+2p 447+470 2p+2p potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 305.56sec 0 300.24sec
447+470 2p+2p 447+470 2p+2p shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.24sec
447+470 2p+2p 447+470 2p+2p shooting_stars_moonfire 202497 5356749 17841 46.22 14682 31560 231.9 231.3 50.2% 0.0% 0.0% 0.0% 1.49sec 5356749 300.24sec
447+470 2p+2p 447+470 2p+2p shooting_stars_sunfire 202497 5385995 17939 46.61 14645 31476 233.8 233.2 50.2% 0.0% 0.0% 0.0% 1.48sec 5385995 300.24sec
447+470 2p+2p 447+470 2p+2p orbit_breaker 274283 9067756 30202 18.55 62145 133526 15.5 92.8 49.8% 0.0% 0.0% 0.0% 19.46sec 9067756 300.24sec
447+470 2p+2p 447+470 2p+2p starfall 191034 67850483 225986 353.82 25339 54913 103.3 1770.5 43.9% 0.0% 0.0% 0.0% 2.88sec 67850483 300.24sec
447+470 2p+2p 447+470 2p+2p starfire 194153 48693075 162180 140.85 43204 93658 116.5 704.8 51.3% 0.0% 0.0% 0.0% 2.54sec 48693075 300.24sec
447+470 2p+2p 447+470 2p+2p sunfire 93402 7189 24 0.20 5558 11337 1.0 1.0 28.2% 0.0% 0.0% 0.0% 0.00sec 18286251 300.24sec
447+470 2p+2p 447+470 2p+2p sunfire ticks -93402 18279062 60930 362.04 7138 15195 1.0 1810.2 36.7% 0.0% 0.0% 0.0% 0.00sec 18286251 300.24sec
447+470 2p+2p 447+470 2p+2p tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.3 0.0 0.0% 0.0% 0.0% 0.0% 32.36sec 0 300.24sec
447+470 2p+2p 447+470 2p+2p denizen_of_the_flame 426486 827386 2756 9.92 12992 26495 8.3 49.6 27.2% 0.0% 0.0% 0.0% 32.36sec 827386 300.24sec
447+470 2p+2p 447+470 2p+2p denizen_of_the_flame_secondary 426431 756324 2519 19.06 6183 12603 15.9 95.4 27.2% 0.0% 0.0% 0.0% 15.59sec 756324 300.24sec
447+470 2p+2p 447+470 2p+2p wrath 190984 1042749 3473 5.16 28666 58555 26.0 25.8 39.2% 0.0% 0.0% 0.0% 10.56sec 1042749 300.24sec
460 T31 2p 460 T31 2p astral_smolder ticks -394061 29771975 99240 146.36 40682 0 370.6 731.8 0.0% 0.0% 0.0% 0.0% 0.87sec 29771975 299.63sec
460 T31 2p 460 T31 2p augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
460 T31 2p 460 T31 2p flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
460 T31 2p 460 T31 2p food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
460 T31 2p 460 T31 2p fury_of_elune 202770 6135643 20477 151.14 5106 11062 5.1 754.8 50.8% 0.0% 0.0% 0.0% 64.51sec 6135643 299.63sec
460 T31 2p 460 T31 2p hungering_shadowflame 424324 877135 2927 3.41 40111 81918 17.0 17.0 27.4% 0.0% 0.0% 0.0% 17.18sec 877135 299.63sec
460 T31 2p 460 T31 2p hungering_shadowflame_self 424324 513490 1714 3.41 23516 47955 17.0 17.0 27.3% 0.0% 0.0% 0.0% 17.18sec 567600 299.63sec
460 T31 2p 460 T31 2p incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.02sec 0 299.63sec
460 T31 2p 460 T31 2p launched_thorns 379403 1673288 5584 6.76 38642 78773 33.8 33.7 27.3% 0.0% 0.0% 0.0% 8.91sec 1673288 299.63sec
460 T31 2p 460 T31 2p launched_thorns_heal 379407 0 0 0.00 0 0 0.2 0.0 0.0% 0.0% 0.0% 0.0% 18.00sec 0 299.63sec
460 T31 2p 460 T31 2p moonfire 8921 53543 179 1.20 5935 12102 3.0 6.0 48.5% 0.0% 0.0% 0.0% 1.08sec 18069692 299.63sec
460 T31 2p 460 T31 2p moonfire ticks -8921 18016149 60054 359.00 7005 14499 3.0 1795.0 40.5% 0.0% 0.0% 0.0% 1.08sec 18069692 299.63sec
460 T31 2p 460 T31 2p moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
460 T31 2p 460 T31 2p natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.43sec 0 299.63sec
460 T31 2p 460 T31 2p overwhelming_rage ticks -374037 639315 2131 3.92 32624 0 4.0 19.6 0.0% 0.0% 0.0% 0.0% 58.02sec 706580 299.63sec
460 T31 2p 460 T31 2p potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 306.68sec 0 299.63sec
460 T31 2p 460 T31 2p shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
460 T31 2p 460 T31 2p shooting_stars_moonfire 202497 4509828 15051 46.28 12375 26572 231.7 231.1 50.3% 0.0% 0.0% 0.0% 1.48sec 4509828 299.63sec
