SimulationCraft 1015-01

for World of Warcraft 10.2.0.52095 PTR (hotfix 2023-11-09/52095, git build e1ec9bc853)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
Adjust bear thrash periodic damage spell level requirement
Thrash spell_level 11.00 18.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-05-16 Base value of Frost aura's effect 191124 is truncated.
Frost Mage (effect#5) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191122 is truncated.
Frost Mage (effect#3) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191121 is truncated.
Frost Mage (effect#2) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 179703 is truncated.
Frost Mage (effect#1) base_value 9.00 9.20
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-01-08 Manually set secondary Malefic Rapture level requirement
Malefic Rapture spell_level 11.00 43.00

Table of Contents

Raid Summary

Created with Highcharts 4.2.3 Damage per Second(Click title for burst)202,922197,952188,583186,445186,087183,894182,114470 T31 4p460 T31 4p447+470 2p+2p470 T31 2p447+460 2p+2p460 T31 2p447 T30 4p
Created with Highcharts 4.2.3 Damage Taken per Second(Click title for burst)3,9263,9003,8703,8343,8283,8173,760470 T31 4p470 T31 2p460 T31 2p460 T31 4p447+470 2p+2p447+460 2p+2p447 T30 4p

Additional Raid Information

447 T30 4p : 182114 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
182114.5 182114.5 181.7 / 0.100% 26014.4 / 14.3% 14797.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
11.9 11.9 Astral Power 0.00% 64.4 100.1% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
447 T30 4p 182114
Astral Smolder 9378 5.1% 59.6 5.00s 47230 0 Periodic 112.3 25082 0 25082 0.0% 74.8%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 59.62 0.00 112.28 112.28 43.19 0.0000 2.0000 2816082.20 2816082.20 0.00% 12540.78 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 112.28 71 152 25082.05 7782 89179 25090.71 19419 33078 2816082 2816082 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Denizen of the Dream 0 (5064) 0.0% (2.8%) 8.5 32.19s 180165 0

Stats Details: Denizen Of The Dream

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.46 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Denizen Of The Dream

  • id:394065
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394065
  • name:Denizen of the Dream
  • school:physical
  • tooltip:
  • description:Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.
    Fey Missile 13905  / 5064 2.8% 147.5 1.76s 10331 7897 Direct 146.6 8061 16739 10394 26.9%

Stats Details: Fey Missile

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 147.54 146.63 0.00 0.00 0.00 1.3082 0.0000 1524196.33 1524196.33 0.00% 7897.35 7897.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.12% 107.21 22 250 8061.43 5274 14146 8053.89 7140 9590 864300 864300 0.00%
crit 26.88% 39.42 6 97 16738.67 12635 29424 16726.45 14114 20975 659896 659896 0.00%

Action Details: Fey Missile

  • id:188046
  • school:astral
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.531
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.236000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:188046
  • name:Fey Missile
  • school:astral
  • tooltip:
  • description:{$@spelldesc187875=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$188083d=30 seconds}.}

Action Priority List

    default
    [ ]:4499.91
Hungering Shadowflame 2928 1.6% 17.1 17.04s 51385 0 Direct 17.1 40020 82237 51383 26.9%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.15 17.15 0.00 0.00 0.00 0.0000 0.0000 881016.99 881016.99 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.09% 12.53 3 27 40019.76 26959 154597 39855.40 26959 88580 501630 501630 0.00%
crit 26.91% 4.61 0 14 82236.78 54997 315378 81022.92 0 301918 379387 379387 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24191.79
  • base_dd_max:24191.79
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 5527 3.0% 33.7 8.70s 49302 0 Direct 33.6 38594 78679 49440 27.1%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.70 33.60 0.00 0.00 0.00 0.0000 0.0000 1661281.58 1661281.58 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.94% 24.51 8 45 38594.41 38162 43768 38593.05 38162 39984 945961 945961 0.00%
crit 27.06% 9.09 1 22 78679.32 77851 89287 78679.52 77851 86428 715321 715321 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:34245.43
  • base_dd_max:34245.43
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 11713 6.4% 14.4 21.62s 244803 249820 Direct 14.4 8806 18234 12078 34.7%
Periodic 306.9 7889 16641 10900 34.4% 99.7%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.37 14.37 306.89 306.89 13.37 0.9799 0.9753 3518714.15 3518714.15 0.00% 11227.30 249819.96
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 65.29% 9.38 2 17 8805.90 6429 15978 8799.57 7524 10448 82651 82651 0.00%
crit 34.71% 4.99 0 13 18234.45 12146 32677 18171.09 0 26714 90974 90974 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 65.60% 201.33 137 270 7888.97 110 14557 7890.79 7422 8409 1588263 1588263 0.00%
crit 34.40% 105.57 67 147 16640.69 138 29696 16649.02 15496 18072 1756826 1756826 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.39

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.39
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    st
    [K]:1.66
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [R]:12.71
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
New Moon (Talent) 0 (16091) 0.0% (8.8%) 17.0 18.07s 284926 235436

Stats Details: Moons Talent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.96 0.00 0.00 0.00 0.00 1.2102 0.0000 0.00 0.00 0.00% 235436.40 235436.40

Action Details: Moons Talent

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
    Full Moon 5775 3.2% 5.3 63.40s 329623 175691 Direct 5.2 226066 461352 331980 45.0%

Stats Details: Full Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.28 5.24 0.00 0.00 0.00 1.8763 0.0000 1739690.21 1739690.21 0.00% 175690.79 175690.79
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 55.00% 2.88 0 6 226066.47 156722 389311 222050.64 0 354217 651616 651616 0.00%
crit 45.00% 2.36 0 6 461351.87 319712 795427 436505.52 0 762929 1088074 1088074 0.00%

Action Details: Full Moon

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:50.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Action Priority List

    st
    [U]:5.34
  • if_expr:astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    New Moon 4432 2.4% 6.0 54.02s 222187 294488 Direct 5.9 145792 312513 223627 46.7%

Stats Details: New Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.99 5.95 0.00 0.00 0.00 0.7545 0.0000 1329907.33 1329907.33 0.00% 294487.89 294487.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.31% 3.17 0 7 145791.65 79969 225687 144261.50 0 216501 462244 462244 0.00%
crit 46.69% 2.78 0 7 312512.50 175229 460402 308196.82 0 460402 867664 867664 0.00%

Action Details: New Moon

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Action Priority List

    st
    [S]:6.00
  • if_expr:astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Half Moon 5883 3.2% 5.7 57.52s 309434 249326 Direct 5.7 200387 411299 311378 52.6%

Stats Details: Half Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.70 5.66 0.00 0.00 0.00 1.2411 0.0000 1762734.63 1762734.63 0.00% 249325.97 249325.97
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 47.37% 2.68 0 6 200387.30 115453 320465 195647.12 0 309337 537250 537250 0.00%
crit 52.63% 2.98 0 7 411299.08 266427 641308 405902.81 0 618559 1225485 1225485 0.00%

Action Details: Half Moon

  • id:274282
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:24.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.875000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274282
  • name:Half Moon
  • school:astral
  • tooltip:
  • description:Deals {$s1=0} Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates {$=}{{$m3=240}/10} Astral Power.|r

Action Priority List

    st
    [T]:5.72
  • if_expr:astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (24752) 0.0% (13.6%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 5399 3.0% 74.2 4.02s 21845 0 Direct 74.0 14767 31313 21903 43.1%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 74.24 74.05 0.00 0.00 0.00 0.0000 0.0000 1621814.84 1621814.84 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.87% 42.11 17 72 14766.85 9717 27838 14768.06 13371 16420 621889 621889 0.00%
crit 43.13% 31.93 14 58 31312.88 19823 58380 31324.09 27834 35478 999925 999925 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 5404 3.0% 74.4 4.02s 21842 0 Direct 74.2 14741 31289 21898 43.3%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 74.37 74.17 0.00 0.00 0.00 0.0000 0.0000 1624301.13 1624301.13 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.75% 42.09 19 71 14740.56 9692 27803 14741.00 13246 16574 620471 620471 0.00%
crit 43.25% 32.08 12 55 31288.87 19771 58380 31300.61 28026 36421 1003830 1003830 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 3805 2.1% 6.2 49.09s 184531 0 Direct 6.2 124720 264968 185114 43.0%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.20 6.18 0.00 0.00 0.00 0.0000 0.0000 1143194.32 1143194.32 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.98% 3.52 0 8 124719.75 81552 229167 123608.10 0 221948 439118 439118 0.00%
crit 43.02% 2.66 0 7 264968.33 166365 484518 257098.32 0 428234 704076 704076 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Crashing Star 10144 5.6% 37.3 7.96s 81748 0 Direct 37.2 55096 116876 81942 43.5%

Stats Details: Crashing Star

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.30 37.21 0.00 0.00 0.00 0.0000 0.0000 3048995.68 3048995.68 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.54% 21.04 5 42 55095.76 36166 102326 55096.28 46919 66347 1158897 1158897 0.00%
crit 43.46% 16.17 3 35 116876.38 73779 217856 116919.57 97348 144292 1890099 1890099 0.00%

Action Details: Crashing Star

  • id:408310
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:5.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Spelldata

  • id:408310
  • name:Crashing Star
  • school:astral
  • tooltip:
  • description:{$@spelldesc405511=Shooting Stars has a {$s1=20}% chance to instead call down a Crashing Star, dealing {$408310s1=0} Astral damage to the target and generating {$=}{{$408310m2=50}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 2232 1.2% 22.8 11.31s 29544 24544 Direct 23.8 20108 40791 28303 39.6%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.82 23.82 0.00 0.00 0.00 1.2038 0.0000 674300.02 674300.02 0.00% 24544.10 24544.10
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 60.38% 14.38 2 26 20108.34 16318 35837 20085.54 18170 22459 289228 289228 0.00%
crit 39.62% 9.44 1 21 40790.57 33290 72011 40740.58 35114 47295 385072 385072 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    st
    [N]:22.90
  • if_expr:variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Warrior of Elune2024251-1.000Spell DataNo-stacks
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Starsurge 55110 (74485) 30.2% (40.9%) 113.6 2.64s 196878 196781 Direct 113.4 (150.7) 100474 211712 145951 40.9% (41.5%)

Stats Details: Starsurge

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 113.61 113.37 0.00 0.00 0.00 1.0005 0.0000 16546280.36 16546280.36 0.00% 196780.84 196780.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.12% 67.02 40 98 100473.79 64986 189573 100485.82 92989 110092 6733860 6733860 0.00%
crit 40.88% 46.35 26 71 211711.92 132572 386729 211833.08 193549 235601 9812420 9812420 0.00%

Action Details: Starsurge

  • id:78674
  • school:astral
  • range:45.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:36.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.455000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.18

Spelldata

  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$s1=0} Astral damage.