460 T31 2p 460 T31 2p shooting_stars_sunfire 202497 4532401 15127 46.70 12342 26514 233.8 233.2 50.1% 0.0% 0.0% 0.0% 1.49sec 4532401 299.63sec
460 T31 2p 460 T31 2p orbit_breaker 274283 9169849 30604 18.59 62928 135103 15.5 92.8 49.7% 0.0% 0.0% 0.0% 19.51sec 9169849 299.63sec
460 T31 2p 460 T31 2p starfall 191034 68449878 228446 353.82 25664 55509 103.2 1766.9 43.8% 0.0% 0.0% 0.0% 2.87sec 68449878 299.63sec
460 T31 2p 460 T31 2p starfire 194153 49038921 163663 140.90 43618 94511 116.3 703.6 51.2% 0.0% 0.0% 0.0% 2.54sec 49038921 299.63sec
460 T31 2p 460 T31 2p sunfire 93402 5968 20 0.20 4676 9536 1.0 1.0 26.6% 0.0% 0.0% 0.0% 0.00sec 15350081 299.63sec
460 T31 2p 460 T31 2p sunfire ticks -93402 15344113 51147 361.58 6006 12774 1.0 1807.9 36.7% 0.0% 0.0% 0.0% 0.00sec 15350081 299.63sec
460 T31 2p 460 T31 2p tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.4 0.0 0.0% 0.0% 0.0% 0.0% 33.89sec 0 299.63sec
460 T31 2p 460 T31 2p denizen_of_the_flame 426486 838552 2799 10.05 13014 26530 8.4 50.2 27.4% 0.0% 0.0% 0.0% 33.89sec 838552 299.63sec
460 T31 2p 460 T31 2p denizen_of_the_flame_secondary 426431 765363 2554 19.32 6192 12622 16.1 96.5 27.1% 0.0% 0.0% 0.0% 16.48sec 765363 299.63sec
460 T31 2p 460 T31 2p wrath 190984 1052723 3513 5.17 28996 59136 26.0 25.8 39.1% 0.0% 0.0% 0.0% 10.53sec 1052723 299.63sec
460 T31 4p 460 T31 4p astral_smolder ticks -394061 33774792 112583 146.82 46011 0 371.2 734.1 0.0% 0.0% 0.0% 0.0% 0.87sec 33774792 300.88sec
460 T31 4p 460 T31 4p augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.88sec
460 T31 4p 460 T31 4p flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.88sec
460 T31 4p 460 T31 4p food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.88sec
460 T31 4p 460 T31 4p fury_of_elune 202770 6686043 22222 150.36 5614 12037 5.1 754.0 50.7% 0.0% 0.0% 0.0% 64.63sec 6686043 300.88sec
460 T31 4p 460 T31 4p hungering_shadowflame 424324 869235 2889 3.37 40031 82488 16.9 16.9 26.9% 0.0% 0.0% 0.0% 16.54sec 869235 300.88sec
460 T31 4p 460 T31 4p hungering_shadowflame_self 424324 510639 1697 3.37 23514 47960 16.9 16.9 27.5% 0.0% 0.0% 0.0% 16.54sec 564474 300.88sec
460 T31 4p 460 T31 4p incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.15sec 0 300.88sec
460 T31 4p 460 T31 4p launched_thorns 379403 1663185 5528 6.70 38618 78732 33.7 33.6 27.1% 0.0% 0.0% 0.0% 8.78sec 1663185 300.88sec
460 T31 4p 460 T31 4p launched_thorns_heal 379407 0 0 0.00 0 0 0.2 0.0 0.0% 0.0% 0.0% 0.0% 90.00sec 0 300.88sec
460 T31 4p 460 T31 4p moonfire 8921 52918 176 1.20 5898 12020 3.0 6.0 47.7% 0.0% 0.0% 0.0% 1.10sec 18953285 300.88sec
460 T31 4p 460 T31 4p moonfire ticks -8921 18900368 63001 360.09 7331 15159 3.0 1800.4 40.5% 0.0% 0.0% 0.0% 1.10sec 18953285 300.88sec
460 T31 4p 460 T31 4p moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.88sec
460 T31 4p 460 T31 4p natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.41sec 0 300.88sec
460 T31 4p 460 T31 4p overwhelming_rage ticks -374037 630806 2103 3.93 32127 0 4.1 19.6 0.0% 0.0% 0.0% 0.0% 62.21sec 696852 300.88sec
460 T31 4p 460 T31 4p potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 304.85sec 0 300.88sec
460 T31 4p 460 T31 4p shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.88sec
460 T31 4p 460 T31 4p shooting_stars_moonfire 202497 4847755 16112 46.18 13249 28542 232.2 231.6 50.2% 0.0% 0.0% 0.0% 1.49sec 4847755 300.88sec
460 T31 4p 460 T31 4p shooting_stars_sunfire 202497 4872255 16194 46.58 13210 28460 234.2 233.6 50.2% 0.0% 0.0% 0.0% 1.49sec 4872255 300.88sec
460 T31 4p 460 T31 4p orbit_breaker 274283 9871557 32809 18.54 67354 145464 15.5 92.9 49.7% 0.0% 0.0% 0.0% 19.55sec 9871557 300.88sec
460 T31 4p 460 T31 4p starfall 191034 75065522 249490 353.82 27981 60659 103.5 1774.2 43.9% 0.0% 0.0% 0.0% 2.88sec 75065522 300.88sec
460 T31 4p 460 T31 4p starfire 194153 51170112 170071 140.81 45496 98236 116.7 706.1 51.1% 0.0% 0.0% 0.0% 2.54sec 51170112 300.88sec