Action Priority List

    st
    [P]:83.92
  • if_expr:variable.starsurge_condition1
    st
    [W]:29.69
  • if_expr:variable.starsurge_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Flat Cost Incarnation: Chosen of Elune1025603-8.000Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Goldrinn's Fang 19376 10.6% 37.5 7.92s 155279 0 Direct 37.3 105746 222022 156047 43.3%

Stats Details: Goldrinns Fang

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.49 37.31 0.00 0.00 0.00 0.0000 0.0000 5821206.96 5821206.96 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.74% 21.17 7 38 105745.99 68050 192828 105767.08 92348 124793 2238411 2238411 0.00%
crit 43.26% 16.14 3 31 222022.41 157910 404385 222100.78 187244 272095 3582796 3582796 0.00%

Action Details: Goldrinns Fang

  • id:394047
  • school:astral
  • range:60.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.852000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10

Spelldata

  • id:394047
  • name:Goldrinn's Fang
  • school:astral
  • tooltip:Deals {$m1=0} Arcane damage.
  • description:Deals {$m1=0} Arcane damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountPower of Goldrinn3940462PCT1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Friend of the Fae39408310.100Spell Data
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Incarnation: Chosen of Elune10256020.100Spell Data
Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Dot / Debuff on Target Moonfire16481250.283Mastery
Sunfire16481550.283Mastery
Waning Twilight39395710.100
Sunfire 11507 6.3% 17.4 18.05s 198340 201413 Direct 17.4 8581 17661 11966 37.3%
Periodic 307.9 7594 15687 10556 36.6% 100.0%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.44 17.44 307.86 307.86 16.43 0.9848 0.9753 3458666.91 3458666.91 0.00% 10895.50 201413.17
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 62.72% 10.94 3 19 8581.26 5384 15049 8573.34 7083 10248 93857 93857 0.00%
crit 37.28% 6.50 0 14 17661.42 10983 29216 17645.70 0 22800 114841 114841 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 63.39% 195.16 131 254 7593.61 86 13234 7592.37 7219 8038 1481999 1481999 0.00%
crit 36.61% 112.70 63 161 15687.25 1897 26996 15687.33 14715 16683 1767971 1767971 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.26
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    st
    [J]:1.89
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [Q]:15.54
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (3094) 0.0% (1.7%) 8.5 31.78s 109763 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.48 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 1610 0.9% 8.5 31.78s 57126 0 Direct 8.5 44597 90856 57133 27.1%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.48 8.48 0.00 0.00 0.00 0.0000 0.0000 484221.65 484221.65 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.91% 6.18 0 15 44596.82 44043 50512 44575.15 0 49165 275610 275610 0.00%
crit 27.09% 2.30 0 10 90856.45 89847 103045 82567.58 0 103045 208611 208611 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:39522.22
  • base_dd_max:39522.22
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 1483 0.8% 16.4 15.39s 27155 0 Direct 16.4 21204 43237 27159 27.0%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.43 16.43 0.00 0.00 0.00 0.0000 0.0000 446168.90 446168.90 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.99% 11.99 1 29 21204.31 20957 24036 21203.52 20957 22668 254288 254288 0.00%
crit 27.01% 4.44 0 15 43236.90 42752 49033 42541.11 0 49033 191881 191881 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18805.57
  • base_dd_max:18805.57
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 15344 8.4% 110.4 2.66s 41745 43232 Direct 110.1 28121 58278 41873 45.6%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 110.40 110.06 0.00 0.00 0.00 0.9656 0.0000 4608747.25 4608747.25 0.00% 43231.59 43231.59
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.40% 59.88 35 89 28121.40 12439 49287 28118.95 25706 30766 1683818 1683818 0.00%
crit 45.60% 50.19 29 77 58278.31 25375 99463 58272.14 50910 63600 2924930 2924930 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    st
    [O]:1.74
  • if_expr:variable.enter_eclipse
    st
    [X]:106.93

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.400Spell Data
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
447 T30 4p
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447 T30 4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447 T30 4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447 T30 4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 180.65s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    st
    [L]:2.00
  • if_expr:variable.cd_condition_st

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.7 74.51s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.67 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447 T30 4p
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:57075.72
  • base_dd_max:57075.72
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.33s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.75 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447 T30 4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.75
Elemental Potion of Ultimate Power 1.5 307.71s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.50
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
Warrior of Elune 5.5 53.04s

Stats Details: Warrior Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Warrior Of Elune

  • id:202425
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202425
  • name:Warrior of Elune
  • school:arcane
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.

Action Priority List

    st
    [M]:5.50
  • if_expr:variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 8.9 2.5 35.3s 29.5s 8.4s 24.92% 29.14% 2.5 (16.8) 8.7

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 52.9s
  • trigger_min/max:0.0s / 51.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.8s
  • uptime_min/max:22.42% / 30.65%

Stack Uptimes

  • balance_of_all_things_arcane_1:2.93%
  • balance_of_all_things_arcane_2:2.95%
  • balance_of_all_things_arcane_3:2.98%
  • balance_of_all_things_arcane_4:3.00%
  • balance_of_all_things_arcane_5:3.03%
  • balance_of_all_things_arcane_6:3.07%
  • balance_of_all_things_arcane_7:3.42%
  • balance_of_all_things_arcane_8:3.55%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 18.2 1.6 16.9s 15.5s 8.2s 49.63% 53.46% 1.6 (7.4) 17.7

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.8s
  • trigger_min/max:0.9s / 39.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.6s
  • uptime_min/max:44.49% / 53.61%

Stack Uptimes

  • balance_of_all_things_nature_1:5.89%
  • balance_of_all_things_nature_2:5.97%
  • balance_of_all_things_nature_3:6.07%
  • balance_of_all_things_nature_4:6.15%
  • balance_of_all_things_nature_5:6.24%
  • balance_of_all_things_nature_6:6.32%
  • balance_of_all_things_nature_7:6.43%
  • balance_of_all_things_nature_8:6.56%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Best Friends with Aerwynn 2.8 0.0 70.7s 70.7s 10.8s 10.01% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 324.4s
  • trigger_min/max:12.0s / 324.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 11.0s
  • uptime_min/max:0.00% / 31.49%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.90%
  • best_friends_with_aerwynn_2:0.90%
  • best_friends_with_aerwynn_3:0.90%
  • best_friends_with_aerwynn_4:0.90%
  • best_friends_with_aerwynn_5:0.91%
  • best_friends_with_aerwynn_6:0.91%
  • best_friends_with_aerwynn_7:0.91%
  • best_friends_with_aerwynn_8:0.92%
  • best_friends_with_aerwynn_9:0.92%
  • best_friends_with_aerwynn_10:0.92%
  • best_friends_with_aerwynn_11:0.93%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 113.9s 70.7s 45.6s 33.34% 0.00% 69.6 (69.6) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:14.0s / 345.0s
  • trigger_min/max:12.0s / 324.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 266.1s
  • uptime_min/max:0.00% / 94.26%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.34%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.5s 70.5s 10.8s 10.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 339.9s
  • trigger_min/max:12.0s / 339.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 32.56%

Stack Uptimes

  • best_friends_with_pip_1:0.89%
  • best_friends_with_pip_2:0.90%
  • best_friends_with_pip_3:0.90%
  • best_friends_with_pip_4:0.90%
  • best_friends_with_pip_5:0.91%
  • best_friends_with_pip_6:0.91%
  • best_friends_with_pip_7:0.91%
  • best_friends_with_pip_8:0.92%
  • best_friends_with_pip_9:0.92%
  • best_friends_with_pip_10:0.92%
  • best_friends_with_pip_11:0.92%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 114.4s 70.5s 45.6s 33.42% 0.00% 70.1 (70.1) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 341.9s
  • trigger_min/max:12.0s / 339.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 316.9s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.42%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 69.9s 69.9s 10.8s 10.01% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 331.1s
  • trigger_min/max:12.0s / 331.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 35.17%

Stack Uptimes

  • best_friends_with_urctos_1:0.89%
  • best_friends_with_urctos_2:0.90%
  • best_friends_with_urctos_3:0.90%
  • best_friends_with_urctos_4:0.90%
  • best_friends_with_urctos_5:0.91%
  • best_friends_with_urctos_6:0.91%
  • best_friends_with_urctos_7:0.91%
  • best_friends_with_urctos_8:0.92%
  • best_friends_with_urctos_9:0.92%
  • best_friends_with_urctos_10:0.92%
  • best_friends_with_urctos_11:0.93%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 113.8s 69.9s 46.0s 33.24% 0.00% 69.8 (69.8) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 355.1s
  • trigger_min/max:12.0s / 331.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 316.3s
  • uptime_min/max:0.00% / 97.11%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.24%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.66%

Stack Uptimes

  • bloodlust_1:13.48%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 61.4s 58.1s 49.8s 80.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 341.0s
  • trigger_min/max:15.0s / 298.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 360.0s
  • uptime_min/max:45.73% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.00%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Denizen of the Dream 8.5 0.0 45.3s 32.3s 41.0s 56.78% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_denizen_of_the_dream
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 277.5s
  • trigger_min/max:0.0s / 136.4s
  • trigger_pct:99.98%
  • duration_min/max:0.0s / 236.9s
  • uptime_min/max:21.31% / 93.97%

Stack Uptimes

  • denizen_of_the_dream_1:38.36%
  • denizen_of_the_dream_2:14.27%
  • denizen_of_the_dream_3:3.44%
  • denizen_of_the_dream_4:0.63%
  • denizen_of_the_dream_5:0.10%
  • denizen_of_the_dream_6:0.02%
  • denizen_of_the_dream_7:0.01%

Spelldata

  • id:394076
  • name:Denizen of the Dream
  • tooltip:
  • description:{$@spelldesc394065=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Lunar) 7.1 2.3 46.0s 37.5s 20.7s 48.93% 52.70% 2.3 (2.3) 6.8

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.4s
  • trigger_min/max:0.0s / 90.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.1s
  • uptime_min/max:43.87% / 60.03%

Stack Uptimes

  • eclipse_lunar_1:48.93%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 13.3 4.5 23.5s 17.4s 20.7s 91.27% 94.50% 4.5 (4.5) 12.4

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 60.9s
  • trigger_min/max:0.9s / 56.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 58.5s
  • uptime_min/max:83.97% / 94.36%

Stack Uptimes

  • eclipse_solar_1:91.27%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 307.3s 307.3s 27.2s 13.32% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 329.8s
  • trigger_min/max:300.0s / 329.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.91% / 18.06%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.32%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Friend of the Fae 5.2 3.2 55.8s 32.3s 24.8s 43.02% 42.93% 3.2 (3.2) 4.8

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_friend_of_the_fae
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 184.0s
  • trigger_min/max:0.0s / 136.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 118.0s
  • uptime_min/max:14.20% / 78.09%

Stack Uptimes

  • friend_of_the_fae_1:43.02%

Spelldata

  • id:394083
  • name:Friend of the Fae
  • tooltip:Arcane and Nature damage increased by {$=}w1%.
  • description:{$@spelldesc394081=When a Faerie Dragon is summoned, your spells deal {$394083m1=10}% increased damage for {$394083d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 7.1 0.0 45.7s 45.7s 20.3s 47.90% 50.89% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.4s
  • trigger_min/max:12.0s / 90.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:43.34% / 54.85%

Stack Uptimes

  • incarnation_chosen_of_elune_1:47.90%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.6 0.0 99.8s 99.8s 19.5s 23.25% 0.00% 0.0 (0.0) 3.2

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:55.09

Trigger Details

  • interval_min/max:90.0s / 129.0s
  • trigger_min/max:90.0s / 129.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.22% / 26.28%

Stack Uptimes

  • kindled_soul_5:1.10%
  • kindled_soul_10:1.14%
  • kindled_soul_15:1.14%
  • kindled_soul_20:1.15%
  • kindled_soul_25:1.15%
  • kindled_soul_30:1.15%
  • kindled_soul_35:1.15%
  • kindled_soul_40:1.16%
  • kindled_soul_45:1.16%
  • kindled_soul_50:1.16%
  • kindled_soul_55:1.17%
  • kindled_soul_60:1.17%
  • kindled_soul_65:1.17%
  • kindled_soul_70:1.17%
  • kindled_soul_75:1.18%
  • kindled_soul_80:1.18%
  • kindled_soul_85:1.18%
  • kindled_soul_90:1.19%
  • kindled_soul_95:1.19%
  • kindled_soul_100:1.19%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Grace 12.4 0.0 21.7s 21.7s 5.9s 24.32% 0.00% 0.0 (0.0) 12.1

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 60.7s
  • trigger_min/max:13.0s / 60.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:19.37% / 28.96%

Stack Uptimes

  • natures_grace_1:24.32%

Spelldata

  • id:393959
  • name:Nature's Grace
  • tooltip:Haste increased by {$s1=10}%.
  • description:{$@spelldesc393958=After an Eclipse ends, you gain {$393959s1=10}% Haste for {$393959d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Vigil 3.7 0.0 90.3s 90.3s 14.8s 18.40% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.9s
  • trigger_min/max:90.0s / 91.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.54% / 21.03%

Stack Uptimes

  • natures_vigil_1:18.40%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.4 0.1 74.3s 68.1s 7.8s 6.34% 7.23% 0.1 (0.1) 1.3

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.4s / 330.3s
  • trigger_min/max:0.1s / 330.3s
  • trigger_pct:15.04%
  • duration_min/max:0.0s / 30.1s
  • uptime_min/max:0.00% / 27.17%

Stack Uptimes

  • owlkin_frenzy_1:6.34%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 8.0 106.5 39.5s 39.5s 35.4s 94.46% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:24.3s / 52.5s
  • trigger_min/max:24.3s / 52.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 49.4s
  • uptime_min/max:91.30% / 96.99%

Stack Uptimes

  • primordial_arcanic_pulsar_4:4.77%
  • primordial_arcanic_pulsar_8:5.48%
  • primordial_arcanic_pulsar_12:6.86%
  • primordial_arcanic_pulsar_16:8.02%
  • primordial_arcanic_pulsar_20:6.56%
  • primordial_arcanic_pulsar_24:6.34%
  • primordial_arcanic_pulsar_28:7.95%
  • primordial_arcanic_pulsar_32:7.25%
  • primordial_arcanic_pulsar_36:6.82%
  • primordial_arcanic_pulsar_40:7.04%
  • primordial_arcanic_pulsar_44:6.78%
  • primordial_arcanic_pulsar_48:6.79%
  • primordial_arcanic_pulsar_52:6.94%
  • primordial_arcanic_pulsar_56:6.85%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 18.6 3.5 16.7s 14.5s 6.3s 38.79% 38.79% 3.5 (3.5) 18.2

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 49.2s
  • trigger_min/max:0.0s / 39.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.1s
  • uptime_min/max:35.80% / 42.07%

Stack Uptimes

  • solstice_1:38.79%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 20.9 92.8 14.7s 2.6s 14.0s 97.10% 0.00% 51.5 (51.5) 7.5

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 22.0s
  • trigger_min/max:0.8s / 11.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:92.30% / 99.39%

Stack Uptimes

  • starlord_1:10.02%
  • starlord_2:15.50%
  • starlord_3:71.58%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Wafting Devotion 4.3 1.2 60.8s 45.1s 16.6s 23.83% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 195.7s
  • trigger_min/max:0.0s / 195.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 72.5s
  • uptime_min/max:4.85% / 59.01%

Stack Uptimes

  • wafting_devotion_1:23.83%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Warrior of Elune 5.5 0.0 53.3s 53.3s 22.2s 40.59% 39.14% 0.0 (0.0) 2.5

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_warrior_of_elune
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:45.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 113.6s
  • trigger_min/max:45.0s / 113.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s
  • uptime_min/max:26.37% / 51.46%

Stack Uptimes

  • warrior_of_elune_1:22.93%
  • warrior_of_elune_2:5.04%
  • warrior_of_elune_3:12.63%

Spelldata

  • id:202425
  • name:Warrior of Elune
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.
  • max_stacks:0
  • duration:25.00
  • cooldown:45.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Denizen of the Dream 8.5 2.0 18.0 32.3s 0.0s 136.4s
Primordial Arcanic Pulsar 7.1 6.0 9.0 41.4s 29.3s 52.1s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.14% 0.00% 1.82% 0.5s 0.0s 4.5s
Astral Smolder 74.88% 51.19% 91.75% 13.7s 0.0s 104.0s
Incarnation (Total) 47.90% 43.34% 54.85% 20.3s 0.0s 54.0s
Incarnation (Pulsar) 27.68% 25.22% 29.95% 11.8s 0.0s 12.0s
Lunar Eclipse Only 1.03% 0.53% 8.32% 1.3s 0.0s 15.0s
Solar Eclipse Only 43.37% 32.82% 49.58% 12.2s 0.0s 15.0s
No Eclipse 7.66% 4.90% 10.26% 1.9s 0.0s 4.7s
Friend of the Fae 43.02% 14.20% 78.09% 24.8s 0.0s 118.0s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Warrior of Elune12.9770.00068.57472.08936.895117.235
Full Moon
New Moon
Half Moon		0.3070.00026.3725.2153.86430.473

Eclipse Utilization

NoneSolarLunarBoth
Wrath6.546.0%52.2448.2%0.290.3%49.3345.5%
Starfire22.6094.9%0.000.0%1.004.2%0.220.9%
Starsurge0.000.0%46.0440.5%0.530.5%67.0459.0%
New Moon0.020.3%0.132.2%0.000.0%5.8497.6%
Half Moon0.000.0%0.223.9%0.000.0%5.4796.1%
Full Moon0.292.5%3.1027.0%0.090.8%8.0069.7%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
447 T30 4p
Nature's BalanceAstral Power99.77199.335.55%2.000.200.10%
Crashing StarAstral Power37.30186.095.18%4.990.390.21%
Full MoonAstral Power5.28263.237.33%49.890.560.21%
Half MoonAstral Power5.70136.743.81%24.000.010.01%
MoonfireAstral Power14.3786.172.40%6.000.060.06%
New MoonAstral Power5.9971.822.00%12.000.000.00%
Orbit BreakerAstral Power6.20184.545.14%29.791.320.71%
Shooting Stars (Moonfire)Astral Power74.25148.234.13%2.000.270.18%
Shooting Stars (Sunfire)Astral Power74.38148.514.14%2.000.240.16%
StarfireAstral Power23.82348.149.70%14.613.140.89%
SunfireAstral Power17.44104.532.91%5.990.090.08%
WrathAstral Power110.401713.1947.71%15.520.280.02%
Usage Type Count Total Tot% Avg RPE APR
447 T30 4p
StarsurgeAstral Power 114.313616.20100.00%31.6431.836185.36
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 679760.0 3182.76 3759.87 1378394.2 506169.3 -259212.8 679760.0
Astral Power 70.0 11.94 11.95 6.6 26.3 0.0 100.0

Statistics & Data Analysis

Fight Length
447 T30 4p Fight Length
Count 5248
Mean 300.79
Minimum 240.03
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.94%
Standard Deviation 34.6581
5th Percentile 246.16
95th Percentile 354.48
( 95th Percentile - 5th Percentile ) 108.31
Mean Distribution
Standard Deviation 0.4784
95.00% Confidence Interval ( 299.85 - 301.73 )
Normalized 95.00% Confidence Interval ( 99.69% - 100.31% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 511
0.1% Error 51002
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1026
DPS
447 T30 4p Damage Per Second
Count 5248
Mean 182114.47
Minimum 159920.61
Maximum 216041.68
Spread ( max - min ) 56121.07
Range [ ( max - min ) / 2 * 100% ] 15.41%
Standard Deviation 6715.6254
5th Percentile 171487.31
95th Percentile 193579.10
( 95th Percentile - 5th Percentile ) 22091.79
Mean Distribution
Standard Deviation 92.7021
95.00% Confidence Interval ( 181932.77 - 182296.16 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5224
0.1 Scale Factor Error with Delta=300 384997
0.05 Scale Factor Error with Delta=300 1539986
0.01 Scale Factor Error with Delta=300 38499634
Priority Target DPS
447 T30 4p Priority Target Damage Per Second
Count 5248
Mean 182114.47
Minimum 159920.61
Maximum 216041.68
Spread ( max - min ) 56121.07
Range [ ( max - min ) / 2 * 100% ] 15.41%
Standard Deviation 6715.6254
5th Percentile 171487.31
95th Percentile 193579.10
( 95th Percentile - 5th Percentile ) 22091.79
Mean Distribution
Standard Deviation 92.7021
95.00% Confidence Interval ( 181932.77 - 182296.16 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5224
0.1 Scale Factor Error with Delta=300 384997
0.05 Scale Factor Error with Delta=300 1539986
0.01 Scale Factor Error with Delta=300 38499634
DPS(e)
447 T30 4p Damage Per Second (Effective)
Count 5248
Mean 182114.47
Minimum 159920.61
Maximum 216041.68
Spread ( max - min ) 56121.07
Range [ ( max - min ) / 2 * 100% ] 15.41%
Damage
447 T30 4p Damage
Count 5248
Mean 53187325.12
Minimum 39764402.29
Maximum 68092548.49
Spread ( max - min ) 28328146.19
Range [ ( max - min ) / 2 * 100% ] 26.63%
DTPS
447 T30 4p Damage Taken Per Second
Count 5248
Mean 3759.69
Minimum 1055.62
Maximum 7291.63
Spread ( max - min ) 6236.01
Range [ ( max - min ) / 2 * 100% ] 82.93%
HPS
447 T30 4p Healing Per Second
Count 5248
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
447 T30 4p Healing Per Second (Effective)
Count 5248
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
447 T30 4p Heal
Count 5248
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
447 T30 4p Healing Taken Per Second
Count 5248
Mean 3175.72
Minimum 762.77
Maximum 5977.34
Spread ( max - min ) 5214.57
Range [ ( max - min ) / 2 * 100% ] 82.10%
TMI
447 T30 4p Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
447 T30 4pTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
447 T30 4p Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.50 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.59 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.75 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.st
# count action,conditions
J 1.89 sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
K 1.66 moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
0.00 starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
0.00 starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
0.00 starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
0.00 wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
0.00 celestial_alignment,if=variable.cd_condition_st
L 2.00 incarnation,if=variable.cd_condition_st
0.00 variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
0.00 variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
M 5.50 warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
N 22.90 starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
O 1.74 wrath,if=variable.enter_eclipse
0.00 variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
0.00 convoke_the_spirits,if=variable.convoke_condition
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+55
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 starfall,if=buff.starweavers_warp.up
0.00 variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
P 83.92 starsurge,if=variable.starsurge_condition1
Q 15.54 sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
R 12.71 moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
S 6.00 new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
T 5.72 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
U 5.34 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
V 12.38 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
W 29.69 starsurge,if=variable.starsurge_condition2
X 106.93 wrath
Y 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFJKLDEPPSPTPUPXXWXXWQXVPPPRXXXXWXWSXMWXXWXVPPPQXPXXPXXWRXWWXVPNNPXPQXXXXWXVPPXORPXXPQTUMVPPPXXWXNNPPRXWQXPPXFXPXXNNPPXXXXVPPQRXPESTPPXXXXMVPPXNNPPQXPPRXXXPXPXNNPQPXXXXXPPRXPUPPQPSXXMVPPNNPXXPXRXXWVPQXPNFNLPTPPUWXVPPXPQPRXXXEWXXWXSPPPXXXQXWXRWXMVPPXPXNNNPPPQTXVPPPXRXNNPPXXXXPPJXPXXNNRWXXPPQXMPXXWFXXNNVPPXPPPRQUSWWXNNVPPXXPXXXWXQRDNNPPXPXPXEXXXWQTVPPMPXRXWXWNNWW