460 T31 4p 460 T31 4p sunfire 93402 5947 20 0.20 4630 9442 1.0 1.0 27.4% 0.0% 0.0% 0.0% 0.00sec 15848782 300.88sec
460 T31 4p 460 T31 4p sunfire ticks -93402 15842835 52809 362.66 6161 13194 1.0 1813.3 36.6% 0.0% 0.0% 0.0% 0.00sec 15848782 300.88sec
460 T31 4p 460 T31 4p tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.4 0.0 0.0% 0.0% 0.0% 0.0% 33.38sec 0 300.88sec
460 T31 4p 460 T31 4p denizen_of_the_flame 426486 837260 2783 10.03 13003 26502 8.4 50.3 27.0% 0.0% 0.0% 0.0% 33.38sec 837260 300.88sec
460 T31 4p 460 T31 4p denizen_of_the_flame_secondary 426431 766315 2547 19.28 6186 12611 16.1 96.7 27.1% 0.0% 0.0% 0.0% 16.09sec 766315 300.88sec
460 T31 4p 460 T31 4p wrath 190984 1042350 3464 5.16 28704 58464 26.0 25.9 38.8% 0.0% 0.0% 0.0% 10.57sec 1042350 300.88sec
470 T31 2p 470 T31 2p astral_smolder ticks -394061 30272129 100907 146.89 41215 0 372.8 734.5 0.0% 0.0% 0.0% 0.0% 0.86sec 30272129 300.21sec
470 T31 2p 470 T31 2p augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.21sec
470 T31 2p 470 T31 2p flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.21sec
470 T31 2p 470 T31 2p food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.21sec
470 T31 2p 470 T31 2p fury_of_elune 202770 6234883 20768 150.98 5171 11210 5.1 755.4 51.1% 0.0% 0.0% 0.0% 64.83sec 6234883 300.21sec
470 T31 2p 470 T31 2p hungering_shadowflame 424324 869942 2898 3.38 39936 82578 16.9 16.9 27.1% 0.0% 0.0% 0.0% 16.87sec 869942 300.21sec
470 T31 2p 470 T31 2p hungering_shadowflame_self 424324 510809 1701 3.38 23516 47955 16.9 16.9 27.5% 0.0% 0.0% 0.0% 16.87sec 564639 300.21sec
470 T31 2p 470 T31 2p incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.99sec 0 300.21sec
470 T31 2p 470 T31 2p launched_thorns 379403 1670343 5564 6.73 38627 78717 33.7 33.7 27.4% 0.0% 0.0% 0.0% 8.88sec 1670343 300.21sec
470 T31 2p 470 T31 2p launched_thorns_heal 379407 0 0 0.00 0 0 0.2 0.0 0.0% 0.0% 0.0% 0.0% 182.00sec 0 300.21sec
470 T31 2p 470 T31 2p moonfire 8921 54407 181 1.20 6010 12248 3.0 6.0 49.0% 0.0% 0.0% 0.0% 1.06sec 18336359 300.21sec
470 T31 2p 470 T31 2p moonfire ticks -8921 18281953 60940 359.98 7083 14658 3.0 1799.9 40.6% 0.0% 0.0% 0.0% 1.06sec 18336359 300.21sec
470 T31 2p 470 T31 2p moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.21sec
470 T31 2p 470 T31 2p natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.38sec 0 300.21sec
470 T31 2p 470 T31 2p overwhelming_rage ticks -374037 656930 2190 3.94 33313 0 4.1 19.7 0.0% 0.0% 0.0% 0.0% 55.95sec 725900 300.21sec
470 T31 2p 470 T31 2p potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 307.29sec 0 300.21sec
470 T31 2p 470 T31 2p shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.21sec
470 T31 2p 470 T31 2p shooting_stars_moonfire 202497 4590417 15291 46.48 12524 26894 233.2 232.5 50.2% 0.0% 0.0% 0.0% 1.49sec 4590417 300.21sec
470 T31 2p 470 T31 2p shooting_stars_sunfire 202497 4598746 15318 46.72 12483 26807 234.4 233.7 50.2% 0.0% 0.0% 0.0% 1.48sec 4598746 300.21sec
470 T31 2p 470 T31 2p orbit_breaker 274283 9324736 31061 18.63 63638 136616 15.6 93.2 49.9% 0.0% 0.0% 0.0% 19.48sec 9324736 300.21sec
470 T31 2p 470 T31 2p starfall 191034 69547924 231663 353.85 25973 56241 103.5 1770.5 44.0% 0.0% 0.0% 0.0% 2.88sec 69547924 300.21sec
470 T31 2p 470 T31 2p starfire 194153 49764784 165766 141.01 44102 95508 116.6 705.6 51.4% 0.0% 0.0% 0.0% 2.54sec 49764784 300.21sec
470 T31 2p 470 T31 2p sunfire 93402 6155 21 0.20 4729 9646 1.0 1.0 29.0% 0.0% 0.0% 0.0% 0.00sec 15578582 300.21sec
470 T31 2p 470 T31 2p sunfire ticks -93402 15572427 51908 362.56 6071 12913 1.0 1812.8 36.8% 0.0% 0.0% 0.0% 0.00sec 15578582 300.21sec
470 T31 2p 470 T31 2p tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.3 0.0 0.0% 0.0% 0.0% 0.0% 32.52sec 0 300.21sec