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask 447 T30 4p 50.0/100: 50% astral_power
Pre precombat 1 food 447 T30 4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 2 augmentation 447 T30 4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 4 no_cd_talent 447 T30 4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 5 on_use_trinket 447 T30 4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 6 on_use_trinket 447 T30 4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 7 on_use_trinket 447 T30 4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 60.0/100: 60% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil 447 T30 4p 50.0/100: 50% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 st J sunfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.946 st K moonfire Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:01.891 st L incarnation_chosen_of_elune Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, corrupting_rage
0:01.891 default D potion Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, corrupting_rage
0:01.891 default E use_items Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, corrupting_rage, elemental_potion_of_ultimate_power
0:01.891 st P starsurge Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:02.750 st P starsurge Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:03.575 st S new_moon Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:04.328 st P starsurge Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:05.122 st T half_moon Fluffy_Pillow 12.0/100: 12% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:06.144 st P starsurge Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
0:06.911 st U full_moon Fluffy_Pillow 15.0/100: 15% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), solstice, starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:08.442 st P starsurge Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), best_friends_with_aerwynn(10), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
0:09.211 st X wrath Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_aerwynn(9), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:09.979 st X wrath Fluffy_Pillow 59.0/100: 59% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_aerwynn(9), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:10.747 st W starsurge Fluffy_Pillow 75.0/100: 75% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_aerwynn(8), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:11.514 st X wrath Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_aerwynn(7), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:12.282 st X wrath Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_aerwynn(6), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:13.050 st W starsurge Fluffy_Pillow 85.0/100: 85% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_aerwynn(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:13.816 st Q sunfire Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_aerwynn(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:14.584 st X wrath Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_aerwynn(4), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:15.352 st V cancel_buff Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_aerwynn(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:15.352 st P starsurge Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), best_friends_with_aerwynn(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:16.211 st P starsurge Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord, best_friends_with_aerwynn(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.038 st P starsurge Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(2), best_friends_with_aerwynn, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:17.835 st R moonfire Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_aerwynn, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:18.602 st X wrath Fluffy_Pillow 14.0/100: 14% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:19.370 st X wrath Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:20.137 st X wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:20.906 st X wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:21.673 st W starsurge Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:22.440 st X wrath Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:23.207 st W starsurge Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:23.975 st S new_moon Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:24.859 st X wrath Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:25.629 st M warrior_of_elune Fluffy_Pillow 81.0/100: 81% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:25.629 st W starsurge Fluffy_Pillow 81.0/100: 81% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), corrupting_rage, elemental_potion_of_ultimate_power
0:26.395 st X wrath Fluffy_Pillow 53.0/100: 53% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), corrupting_rage, elemental_potion_of_ultimate_power
0:27.163 st X wrath Fluffy_Pillow 71.0/100: 71% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), corrupting_rage, elemental_potion_of_ultimate_power
0:27.929 st W starsurge Fluffy_Pillow 89.0/100: 89% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), corrupting_rage, elemental_potion_of_ultimate_power
0:28.698 st X wrath Fluffy_Pillow 61.0/100: 61% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), corrupting_rage, elemental_potion_of_ultimate_power
0:29.464 st V cancel_buff Fluffy_Pillow 77.0/100: 77% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), corrupting_rage, elemental_potion_of_ultimate_power
0:29.464 st P starsurge Fluffy_Pillow 77.0/100: 77% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), warrior_of_elune(3), corrupting_rage, elemental_potion_of_ultimate_power
0:30.324 st P starsurge Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord, warrior_of_elune(3), corrupting_rage, elemental_potion_of_ultimate_power
0:31.151 st P starsurge Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(2), warrior_of_elune(3), corrupting_rage, elemental_potion_of_ultimate_power
0:31.949 st Q sunfire Fluffy_Pillow 3.0/100: 3% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), corrupting_rage
0:32.715 st X wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), corrupting_rage
0:33.484 st P starsurge Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), corrupting_rage
0:34.252 st X wrath Fluffy_Pillow 7.0/100: 7% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), corrupting_rage
0:35.021 st X wrath Fluffy_Pillow 23.0/100: 23% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), corrupting_rage
0:35.788 st P starsurge Fluffy_Pillow 39.0/100: 39% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), corrupting_rage
0:36.556 st X wrath Fluffy_Pillow 45.0/100: 45% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), corrupting_rage
0:37.321 st X wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), corrupting_rage
0:38.087 st W starsurge Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), corrupting_rage
0:38.855 st R moonfire Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), corrupting_rage
0:39.624 st X wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), corrupting_rage
0:40.393 st W starsurge Fluffy_Pillow 80.0/100: 80% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), corrupting_rage
0:41.391 st W starsurge Fluffy_Pillow 54.0/100: 54% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage
0:42.387 st X wrath Fluffy_Pillow 33.0/100: 33% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage
0:43.382 st V cancel_buff Fluffy_Pillow 49.0/100: 49% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage
0:43.382 st P starsurge Fluffy_Pillow 49.0/100: 49% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), warrior_of_elune(3), best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage
0:44.497 st N starfire Fluffy_Pillow 21.0/100: 21% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), starlord, warrior_of_elune(3), best_friends_with_pip(8), best_friends_with_pip_static, corrupting_rage
0:45.571 st N starfire Fluffy_Pillow 39.8/100: 40% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), starlord, warrior_of_elune(2), best_friends_with_pip(7), best_friends_with_pip_static, corrupting_rage
0:46.645 st P starsurge Fluffy_Pillow 58.6/100: 59% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord, warrior_of_elune, best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage
0:47.719 st X wrath Fluffy_Pillow 24.6/100: 25% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(2), warrior_of_elune, best_friends_with_pip(5), best_friends_with_pip_static, corrupting_rage
0:48.753 st P starsurge Fluffy_Pillow 42.6/100: 43% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(2), warrior_of_elune, best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage
0:49.787 st Q sunfire Fluffy_Pillow 8.6/100: 9% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune, best_friends_with_pip(3), best_friends_with_pip_static, corrupting_rage
0:50.783 st X wrath Fluffy_Pillow 14.6/100: 15% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage
0:51.880 st X wrath Fluffy_Pillow 34.6/100: 35% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_pip, best_friends_with_pip_static, corrupting_rage
0:52.977 st X wrath Fluffy_Pillow 50.6/100: 51% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_pip_static, corrupting_rage
0:54.074 st X wrath Fluffy_Pillow 73.6/100: 74% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_pip_static, corrupting_rage
0:55.171 st W starsurge Fluffy_Pillow 91.6/100: 92% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_pip_static, corrupting_rage
0:56.268 st X wrath Fluffy_Pillow 55.6/100: 56% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_pip_static, corrupting_rage
0:57.364 st V cancel_buff Fluffy_Pillow 75.6/100: 76% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_pip_static, corrupting_rage
0:57.364 st P starsurge Fluffy_Pillow 75.6/100: 76% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), best_friends_with_pip_static, corrupting_rage
0:58.592 st P starsurge Fluffy_Pillow 44.6/100: 45% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, corrupting_rage
0:59.771 st X wrath Fluffy_Pillow 8.6/100: 9% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(2), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage
1:00.909 st O wrath Fluffy_Pillow 22.6/100: 23% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), starlord(2), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage
1:01.943 st R moonfire Fluffy_Pillow 32.6/100: 33% astral_power balance_of_all_things_arcane(8), denizen_of_the_dream(2), eclipse_lunar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(2), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, corrupting_rage
1:02.978 st P starsurge Fluffy_Pillow 40.6/100: 41% astral_power balance_of_all_things_arcane(7), denizen_of_the_dream(2), eclipse_lunar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(2), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, corrupting_rage
1:04.010 st X wrath Fluffy_Pillow 11.6/100: 12% astral_power balance_of_all_things_arcane(6), denizen_of_the_dream, eclipse_lunar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, corrupting_rage
1:05.006 st X wrath Fluffy_Pillow 28.6/100: 29% astral_power balance_of_all_things_arcane(5), denizen_of_the_dream, eclipse_lunar, friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(56), solstice, starlord(3), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, corrupting_rage
1:06.003 st P starsurge Fluffy_Pillow 44.6/100: 45% astral_power balance_of_all_things_arcane(4), denizen_of_the_dream, eclipse_lunar, friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(56), solstice, starlord(3), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, corrupting_rage
1:06.999 st Q sunfire Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, corrupting_rage
1:07.996 st T half_moon Fluffy_Pillow 21.6/100: 22% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, corrupting_rage
1:09.322 st U full_moon Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(3), best_friends_with_aerwynn_static, corrupting_rage
1:11.311 st M warrior_of_elune Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(3), best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage
1:11.311 st V cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(3), warrior_of_elune(3), best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage
1:11.311 st P starsurge Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, warrior_of_elune(3), best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage
1:12.428 st P starsurge Fluffy_Pillow 74.0/100: 74% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(4), starlord, warrior_of_elune(3), best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage
1:13.502 st P starsurge Fluffy_Pillow 46.0/100: 46% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(8), starlord(2), warrior_of_elune(3), best_friends_with_pip(8), best_friends_with_pip_static, corrupting_rage
1:14.535 st X wrath Fluffy_Pillow 20.0/100: 20% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_pip(7), best_friends_with_pip_static, corrupting_rage
1:15.531 st X wrath Fluffy_Pillow 38.0/100: 38% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage
1:16.526 st W starsurge Fluffy_Pillow 54.0/100: 54% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_pip(5), best_friends_with_pip_static, corrupting_rage
1:17.523 st X wrath Fluffy_Pillow 26.0/100: 26% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage
1:18.518 st N starfire Fluffy_Pillow 38.0/100: 38% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_pip(3), best_friends_with_pip_static, corrupting_rage
1:19.514 st N starfire Fluffy_Pillow 56.8/100: 57% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(2), best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage
1:20.509 st P starsurge Fluffy_Pillow 78.6/100: 79% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), warrior_of_elune, best_friends_with_pip, best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:21.432 st P starsurge Fluffy_Pillow 46.6/100: 47% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:22.355 st R moonfire Fluffy_Pillow 44.6/100: 45% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:23.276 st X wrath Fluffy_Pillow 50.6/100: 51% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:24.200 st W starsurge Fluffy_Pillow 78.6/100: 79% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:25.216 st Q sunfire Fluffy_Pillow 47.6/100: 48% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:26.232 st X wrath Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:27.245 st P starsurge Fluffy_Pillow 71.6/100: 72% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(28), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:28.380 st P starsurge Fluffy_Pillow 37.6/100: 38% astral_power denizen_of_the_dream, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord, warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:29.472 st X wrath Fluffy_Pillow 3.6/100: 4% astral_power denizen_of_the_dream, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:30.525 default F natures_vigil 447 T30 4p 23.6/100: 24% astral_power denizen_of_the_dream, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:30.525 st X wrath Fluffy_Pillow 23.6/100: 24% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:31.577 st P starsurge Fluffy_Pillow 39.6/100: 40% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:32.629 st X wrath Fluffy_Pillow 5.6/100: 6% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:33.642 st X wrath Fluffy_Pillow 23.6/100: 24% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:34.659 st N starfire Fluffy_Pillow 33.6/100: 34% astral_power natures_vigil, denizen_of_the_dream, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:35.582 st N starfire Fluffy_Pillow 50.4/100: 50% astral_power natures_vigil, denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:36.504 st P starsurge Fluffy_Pillow 71.2/100: 71% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:37.428 st P starsurge Fluffy_Pillow 37.2/100: 37% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:38.350 st X wrath Fluffy_Pillow 8.2/100: 8% astral_power natures_vigil, balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:39.272 st X wrath Fluffy_Pillow 28.2/100: 28% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:40.195 st X wrath Fluffy_Pillow 46.2/100: 46% astral_power natures_vigil, balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:41.117 st X wrath Fluffy_Pillow 64.2/100: 64% astral_power natures_vigil, balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:42.132 st V cancel_buff Fluffy_Pillow 82.2/100: 82% astral_power natures_vigil, balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:42.132 st P starsurge Fluffy_Pillow 82.2/100: 82% astral_power natures_vigil, balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:43.267 st P starsurge Fluffy_Pillow 46.2/100: 46% astral_power natures_vigil, balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord, best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:44.359 st Q sunfire Fluffy_Pillow 10.2/100: 10% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:45.409 st R moonfire Fluffy_Pillow 18.2/100: 18% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:46.461 st X wrath Fluffy_Pillow 24.2/100: 24% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:47.513 st P starsurge Fluffy_Pillow 40.2/100: 40% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:48.566 default E use_items Fluffy_Pillow 13.2/100: 13% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), best_friends_with_pip_static, wafting_devotion
1:48.566 st S new_moon Fluffy_Pillow 13.2/100: 13% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), best_friends_with_pip_static, wafting_devotion, kindled_soul(100)
1:49.321 st T half_moon Fluffy_Pillow 27.2/100: 27% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), best_friends_with_pip_static, kindled_soul(100)
1:50.649 st P starsurge Fluffy_Pillow 53.2/100: 53% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), best_friends_with_pip_static, kindled_soul(90)
1:51.646 st P starsurge Fluffy_Pillow 34.2/100: 34% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_pip_static, kindled_soul(85)
1:52.645 st X wrath Fluffy_Pillow 10.2/100: 10% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), best_friends_with_pip_static, kindled_soul(80)
1:53.642 st X wrath Fluffy_Pillow 26.2/100: 26% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), best_friends_with_pip_static, kindled_soul(75)
1:54.636 st X wrath Fluffy_Pillow 44.2/100: 44% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), best_friends_with_pip_static, kindled_soul(70)
1:55.633 st X wrath Fluffy_Pillow 60.2/100: 60% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), best_friends_with_pip_static, kindled_soul(65)
1:56.628 st M warrior_of_elune Fluffy_Pillow 78.2/100: 78% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), best_friends_with_pip_static, kindled_soul(60)
1:56.628 st V cancel_buff Fluffy_Pillow 78.2/100: 78% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, kindled_soul(60)
1:56.628 st P starsurge Fluffy_Pillow 78.2/100: 78% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), warrior_of_elune(3), best_friends_with_pip_static, kindled_soul(60)
1:57.744 st P starsurge Fluffy_Pillow 54.2/100: 54% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord, warrior_of_elune(3), best_friends_with_pip_static, kindled_soul(55)
1:58.817 st X wrath Fluffy_Pillow 26.2/100: 26% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(2), warrior_of_elune(3), best_friends_with_pip_static, kindled_soul(50)
1:59.850 st N starfire Fluffy_Pillow 38.2/100: 38% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(16), starlord(2), warrior_of_elune(3), best_friends_with_pip_static, kindled_soul(45)
2:00.885 st N starfire Fluffy_Pillow 57.0/100: 57% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(16), starlord(2), warrior_of_elune(2), best_friends_with_pip_static, kindled_soul(40)
2:01.918 st P starsurge Fluffy_Pillow 75.8/100: 76% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(2), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, kindled_soul(35)
2:02.875 st P starsurge Fluffy_Pillow 39.8/100: 40% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, kindled_soul(30)
2:03.797 st Q sunfire Fluffy_Pillow 7.8/100: 8% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(25)
2:04.719 st X wrath Fluffy_Pillow 13.8/100: 14% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(20)
2:05.641 st P starsurge Fluffy_Pillow 69.8/100: 70% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(15)
2:06.656 st P starsurge Fluffy_Pillow 42.8/100: 43% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(10)
2:07.672 st R moonfire Fluffy_Pillow 8.8/100: 9% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(5)
2:08.686 st X wrath Fluffy_Pillow 14.8/100: 15% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:09.700 st X wrath Fluffy_Pillow 32.8/100: 33% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:10.714 st X wrath Fluffy_Pillow 48.8/100: 49% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:11.729 st P starsurge Fluffy_Pillow 64.8/100: 65% astral_power eclipse_solar, primordial_arcanic_pulsar(32), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:12.864 st X wrath Fluffy_Pillow 30.8/100: 31% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord, warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:13.955 st P starsurge Fluffy_Pillow 46.8/100: 47% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord, warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:15.046 st X wrath Fluffy_Pillow 12.8/100: 13% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:16.098 st N starfire Fluffy_Pillow 22.8/100: 23% astral_power natures_grace, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, corrupting_rage
2:17.132 st N starfire Fluffy_Pillow 41.6/100: 42% astral_power natures_grace, primordial_arcanic_pulsar(40), starlord(2), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage
2:18.681 st P starsurge Fluffy_Pillow 59.6/100: 60% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage
2:19.714 st Q sunfire Fluffy_Pillow 28.6/100: 29% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, corrupting_rage
2:20.709 st P starsurge Fluffy_Pillow 38.6/100: 39% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, corrupting_rage
2:21.705 st X wrath Fluffy_Pillow 4.6/100: 5% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, corrupting_rage
2:22.702 st X wrath Fluffy_Pillow 20.6/100: 21% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, corrupting_rage
2:23.800 st X wrath Fluffy_Pillow 38.6/100: 39% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, corrupting_rage
2:24.898 st X wrath Fluffy_Pillow 58.6/100: 59% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, corrupting_rage
2:25.994 st X wrath Fluffy_Pillow 74.6/100: 75% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, corrupting_rage
2:27.091 st P starsurge Fluffy_Pillow 92.6/100: 93% astral_power eclipse_solar, primordial_arcanic_pulsar(48), best_friends_with_aerwynn, best_friends_with_aerwynn_static, corrupting_rage
2:28.318 st P starsurge Fluffy_Pillow 56.6/100: 57% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord, best_friends_with_aerwynn_static, corrupting_rage
2:29.498 st R moonfire Fluffy_Pillow 20.6/100: 21% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(2), best_friends_with_aerwynn_static, corrupting_rage
2:30.634 st X wrath Fluffy_Pillow 28.6/100: 29% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(2), best_friends_with_aerwynn_static, corrupting_rage
2:31.771 st P starsurge Fluffy_Pillow 44.6/100: 45% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(2), best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage
2:32.906 st U full_moon Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_pip(10), best_friends_with_pip_static
2:34.896 st P starsurge Fluffy_Pillow 69.6/100: 70% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_pip(8), best_friends_with_pip_static
2:35.892 st P starsurge Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_pip(7), best_friends_with_pip_static
2:36.887 st Q sunfire Fluffy_Pillow 20.6/100: 21% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), best_friends_with_pip(6), best_friends_with_pip_static
2:37.883 st P starsurge Fluffy_Pillow 30.6/100: 31% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), best_friends_with_pip(5), best_friends_with_pip_static
2:38.880 st S new_moon Fluffy_Pillow 2.6/100: 3% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip(4), best_friends_with_pip_static
2:39.635 st X wrath Fluffy_Pillow 16.6/100: 17% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip(4), best_friends_with_pip_static
2:40.630 st X wrath Fluffy_Pillow 39.6/100: 40% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip(3), best_friends_with_pip_static
2:41.627 st M warrior_of_elune Fluffy_Pillow 55.6/100: 56% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip(2), best_friends_with_pip_static
2:41.628 st V cancel_buff Fluffy_Pillow 55.6/100: 56% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_pip(2), best_friends_with_pip_static
2:41.628 st P starsurge Fluffy_Pillow 55.6/100: 56% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), warrior_of_elune(3), best_friends_with_pip(2), best_friends_with_pip_static
2:42.745 st P starsurge Fluffy_Pillow 31.6/100: 32% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord, warrior_of_elune(3), best_friends_with_pip, best_friends_with_pip_static
2:43.820 st N starfire Fluffy_Pillow 3.6/100: 4% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(20), starlord(2), warrior_of_elune(3), best_friends_with_pip_static
2:44.853 st N starfire Fluffy_Pillow 20.4/100: 20% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(2), warrior_of_elune(3), best_friends_with_pip_static
2:45.886 st P starsurge Fluffy_Pillow 41.2/100: 41% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(2), warrior_of_elune(2), best_friends_with_pip_static
2:46.918 st X wrath Fluffy_Pillow 12.2/100: 12% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune(2), best_friends_with_pip_static
2:47.913 st X wrath Fluffy_Pillow 28.2/100: 28% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune(2), best_friends_with_pip_static, corrupting_rage
2:48.909 st P starsurge Fluffy_Pillow 48.2/100: 48% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune(2), best_friends_with_pip_static, corrupting_rage
2:49.907 st X wrath Fluffy_Pillow 12.2/100: 12% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune(2), best_friends_with_pip_static, corrupting_rage
2:51.002 st R moonfire Fluffy_Pillow 32.2/100: 32% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(2), best_friends_with_pip_static, corrupting_rage
2:52.098 st X wrath Fluffy_Pillow 38.2/100: 38% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(2), best_friends_with_pip_static, corrupting_rage
2:53.194 st X wrath Fluffy_Pillow 59.2/100: 59% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(2), best_friends_with_pip_static, corrupting_rage
2:54.291 st W starsurge Fluffy_Pillow 84.2/100: 84% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(2), best_friends_with_pip_static, corrupting_rage
2:55.387 st V cancel_buff Fluffy_Pillow 48.2/100: 48% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), best_friends_with_pip_static, corrupting_rage
2:55.387 st P starsurge Fluffy_Pillow 48.2/100: 48% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), warrior_of_elune(2), best_friends_with_pip_static, corrupting_rage
2:56.617 st Q sunfire Fluffy_Pillow 12.2/100: 12% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, warrior_of_elune(2), best_friends_with_pip_static, corrupting_rage
2:57.797 st X wrath Fluffy_Pillow 20.2/100: 20% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, warrior_of_elune(2), best_friends_with_pip_static, corrupting_rage
2:58.979 st P starsurge Fluffy_Pillow 36.2/100: 36% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, warrior_of_elune(2), best_friends_with_pip_static, corrupting_rage
3:00.159 st N starfire Fluffy_Pillow 4.2/100: 4% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune(2), best_friends_with_pip_static, corrupting_rage
3:01.192 default F natures_vigil 447 T30 4p 21.0/100: 21% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, best_friends_with_pip_static, corrupting_rage
3:01.192 st N starfire Fluffy_Pillow 21.0/100: 21% astral_power natures_vigil, denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, best_friends_with_pip_static, corrupting_rage
3:02.226 st L incarnation_chosen_of_elune Fluffy_Pillow 37.8/100: 38% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), best_friends_with_pip_static, corrupting_rage
3:02.226 st P starsurge Fluffy_Pillow 37.8/100: 38% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), best_friends_with_pip_static, corrupting_rage
3:03.168 st T half_moon Fluffy_Pillow 11.8/100: 12% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_pip_static, corrupting_rage
3:04.374 st P starsurge Fluffy_Pillow 72.8/100: 73% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:05.213 st P starsurge Fluffy_Pillow 44.8/100: 45% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:06.050 st U full_moon Fluffy_Pillow 22.8/100: 23% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:07.890 st W starsurge Fluffy_Pillow 84.8/100: 85% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:08.813 st X wrath Fluffy_Pillow 58.8/100: 59% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:09.735 st V cancel_buff Fluffy_Pillow 78.8/100: 79% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:09.735 st P starsurge Fluffy_Pillow 78.8/100: 79% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:10.768 st P starsurge Fluffy_Pillow 50.8/100: 51% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord, best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:11.761 st X wrath Fluffy_Pillow 27.8/100: 28% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:12.719 st P starsurge Fluffy_Pillow 49.8/100: 50% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:13.676 st Q sunfire Fluffy_Pillow 25.8/100: 26% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:14.600 st P starsurge Fluffy_Pillow 35.8/100: 36% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:15.523 st R moonfire Fluffy_Pillow 16.8/100: 17% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:16.447 st X wrath Fluffy_Pillow 27.8/100: 28% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:17.369 st X wrath Fluffy_Pillow 43.8/100: 44% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:18.293 st X wrath Fluffy_Pillow 61.8/100: 62% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:19.217 default E use_items Fluffy_Pillow 77.8/100: 78% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:19.217 st W starsurge Fluffy_Pillow 77.8/100: 78% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(100)
3:20.139 st X wrath Fluffy_Pillow 49.8/100: 50% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
3:21.132 st X wrath Fluffy_Pillow 67.8/100: 68% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(95)
3:22.129 st W starsurge Fluffy_Pillow 85.8/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(90)
3:23.127 st X wrath Fluffy_Pillow 57.8/100: 58% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(85)
3:24.123 st S new_moon Fluffy_Pillow 75.8/100: 76% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(80)
3:24.878 st P starsurge Fluffy_Pillow 87.8/100: 88% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), best_friends_with_pip_static, corrupting_rage, kindled_soul(75)
3:25.992 st P starsurge Fluffy_Pillow 59.8/100: 60% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord, best_friends_with_pip_static, corrupting_rage, kindled_soul(70)
3:27.065 st P starsurge Fluffy_Pillow 33.8/100: 34% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(65)
3:28.099 st X wrath Fluffy_Pillow 7.8/100: 8% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(60)
3:29.095 st X wrath Fluffy_Pillow 23.8/100: 24% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(55)
3:30.092 st X wrath Fluffy_Pillow 41.8/100: 42% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage, kindled_soul(50)
3:31.089 st Q sunfire Fluffy_Pillow 57.8/100: 58% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage, kindled_soul(45)
3:32.086 st X wrath Fluffy_Pillow 63.8/100: 64% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage, kindled_soul(40)
3:33.082 st W starsurge Fluffy_Pillow 81.8/100: 82% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_urctos(9), best_friends_with_urctos_static, kindled_soul(35)
3:34.079 st X wrath Fluffy_Pillow 53.8/100: 54% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos(8), best_friends_with_urctos_static, kindled_soul(30)
3:35.074 st R moonfire Fluffy_Pillow 71.8/100: 72% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos(7), best_friends_with_urctos_static, kindled_soul(25)
3:36.071 st W starsurge Fluffy_Pillow 84.8/100: 85% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos(6), best_friends_with_urctos_static, kindled_soul(20)
3:37.068 st X wrath Fluffy_Pillow 56.8/100: 57% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_urctos(5), best_friends_with_urctos_static, kindled_soul(15)