470 T31 2p 470 T31 2p denizen_of_the_flame 426486 837095 2788 10.00 13008 26515 8.3 50.0 27.6% 0.0% 0.0% 0.0% 32.52sec 837095 300.21sec
470 T31 2p 470 T31 2p denizen_of_the_flame_secondary 426431 763143 2542 19.23 6188 12614 16.0 96.2 27.1% 0.0% 0.0% 0.0% 15.90sec 763143 300.21sec
470 T31 2p 470 T31 2p wrath 190984 1072826 3574 5.18 29294 60099 26.1 25.9 39.3% 0.0% 0.0% 0.0% 10.51sec 1072826 300.21sec
470 T31 4p 470 T31 4p astral_smolder ticks -394061 34590032 115300 146.92 47092 0 372.7 734.6 0.0% 0.0% 0.0% 0.0% 0.86sec 34590032 300.52sec
470 T31 4p 470 T31 4p augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.52sec
470 T31 4p 470 T31 4p flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.52sec
470 T31 4p 470 T31 4p food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.52sec
470 T31 4p 470 T31 4p fury_of_elune 202770 6861608 22833 150.77 5746 12297 5.1 755.1 51.0% 0.0% 0.0% 0.0% 64.82sec 6861608 300.52sec
470 T31 4p 470 T31 4p hungering_shadowflame 424324 872976 2905 3.35 40449 82238 16.8 16.8 27.4% 0.0% 0.0% 0.0% 16.96sec 872976 300.52sec
470 T31 4p 470 T31 4p hungering_shadowflame_self 424324 506164 1684 3.35 23519 47961 16.8 16.8 27.1% 0.0% 0.0% 0.0% 16.96sec 559605 300.52sec
470 T31 4p 470 T31 4p incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.97sec 0 300.52sec
470 T31 4p 470 T31 4p launched_thorns 379403 1677542 5582 6.74 38637 78764 33.8 33.8 27.5% 0.0% 0.0% 0.0% 8.59sec 1677542 300.52sec
470 T31 4p 470 T31 4p launched_thorns_heal 379407 0 0 0.00 0 0 0.2 0.0 0.0% 0.0% 0.0% 0.0% 41.00sec 0 300.52sec
470 T31 4p 470 T31 4p moonfire 8921 54208 180 1.20 6032 12297 3.0 6.0 47.9% 0.0% 0.0% 0.0% 1.09sec 19386186 300.52sec
470 T31 4p 470 T31 4p moonfire ticks -8921 19331978 64440 360.39 7485 15473 3.0 1802.0 40.6% 0.0% 0.0% 0.0% 1.09sec 19386186 300.52sec
470 T31 4p 470 T31 4p moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.52sec
470 T31 4p 470 T31 4p natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.42sec 0 300.52sec
470 T31 4p 470 T31 4p overwhelming_rage ticks -374037 658729 2196 3.96 33311 0 4.1 19.8 0.0% 0.0% 0.0% 0.0% 59.32sec 727929 300.52sec
470 T31 4p 470 T31 4p potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 306.00sec 0 300.52sec
470 T31 4p 470 T31 4p shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.52sec
470 T31 4p 470 T31 4p shooting_stars_moonfire 202497 4974786 16554 46.35 13551 29192 232.8 232.2 50.4% 0.0% 0.0% 0.0% 1.48sec 4974786 300.52sec
470 T31 4p 470 T31 4p shooting_stars_sunfire 202497 4988208 16599 46.65 13511 29102 234.2 233.6 50.3% 0.0% 0.0% 0.0% 1.49sec 4988208 300.52sec
470 T31 4p 470 T31 4p orbit_breaker 274283 10101382 33613 18.60 68816 148675 15.6 93.1 49.6% 0.0% 0.0% 0.0% 19.51sec 10101382 300.52sec
470 T31 4p 470 T31 4p starfall 191034 76892968 255869 353.83 28700 62109 103.5 1772.2 44.0% 0.0% 0.0% 0.0% 2.88sec 76892968 300.52sec
470 T31 4p 470 T31 4p starfire 194153 52303577 174045 141.07 46418 100239 116.8 706.6 51.3% 0.0% 0.0% 0.0% 2.54sec 52303577 300.52sec
470 T31 4p 470 T31 4p sunfire 93402 5990 20 0.20 4729 9653 1.0 1.0 25.6% 0.0% 0.0% 0.0% 0.00sec 16209559 300.52sec
470 T31 4p 470 T31 4p sunfire ticks -93402 16203569 54012 362.96 6292 13466 1.0 1814.8 36.8% 0.0% 0.0% 0.0% 0.00sec 16209559 300.52sec
470 T31 4p 470 T31 4p tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.4 0.0 0.0% 0.0% 0.0% 0.0% 30.78sec 0 300.52sec
470 T31 4p 470 T31 4p denizen_of_the_flame 426486 846551 2817 10.12 13011 26518 8.4 50.7 27.3% 0.0% 0.0% 0.0% 30.78sec 846551 300.52sec
470 T31 4p 470 T31 4p denizen_of_the_flame_secondary 426431 773362 2573 19.43 6191 12619 16.2 97.3 27.3% 0.0% 0.0% 0.0% 15.07sec 773362 300.52sec
470 T31 4p 470 T31 4p wrath 190984 1072207 3568 5.18 29334 59832 26.1 26.0 39.3% 0.0% 0.0% 0.0% 10.42sec 1072207 300.52sec