3:38.064 st M warrior_of_elune Fluffy_Pillow 74.8/100: 75% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_urctos(4), best_friends_with_urctos_static, kindled_soul(10)
3:38.064 st V cancel_buff Fluffy_Pillow 74.8/100: 75% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), best_friends_with_urctos(4), best_friends_with_urctos_static, kindled_soul(10)
3:38.064 st P starsurge Fluffy_Pillow 74.8/100: 75% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), warrior_of_elune(3), best_friends_with_urctos(4), best_friends_with_urctos_static, kindled_soul(10)
3:39.182 st P starsurge Fluffy_Pillow 50.8/100: 51% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord, warrior_of_elune(3), best_friends_with_urctos(2), best_friends_with_urctos_static, kindled_soul(5)
3:40.257 st X wrath Fluffy_Pillow 22.8/100: 23% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(2), warrior_of_elune(3), best_friends_with_urctos, best_friends_with_urctos_static
3:41.291 st P starsurge Fluffy_Pillow 38.8/100: 39% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(2), warrior_of_elune(3), best_friends_with_urctos_static
3:42.324 st X wrath Fluffy_Pillow 14.8/100: 15% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static
3:43.322 st N starfire Fluffy_Pillow 35.8/100: 36% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_urctos(11), best_friends_with_urctos_static
3:44.318 st N starfire Fluffy_Pillow 52.6/100: 53% astral_power natures_grace, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(2), best_friends_with_urctos(10), best_friends_with_urctos_static
3:45.317 st N starfire Fluffy_Pillow 71.4/100: 71% astral_power natures_grace, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune, best_friends_with_urctos(9), best_friends_with_urctos_static
3:46.312 st P starsurge Fluffy_Pillow 90.2/100: 90% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), best_friends_with_urctos(8), best_friends_with_urctos_static
3:47.308 st P starsurge Fluffy_Pillow 58.2/100: 58% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), best_friends_with_urctos(7), best_friends_with_urctos_static
3:48.304 st P starsurge Fluffy_Pillow 56.2/100: 56% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(3), best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage
3:49.209 st Q sunfire Fluffy_Pillow 30.2/100: 30% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage
3:50.116 st T half_moon Fluffy_Pillow 36.2/100: 36% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage
3:51.322 st X wrath Fluffy_Pillow 67.2/100: 67% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage
3:52.321 st V cancel_buff Fluffy_Pillow 88.2/100: 88% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage
3:52.321 st P starsurge Fluffy_Pillow 88.2/100: 88% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage
3:53.436 st P starsurge Fluffy_Pillow 62.2/100: 62% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord, best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage
3:54.510 st P starsurge Fluffy_Pillow 38.2/100: 38% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(2), best_friends_with_urctos_static, corrupting_rage
3:55.544 st X wrath Fluffy_Pillow 10.2/100: 10% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), best_friends_with_urctos_static, corrupting_rage
3:56.539 st R moonfire Fluffy_Pillow 26.2/100: 26% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), best_friends_with_urctos_static, corrupting_rage
3:57.536 st X wrath Fluffy_Pillow 34.2/100: 34% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), best_friends_with_urctos_static, corrupting_rage
3:58.532 st N starfire Fluffy_Pillow 50.2/100: 50% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), best_friends_with_urctos_static, corrupting_rage
4:00.025 st N starfire Fluffy_Pillow 64.2/100: 64% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(3), best_friends_with_urctos_static, corrupting_rage
4:01.519 st P starsurge Fluffy_Pillow 76.2/100: 76% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), best_friends_with_urctos_static, corrupting_rage
4:02.515 st P starsurge Fluffy_Pillow 42.2/100: 42% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), best_friends_with_urctos_static, corrupting_rage
4:03.510 st X wrath Fluffy_Pillow 10.2/100: 10% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), best_friends_with_urctos_static, corrupting_rage
4:04.505 st X wrath Fluffy_Pillow 31.2/100: 31% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), best_friends_with_urctos_static, corrupting_rage
4:05.500 st X wrath Fluffy_Pillow 51.2/100: 51% astral_power balance_of_all_things_nature(5), eclipse_solar, primordial_arcanic_pulsar(24), solstice, starlord(3), best_friends_with_urctos_static, corrupting_rage
4:06.597 st X wrath Fluffy_Pillow 73.2/100: 73% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(24), solstice, starlord(3), best_friends_with_urctos_static, corrupting_rage
4:07.693 st P starsurge Fluffy_Pillow 91.2/100: 91% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(24), best_friends_with_urctos_static, corrupting_rage
4:08.922 st P starsurge Fluffy_Pillow 55.2/100: 55% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(28), starlord, best_friends_with_urctos_static, corrupting_rage
4:10.102 st J sunfire Fluffy_Pillow 21.2/100: 21% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(2), best_friends_with_urctos_static, corrupting_rage
4:11.238 st X wrath Fluffy_Pillow 29.2/100: 29% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(2), best_friends_with_urctos_static, corrupting_rage
4:12.375 st P starsurge Fluffy_Pillow 47.2/100: 47% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(2), best_friends_with_urctos_static, corrupting_rage
4:13.512 st X wrath Fluffy_Pillow 13.2/100: 13% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos_static, corrupting_rage
4:14.609 st X wrath Fluffy_Pillow 29.2/100: 29% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos_static, corrupting_rage
4:15.705 st N starfire Fluffy_Pillow 47.2/100: 47% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos_static, corrupting_rage
4:17.346 st N starfire Fluffy_Pillow 61.2/100: 61% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos_static, corrupting_rage
4:18.841 st R moonfire Fluffy_Pillow 75.2/100: 75% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(3), best_friends_with_urctos_static, corrupting_rage
4:19.836 st W starsurge Fluffy_Pillow 86.2/100: 86% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(3), best_friends_with_urctos_static, corrupting_rage
4:20.832 st X wrath Fluffy_Pillow 52.2/100: 52% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_urctos_static, corrupting_rage
4:21.829 st X wrath Fluffy_Pillow 72.2/100: 72% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_urctos_static, corrupting_rage
4:22.826 st P starsurge Fluffy_Pillow 90.2/100: 90% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), solstice, best_friends_with_urctos_static, corrupting_rage
4:24.053 st P starsurge Fluffy_Pillow 60.2/100: 60% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), solstice, starlord, best_friends_with_urctos_static, corrupting_rage
4:25.232 st Q sunfire Fluffy_Pillow 24.2/100: 24% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(2), best_friends_with_urctos_static, corrupting_rage
4:26.367 st X wrath Fluffy_Pillow 30.2/100: 30% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(2), best_friends_with_urctos_static, corrupting_rage
4:27.503 st M warrior_of_elune Fluffy_Pillow 50.2/100: 50% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(2), best_friends_with_urctos_static, corrupting_rage
4:27.503 st P starsurge Fluffy_Pillow 50.2/100: 50% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(2), warrior_of_elune(3), best_friends_with_urctos_static, corrupting_rage
4:28.639 st X wrath Fluffy_Pillow 14.2/100: 14% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, corrupting_rage
4:29.736 st X wrath Fluffy_Pillow 32.2/100: 32% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, corrupting_rage
4:30.833 st W starsurge Fluffy_Pillow 50.2/100: 50% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, corrupting_rage
4:31.929 default F natures_vigil 447 T30 4p 14.2/100: 14% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, corrupting_rage
4:31.929 st X wrath Fluffy_Pillow 14.2/100: 14% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, corrupting_rage
4:33.026 st X wrath Fluffy_Pillow 32.2/100: 32% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, corrupting_rage
4:34.121 st N starfire Fluffy_Pillow 42.2/100: 42% astral_power natures_vigil, denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, corrupting_rage
4:35.118 st N starfire Fluffy_Pillow 59.0/100: 59% astral_power natures_vigil, denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(2), best_friends_with_urctos_static, corrupting_rage
4:36.114 st V cancel_buff Fluffy_Pillow 79.8/100: 80% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
4:36.114 st P starsurge Fluffy_Pillow 79.8/100: 80% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
4:37.229 st P starsurge Fluffy_Pillow 47.8/100: 48% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord, warrior_of_elune, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:38.132 st X wrath Fluffy_Pillow 23.8/100: 24% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(2), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:39.002 st P starsurge Fluffy_Pillow 73.8/100: 74% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(2), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:39.872 st P starsurge Fluffy_Pillow 50.8/100: 51% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:40.793 st P starsurge Fluffy_Pillow 29.8/100: 30% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:41.716 st R moonfire Fluffy_Pillow 3.8/100: 4% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:42.637 st Q sunfire Fluffy_Pillow 11.8/100: 12% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:43.559 st U full_moon Fluffy_Pillow 17.8/100: 18% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:45.400 st S new_moon Fluffy_Pillow 69.8/100: 70% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:46.153 st W starsurge Fluffy_Pillow 86.8/100: 87% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:47.075 st W starsurge Fluffy_Pillow 58.8/100: 59% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune, best_friends_with_urctos(11), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:47.998 st X wrath Fluffy_Pillow 32.8/100: 33% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune, best_friends_with_urctos(10), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:48.923 st N starfire Fluffy_Pillow 46.8/100: 47% astral_power natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune, best_friends_with_urctos(10), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:49.845 st N starfire Fluffy_Pillow 63.6/100: 64% astral_power natures_grace, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune, best_friends_with_urctos(9), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:50.766 st V cancel_buff Fluffy_Pillow 80.4/100: 80% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), best_friends_with_urctos(8), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:50.766 st P starsurge Fluffy_Pillow 80.4/100: 80% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, best_friends_with_urctos(8), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:51.797 st P starsurge Fluffy_Pillow 48.4/100: 48% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord, best_friends_with_urctos(7), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:52.792 st X wrath Fluffy_Pillow 14.4/100: 14% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(2), best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage
4:53.826 st X wrath Fluffy_Pillow 34.4/100: 34% astral_power balance_of_all_things_nature(5), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(2), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage
4:54.858 st P starsurge Fluffy_Pillow 62.4/100: 62% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), solstice, starlord(2), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage
4:55.995 st X wrath Fluffy_Pillow 28.4/100: 28% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage
4:57.093 st X wrath Fluffy_Pillow 46.4/100: 46% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage
4:58.189 st X wrath Fluffy_Pillow 62.4/100: 62% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos_static, corrupting_rage
4:59.284 st W starsurge Fluffy_Pillow 78.4/100: 78% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos_static, corrupting_rage
5:00.381 st X wrath Fluffy_Pillow 44.4/100: 44% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_urctos_static, corrupting_rage
5:01.477 st Q sunfire Fluffy_Pillow 60.4/100: 60% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_urctos_static, corrupting_rage
5:02.572 st R moonfire Fluffy_Pillow 66.4/100: 66% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_urctos_static, corrupting_rage
5:03.669 default D potion Fluffy_Pillow 74.4/100: 74% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_urctos_static, corrupting_rage
5:03.669 st N starfire Fluffy_Pillow 74.4/100: 74% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:05.312 st N starfire Fluffy_Pillow 86.4/100: 86% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:06.805 st P starsurge Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:07.923 st P starsurge Fluffy_Pillow 66.0/100: 66% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:08.997 st X wrath Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:10.031 st P starsurge Fluffy_Pillow 54.0/100: 54% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:11.065 st X wrath Fluffy_Pillow 23.0/100: 23% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:12.161 st P starsurge Fluffy_Pillow 41.0/100: 41% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:13.258 st X wrath Fluffy_Pillow 5.0/100: 5% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:14.354 default E use_items Fluffy_Pillow 23.0/100: 23% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:14.354 st X wrath Fluffy_Pillow 23.0/100: 23% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
5:15.450 st X wrath Fluffy_Pillow 43.0/100: 43% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
5:16.547 st X wrath Fluffy_Pillow 59.0/100: 59% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
5:17.644 st W starsurge Fluffy_Pillow 75.0/100: 75% astral_power denizen_of_the_dream, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
5:18.741 st Q sunfire Fluffy_Pillow 45.0/100: 45% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, solstice, starlord(3), best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
5:19.739 st T half_moon Fluffy_Pillow 53.0/100: 53% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, solstice, starlord(3), best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
5:21.067 st V cancel_buff Fluffy_Pillow 79.0/100: 79% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, solstice, starlord(3), best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
5:21.067 st P starsurge Fluffy_Pillow 79.0/100: 79% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, solstice, best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
5:22.183 st P starsurge Fluffy_Pillow 58.0/100: 58% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord, best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
5:23.256 st M warrior_of_elune Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(2), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
5:23.256 st P starsurge Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(2), warrior_of_elune(3), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
5:24.289 st X wrath Fluffy_Pillow 10.0/100: 10% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
5:25.287 st R moonfire Fluffy_Pillow 26.0/100: 26% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
5:26.284 st X wrath Fluffy_Pillow 32.0/100: 32% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
5:27.281 st W starsurge Fluffy_Pillow 50.0/100: 50% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
5:28.277 st X wrath Fluffy_Pillow 22.0/100: 22% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
5:29.273 st W starsurge Fluffy_Pillow 38.0/100: 38% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
5:30.271 st N starfire Fluffy_Pillow 12.0/100: 12% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
5:31.266 st N starfire Fluffy_Pillow 60.8/100: 61% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
5:32.263 st W starsurge Fluffy_Pillow 81.6/100: 82% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
5:33.260 st W starsurge Fluffy_Pillow 54.6/100: 55% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)