Fluffy_Pillow : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
123386.5 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Waning Twilight 1.0 0.0 1.2s 0.0s 298.7s 99.29% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 8.3s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:232.2s / 359.0s
  • uptime_min/max:91.92% / 99.74%

Stack Uptimes

  • waning_twilight_1:99.29%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 1.6s 0.0s 298.3s 99.35% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 6.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:227.1s / 359.0s
  • uptime_min/max:92.95% / 99.74%

Stack Uptimes

  • waning_twilight_1:99.35%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 2.0s 0.0s 298.0s 99.34% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 12.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:231.5s / 358.9s
  • uptime_min/max:93.43% / 99.74%

Stack Uptimes

  • waning_twilight_1:99.34%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 1.7s 0.0s 297.7s 99.34% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 8.7s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:231.7s / 359.0s
  • uptime_min/max:94.35% / 99.74%

Stack Uptimes

  • waning_twilight_1:99.34%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 1.3s 0.0s 298.3s 99.37% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 9.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:230.8s / 359.0s
  • uptime_min/max:94.33% / 99.74%

Stack Uptimes

  • waning_twilight_1:99.37%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 1.6s 0.0s 299.0s 99.37% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 8.7s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:229.5s / 359.0s
  • uptime_min/max:94.52% / 99.74%

Stack Uptimes

  • waning_twilight_1:99.37%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 1.9s 0.0s 298.6s 99.35% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 11.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:222.0s / 359.1s
  • uptime_min/max:91.00% / 99.74%

Stack Uptimes

  • waning_twilight_1:99.35%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 15038
Mean 300.33
Minimum 240.00
Maximum 359.99
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 19.98%
Standard Deviation 34.5421
5th Percentile 246.06
95th Percentile 353.97
( 95th Percentile - 5th Percentile ) 107.90
Mean Distribution
Standard Deviation 0.2817
95.00% Confidence Interval ( 299.78 - 300.88 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 509
0.1% Error 50815
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1019
DPS
Fluffy_Pillow Damage Per Second
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 15038
Mean 131989.40
Minimum 109782.18
Maximum 155943.75
Spread ( max - min ) 46161.56
Range [ ( max - min ) / 2 * 100% ] 17.49%
Standard Deviation 7084.0334
5th Percentile 120210.01
95th Percentile 143924.42
( 95th Percentile - 5th Percentile ) 23714.42
Mean Distribution
Standard Deviation 57.7678
95.00% Confidence Interval ( 131876.17 - 132102.62 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 111
0.1% Error 11066
0.1 Scale Factor Error with Delta=300 428396
0.05 Scale Factor Error with Delta=300 1713582
0.01 Scale Factor Error with Delta=300 42839547
HPS
Fluffy_Pillow Healing Per Second
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 722
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 40366195 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy2 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
110843.3 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Waning Twilight 1.0 0.0 2.9s 0.0s 296.2s 98.46% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 8.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:228.0s / 359.0s
  • uptime_min/max:90.62% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.46%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.4s 0.0s 296.2s 98.64% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 14.8s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:230.7s / 358.0s
  • uptime_min/max:91.20% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.64%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.0s 0.0s 296.1s 98.68% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 14.1s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:221.9s / 358.8s
  • uptime_min/max:90.56% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.68%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.2s 0.0s 295.6s 98.63% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 10.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:228.3s / 358.8s
  • uptime_min/max:92.37% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.63%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.5s 0.0s 296.3s 98.69% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 15.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:223.9s / 358.6s
  • uptime_min/max:90.93% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.69%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 3.7s 0.0s 297.1s 98.72% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 11.5s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:226.5s / 359.0s
  • uptime_min/max:92.01% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.72%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 5.3s 0.0s 296.5s 98.66% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 28.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:227.5s / 358.6s
  • uptime_min/max:89.32% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.66%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy2 Fight Length
Count 15038
Mean 300.33
Minimum 240.00
Maximum 359.99
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 19.98%
Standard Deviation 34.5421
5th Percentile 246.06
95th Percentile 353.97
( 95th Percentile - 5th Percentile ) 107.90
Mean Distribution
Standard Deviation 0.2817
95.00% Confidence Interval ( 299.78 - 300.88 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 509
0.1% Error 50815
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1019
DPS
enemy2 Damage Per Second
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy2 Priority Target Damage Per Second
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy2 Damage Per Second (Effective)
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy2 Damage
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy2 Damage Taken Per Second
Count 15038
Mean 118554.41
Minimum 100850.27
Maximum 147460.47
Spread ( max - min ) 46610.21
Range [ ( max - min ) / 2 * 100% ] 19.66%
Standard Deviation 6188.6807
5th Percentile 109094.59
95th Percentile 129489.03
( 95th Percentile - 5th Percentile ) 20394.44
Mean Distribution
Standard Deviation 50.4665
95.00% Confidence Interval ( 118455.50 - 118653.33 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 105
0.1% Error 10468
0.1 Scale Factor Error with Delta=300 326949
0.05 Scale Factor Error with Delta=300 1307796
0.01 Scale Factor Error with Delta=300 32694886
HPS
enemy2 Healing Per Second
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy2 Healing Per Second (Effective)
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy2 Heal
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy2 Healing Taken Per Second
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy2 Theck-Meloree Index
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy2Theck-Meloree Index (Effective)
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy2 Max Spike Value
Count 722
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 43501059 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="enemy2"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy3 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
110917.1 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Waning Twilight 1.0 0.0 6.5s 0.0s 295.9s 98.37% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 26.1s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:228.0s / 358.9s
  • uptime_min/max:92.85% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.37%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.9s 0.0s 296.0s 98.57% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 8.7s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:225.8s / 358.8s
  • uptime_min/max:92.67% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.57%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.0s 0.0s 295.8s 98.56% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 11.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:230.7s / 358.9s
  • uptime_min/max:91.20% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.56%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.6s 0.0s 295.4s 98.57% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 14.1s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:227.6s / 358.6s
  • uptime_min/max:91.37% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.57%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 3.5s 0.0s 296.0s 98.59% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 12.7s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:223.6s / 358.9s
  • uptime_min/max:91.33% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.59%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.9s 0.0s 296.6s 98.55% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 10.6s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:227.6s / 358.7s
  • uptime_min/max:92.59% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.55%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.2s 0.0s 296.2s 98.56% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 26.1s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:230.8s / 358.5s