Stats

Level Bonus (70) Race Bonus (tauren) Raid-Buffed Unbuffed Gear Amount
Strength 898 2 986 900 0
Agility 2089 -2 2173 2087 0
Stamina 3848 2 33988 32369 28452
Intellect 2089 -2 13166 12370 9694 (5819)
Spirit 0 0 0 0 0
Health 679760 679760 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13166 12370 0
Crit 26.84% 20.63% 2813
Haste 22.62% 22.62% 3846
Versatility 6.13% 1.13% 232
Mana Regen 2560 2560 0
Attack Power 13693 12865 0
Mastery 28.85% 28.85% 7443
Armor 4288 4288 4288
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 464.00
Local Head Benevolent Embersage's Casque
ilevel: 470, stats: { 585 Armor, +3163 Sta, +655 Crit, +307 Haste, +786 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }, enchant: incandescent_essence
Local Neck Eye of the Rising Flame
ilevel: 470, stats: { +1779 Sta, +233 Haste, +1397 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Life-Bound Shoulderpads
ilevel: 447, stats: { 456 Armor, +1796 Sta, +328 Mastery, +328 Haste, +476 AgiInt }
item effects: { equip: Toxified }
Local Chest Benevolent Embersage's Robe
ilevel: 447, stats: { 664 Armor, +2395 Sta, +605 Crit, +269 Mastery, +635 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 470, stats: { 439 Armor, +2372 Sta, +497 Haste, +224 Mastery, +590 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 447, stats: { 581 Armor, +2395 Sta, +596 Haste, +278 Mastery, +635 AgiInt }, enchant: { +155 StrAgiInt, +41 Vers (lambent_armor_kit_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 470, stats: { 488 Armor, +2372 Sta, +257 Crit, +412 Haste, +590 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Thermal Bindings
ilevel: 470, stats: { 390 Armor, +1779 Sta, +178 Crit, +363 Mastery, +442 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Benevolent Embersage's Talons
ilevel: 447, stats: { 373 Armor, +1796 Sta, +191 Vers, +464 Mastery, +476 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 470, stats: { +1779 Sta, +466 Haste, +1165 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 470, stats: { +1779 Sta, +1118 Crit, +512 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 470, stats: { +747 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 470, stats: { +687 Mastery }
item effects: { use: Balefire Branch }
Local Back Drape of the Loyal Vassal
ilevel: 470, stats: { 312 Armor, +1779 Sta, +305 Haste, +236 Mastery, +442 StrAgiInt }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 470, weapon: { 508 - 654, 2.6 }, stats: { +393 Int, +1896 Int, +1581 Sta, +145 Haste, +335 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 470, stats: { +1206 Int, +1581 Sta, +162 Haste, +319 Mastery }