  • uptime_min/max:89.88% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.56%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy3 Fight Length
Count 15038
Mean 300.33
Minimum 240.00
Maximum 359.99
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 19.98%
Standard Deviation 34.5421
5th Percentile 246.06
95th Percentile 353.97
( 95th Percentile - 5th Percentile ) 107.90
Mean Distribution
Standard Deviation 0.2817
95.00% Confidence Interval ( 299.78 - 300.88 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 509
0.1% Error 50815
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1019
DPS
enemy3 Damage Per Second
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy3 Priority Target Damage Per Second
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy3 Damage Per Second (Effective)
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy3 Damage
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy3 Damage Taken Per Second
Count 15038
Mean 118371.03
Minimum 100147.82
Maximum 141742.61
Spread ( max - min ) 41594.80
Range [ ( max - min ) / 2 * 100% ] 17.57%
Standard Deviation 6169.9544
5th Percentile 108930.19
95th Percentile 129148.32
( 95th Percentile - 5th Percentile ) 20218.13
Mean Distribution
Standard Deviation 50.3138
95.00% Confidence Interval ( 118272.42 - 118469.64 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 105
0.1% Error 10437
0.1 Scale Factor Error with Delta=300 324974
0.05 Scale Factor Error with Delta=300 1299893
0.01 Scale Factor Error with Delta=300 32497322
HPS
enemy3 Healing Per Second
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy3 Healing Per Second (Effective)
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy3 Heal
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy3 Healing Taken Per Second
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy3 Theck-Meloree Index
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy3Theck-Meloree Index (Effective)
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy3 Max Spike Value
Count 722
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 36546889 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="enemy3"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy4 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
110774.7 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Waning Twilight 1.0 0.0 5.6s 0.0s 296.0s 98.38% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 16.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:224.7s / 358.9s
  • uptime_min/max:92.17% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.38%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.0s 0.0s 296.0s 98.57% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 9.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:228.6s / 359.0s
  • uptime_min/max:91.59% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.57%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.1s 0.0s 295.8s 98.57% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 14.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:227.0s / 358.4s
  • uptime_min/max:93.01% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.57%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 3.4s 0.0s 295.3s 98.54% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 10.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:230.0s / 358.1s
  • uptime_min/max:92.23% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.54%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.4s 0.0s 295.9s 98.54% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 10.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:226.0s / 359.0s
  • uptime_min/max:91.88% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.54%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.2s 0.0s 296.6s 98.56% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 8.7s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:225.7s / 359.0s
  • uptime_min/max:91.57% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.56%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.4s 0.0s 296.2s 98.55% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 9.5s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:227.3s / 358.1s
  • uptime_min/max:91.87% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.55%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy4 Fight Length
Count 15038
Mean 300.33
Minimum 240.00
Maximum 359.99
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 19.98%
Standard Deviation 34.5421
5th Percentile 246.06
95th Percentile 353.97
( 95th Percentile - 5th Percentile ) 107.90
Mean Distribution
Standard Deviation 0.2817
95.00% Confidence Interval ( 299.78 - 300.88 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 509
0.1% Error 50815
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1019
DPS
enemy4 Damage Per Second
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy4 Priority Target Damage Per Second
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy4 Damage Per Second (Effective)
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy4 Damage
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy4 Damage Taken Per Second
Count 15038
Mean 118357.23
Minimum 101807.92
Maximum 147403.83
Spread ( max - min ) 45595.91
Range [ ( max - min ) / 2 * 100% ] 19.26%
Standard Deviation 6182.0520
5th Percentile 109013.68
95th Percentile 129244.49
( 95th Percentile - 5th Percentile ) 20230.81
Mean Distribution
Standard Deviation 50.4124
95.00% Confidence Interval ( 118258.42 - 118456.03 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 105
0.1% Error 10481
0.1 Scale Factor Error with Delta=300 326249
0.05 Scale Factor Error with Delta=300 1304996
0.01 Scale Factor Error with Delta=300 32624885
HPS
enemy4 Healing Per Second
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy4 Healing Per Second (Effective)
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy4 Heal
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy4 Healing Taken Per Second
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy4 Theck-Meloree Index
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy4Theck-Meloree Index (Effective)
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy4 Max Spike Value
Count 722
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 39509645 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="enemy4"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy5 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
110508.9 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Waning Twilight 1.0 0.0 4.9s 0.0s 295.9s 98.36% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 16.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:226.6s / 358.6s
  • uptime_min/max:91.87% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.36%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.6s 0.0s 295.9s 98.55% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 11.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:230.1s / 357.9s
  • uptime_min/max:92.90% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.55%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 3.3s 0.0s 295.8s 98.56% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 9.5s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:226.1s / 358.9s
  • uptime_min/max:91.66% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.56%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.8s 0.0s 295.3s 98.52% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 16.3s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:226.6s / 358.9s
  • uptime_min/max:93.75% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.52%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.0s 0.0s 295.9s 98.55% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 8.7s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:230.9s / 358.5s
  • uptime_min/max:89.96% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.55%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.5s 0.0s 296.6s 98.56% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 9.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:223.6s / 359.0s
  • uptime_min/max:91.55% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.56%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.5s 0.0s 296.2s 98.54% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.3s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:222.1s / 358.3s
  • uptime_min/max:90.43% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.54%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy5 Fight Length
Count 15038
Mean 300.33
Minimum 240.00
Maximum 359.99
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 19.98%
Standard Deviation 34.5421
5th Percentile 246.06
95th Percentile 353.97
( 95th Percentile - 5th Percentile ) 107.90
Mean Distribution
Standard Deviation 0.2817
95.00% Confidence Interval ( 299.78 - 300.88 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 509
0.1% Error 50815
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1019
DPS
enemy5 Damage Per Second
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy5 Priority Target Damage Per Second
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy5 Damage Per Second (Effective)
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy5 Damage
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy5 Damage Taken Per Second
Count 15038
Mean 118243.45
Minimum 99369.93
Maximum 143595.45
Spread ( max - min ) 44225.51
Range [ ( max - min ) / 2 * 100% ] 18.70%
Standard Deviation 6212.5008
5th Percentile 108610.17
95th Percentile 129116.93
( 95th Percentile - 5th Percentile ) 20506.76
Mean Distribution
Standard Deviation 50.6607
95.00% Confidence Interval ( 118144.16 - 118342.74 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 107
0.1% Error 10605
0.1 Scale Factor Error with Delta=300 329471
0.05 Scale Factor Error with Delta=300 1317883
0.01 Scale Factor Error with Delta=300 32947054
HPS
enemy5 Healing Per Second
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy5 Healing Per Second (Effective)
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy5 Heal
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy5 Healing Taken Per Second
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy5 Theck-Meloree Index
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy5Theck-Meloree Index (Effective)
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy5 Max Spike Value
Count 722
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 34934206 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="enemy5"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy6 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
111450.7 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Waning Twilight 1.0 0.0 6.0s 0.0s 296.0s 98.40% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 17.1s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:223.3s / 357.8s
  • uptime_min/max:90.42% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.40%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.1s 0.0s 295.9s 98.52% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 9.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:227.6s / 358.9s
  • uptime_min/max:92.50% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.52%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 3.9s 0.0s 295.7s 98.53% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 11.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:231.8s / 358.9s
  • uptime_min/max:92.71% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.53%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.9s 0.0s 295.4s 98.56% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 9.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:225.0s / 359.0s
  • uptime_min/max:93.10% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.56%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 3.8s 0.0s 295.8s 98.52% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 8.6s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:224.0s / 358.0s
  • uptime_min/max:90.21% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.52%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 3.5s 0.0s 296.7s 98.58% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 8.7s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:229.3s / 359.0s
  • uptime_min/max:94.42% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.58%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.0s 0.0s 296.2s 98.54% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 9.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:227.3s / 359.0s
  • uptime_min/max:92.15% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.54%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy6
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy6
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy6
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy6
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy6 Fight Length
Count 15038
Mean 300.33
Minimum 240.00
Maximum 359.99
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 19.98%
Standard Deviation 34.5421
5th Percentile 246.06
95th Percentile 353.97
( 95th Percentile - 5th Percentile ) 107.90
Mean Distribution
Standard Deviation 0.2817
95.00% Confidence Interval ( 299.78 - 300.88 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 509
0.1% Error 50815
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1019
DPS
enemy6 Damage Per Second
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy6 Priority Target Damage Per Second
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy6 Damage Per Second (Effective)
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy6 Damage
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy6 Damage Taken Per Second
Count 15038
Mean 118889.91
Minimum 100208.26
Maximum 142462.01
Spread ( max - min ) 42253.75
Range [ ( max - min ) / 2 * 100% ] 17.77%
Standard Deviation 6205.1769
5th Percentile 109357.61
95th Percentile 129647.83
( 95th Percentile - 5th Percentile ) 20290.22
Mean Distribution
Standard Deviation 50.6010
95.00% Confidence Interval ( 118790.73 - 118989.09 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 105
0.1% Error 10465
0.1 Scale Factor Error with Delta=300 328695
0.05 Scale Factor Error with Delta=300 1314777
0.01 Scale Factor Error with Delta=300 32869418
HPS
enemy6 Healing Per Second
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy6 Healing Per Second (Effective)
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy6 Heal
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy6 Healing Taken Per Second
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy6 Theck-Meloree Index
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy6Theck-Meloree Index (Effective)
Count 15038
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy6 Max Spike Value
Count 722
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 32113558 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="enemy6"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.