Talents

RowDruid Talents [31]
1
2
3
4
5
6
7
8
9
10
RowBalance Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

druid="447 T30 4p"
source=default
spec=balance
level=70
race=tauren
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:hissing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Balance APL can be found at https://balance-simc.github.io/Balance-SimC/balance.txt

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=470,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=470,gem_id=192961/192961/192961
shoulders=lifebound_shoulderpads,id=193406,bonus_id=8836/1576/8797/8960,ilevel=447,crafted_stats=49/36
back=drape_of_the_loyal_vassal,id=158375,bonus_id=4795,ilevel=470
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=447,enchant_id=6625
wrists=thermal_bindings,id=134461,bonus_id=4795,ilevel=470,gem_id=192961
hands=benevolent_embersages_talons,id=207255,bonus_id=4795,ilevel=447
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=447,enchant_id=6830
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=470
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=470
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=470
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=470,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=470

# Gear Summary
# gear_ilvl=464.25
# gear_stamina=28452
# gear_intellect=9694
# gear_crit_rating=2813
# gear_haste_rating=3846
# gear_mastery_rating=7443
# gear_versatility_rating=232
# gear_armor=4288
# set_bonus=tier30_2pc=1
# set_bonus=tier30_4pc=1

447+460 2p+2p : 186087 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
186087.1 186087.1 184.9 / 0.099% 26069.3 / 14.0% 14972.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.1 12.0 Astral Power 0.00% 66.4 99.8% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
447+460 2p+2p 186087
Astral Smolder 11807 6.3% 63.2 4.70s 55931 0 Periodic 115.7 30542 0 30542 0.0% 77.1%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 63.19 0.00 115.71 115.71 47.38 0.0000 2.0000 3534306.91 3534306.91 0.00% 15271.67 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 115.71 67 160 30542.05 7892 107653 30551.45 22807 39145 3534307 3534307 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Denizen of the Dream 0 (5208) 0.0% (2.8%) 8.5 32.39s 184170 0

Stats Details: Denizen Of The Dream

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.47 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Denizen Of The Dream

  • id:394065
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394065
  • name:Denizen of the Dream
  • school:physical
  • tooltip:
  • description:Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.
    Fey Missile 15448  / 5208 2.8% 148.0 1.77s 10541 8092 Direct 147.1 8205 17046 10608 27.2%

Stats Details: Fey Missile

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 148.01 147.08 0.00 0.00 0.00 1.3027 0.0000 1560266.11 1560266.11 0.00% 8091.79 8091.79
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.82% 107.10 24 254 8205.07 5414 14289 8196.04 7265 9923 878726 878726 0.00%
crit 27.18% 39.98 3 96 17045.71 11846 29720 17032.50 14872 20610 681540 681540 0.00%

Action Details: Fey Missile

  • id:188046
  • school:astral
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.509
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.236000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:188046
  • name:Fey Missile
  • school:astral
  • tooltip:
  • description:{$@spelldesc187875=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$188083d=30 seconds}.}

Action Priority List

    default
    [ ]:4315.22
Hungering Shadowflame 2929 1.6% 17.2 16.42s 51209 0 Direct 17.2 39797 81807 51219 27.2%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.18 17.18 0.00 0.00 0.00 0.0000 0.0000 879603.20 879603.20 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.81% 12.51 3 26 39797.22 26959 154597 39683.77 26959 91661 497678 497678 0.00%
crit 27.19% 4.67 0 14 81807.24 54997 315378 80444.21 0 297426 381925 381925 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24191.79
  • base_dd_max:24191.79
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 5561 3.0% 33.8 8.74s 49315 0 Direct 33.7 38601 78673 49453 27.1%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.78 33.69 0.00 0.00 0.00 0.0000 0.0000 1666012.44 1666012.44 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.92% 24.56 9 44 38600.94 38162 43768 38600.15 38162 40132 948189 948189 0.00%
crit 27.08% 9.12 0 23 78672.95 77851 89287 78655.47 0 83093 717823 717823 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:34245.43
  • base_dd_max:34245.43
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 11975 6.4% 14.3 21.61s 250448 256622 Direct 14.3 8884 18432 12120 33.9%
Periodic 307.0 8020 16935 11115 34.7% 99.3%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.32 14.32 307.00 307.00 13.32 0.9760 0.9718 3585773.35 3585773.35 0.00% 11481.05 256621.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.12% 9.47 2 17 8884.19 6687 15571 8877.80 7686 10443 84106 84106 0.00%
crit 33.88% 4.85 0 12 18431.83 13549 32897 18335.02 0 26330 89422 89422 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 65.28% 200.42 139 262 8019.56 3449 14699 8022.04 7637 8545 1607320 1607320 0.00%
crit 34.72% 106.58 67 150 16934.87 2643 29987 16941.46 15871 18379 1804925 1804925 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.39

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.39
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    st
    [K]:1.31
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [S]:13.00
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
New Moon (Talent) 0 (16578) 0.0% (8.9%) 16.9 18.01s 292911 243759

Stats Details: Moons Talent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.95 0.00 0.00 0.00 0.00 1.2017 0.0000 0.00 0.00 0.00% 243758.56 243758.56

Action Details: Moons Talent

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
    Full Moon 5982 3.2% 5.3 63.20s 340331 182564 Direct 5.2 232727 470127 342348 46.2%

Stats Details: Full Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.28 5.25 0.00 0.00 0.00 1.8643 0.0000 1796792.94 1796792.94 0.00% 182563.80 182563.80
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.83% 2.83 0 6 232727.05 159136 382741 228937.54 0 381385 657538 657538 0.00%
crit 46.17% 2.42 0 6 470126.91 324638 769989 450844.15 0 701043 1139255 1139255 0.00%

Action Details: Full Moon

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:50.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Action Priority List

    st
    [V]:5.34
  • if_expr:astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    New Moon 4532 2.4% 6.0 53.83s 225823 299308 Direct 6.0 146824 317004 227194 47.2%

Stats Details: New Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.00 5.96 0.00 0.00 0.00 0.7545 0.0000 1354667.97 1354667.97 0.00% 299307.99 299307.99
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.76% 3.15 0 7 146824.20 87146 228090 144807.51 0 221879 461836 461836 0.00%
crit 47.24% 2.82 0 7 317003.52 180014 465303 312503.89 0 450355 892832 892832 0.00%

Action Details: New Moon

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Action Priority List

    st
    [T]:6.01
  • if_expr:astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Half Moon 6064 3.3% 5.7 57.84s 319730 259841 Direct 5.6 207078 421425 321318 53.3%

Stats Details: Half Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.67 5.64 0.00 0.00 0.00 1.2305 0.0000 1813169.68 1813169.68 0.00% 259840.88 259840.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 46.66% 2.63 0 7 207077.53 115316 323835 200955.96 0 319355 545131 545131 0.00%
crit 53.34% 3.01 0 7 421424.95 246761 679116 415764.25 0 679116 1268039 1268039 0.00%

Action Details: Half Moon

  • id:274282
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:24.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.875000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274282
  • name:Half Moon
  • school:astral
  • tooltip:
  • description:Deals {$s1=0} Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates {$=}{{$m3=240}/10} Astral Power.|r

Action Priority List

    st
    [U]:5.70
  • if_expr:astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (17893) 0.0% (9.6%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 6977 3.8% 93.8 3.14s 22281 0 Direct 93.6 15014 31819 22338 43.6%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.81 93.57 0.00 0.00 0.00 0.0000 0.0000 2090233.35 2090233.35 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.41% 52.79 24 83 15014.40 9867 28916 15015.59 13632 17107 792564 792564 0.00%
crit 43.59% 40.78 19 69 31818.52 20129 58988 31821.63 28481 36191 1297670 1297670 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 6981 3.8% 94.1 3.14s 22222 0 Direct 93.9 14997 31796 22281 43.4%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 94.12 93.87 0.00 0.00 0.00 0.0000 0.0000 2091524.71 2091524.71 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.65% 53.18 29 85 14997.37 9838 28916 14998.04 13812 16611 797510 797510 0.00%
crit 43.35% 40.70 19 67 31795.84 20069 58988 31805.82 28475 36028 1294015 1294015 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 3935 2.1% 6.3 47.95s 188325 0 Direct 6.2 126297 268328 188790 44.0%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.26 6.24 0.00 0.00 0.00 0.0000 0.0000 1178989.57 1178989.57 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 55.99% 3.50 0 8 126297.46 82781 231658 125246.46 0 226117 441574 441574 0.00%
crit 44.01% 2.75 0 7 268328.33 168873 496362 261745.06 0 474190 737416 737416 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 4866 2.6% 26.1 11.44s 56088 62230 Direct 27.1 38198 77825 54014 39.9%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.05 27.05 0.00 0.00 0.00 0.9013 0.0000 1461229.20 1461229.20 0.00% 62230.28 62230.28
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 60.09% 16.26 6 29 38198.49 17062 72375 38208.33 31358 43644 620909 620909 0.00%
crit 39.91% 10.80 2 21 77824.97 34807 143251 77859.68 58069 93571 840320 840320 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    st
    [L]:1.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
    st
    [P]:25.12
  • if_expr:variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Warrior of Elune2024251-1.000Spell DataNo-stacks
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Starsurge 56911 (76933) 30.6% (41.3%) 114.5 2.60s 200996 201535 Direct 114.3 (152.0) 102157 215380 148997 41.4% (41.9%)

Stats Details: Starsurge

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 114.54 114.29 0.00 0.00 0.00 0.9973 0.0000 17029813.07 17029813.07 0.00% 201534.77 201534.77
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.63% 67.01 40 94 102156.61 75168 191549 102172.54 94548 110019 6845106 6845106 0.00%
crit 41.37% 47.29 26 73 215379.86 153342 390759 215490.47 197245 238065 10184707 10184707 0.00%

Action Details: Starsurge

  • id:78674
  • school:astral
  • range:45.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:36.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.455000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.18

Spelldata

  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$s1=0} Astral damage.

Action Priority List

    st
    [Q]:84.70
  • if_expr:variable.starsurge_condition1
    st
    [X]:29.83
  • if_expr:variable.starsurge_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Flat Cost Incarnation: Chosen of Elune1025603-8.000Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Goldrinn's Fang 20021 10.8% 37.8 7.86s 158341 0 Direct 37.7 107546 226136 159087 43.5%

Stats Details: Goldrinns Fang

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.84 37.66 0.00 0.00 0.00 0.0000 0.0000 5991503.52 5991503.52 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.54% 21.29 6 41 107545.93 78600 197553 107579.45 93500 126393 2290016 2290016 0.00%
crit 43.46% 16.37 3 32 226135.58 160343 408600 226210.12 195793 271700 3701488 3701488 0.00%

Action Details: Goldrinns Fang

  • id:394047
  • school:astral
  • range:60.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.852000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10

Spelldata

  • id:394047
  • name:Goldrinn's Fang
  • school:astral
  • tooltip:Deals {$m1=0} Arcane damage.
  • description:Deals {$m1=0} Arcane damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountPower of Goldrinn3940462PCT1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Friend of the Fae39408310.100Spell Data
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Incarnation: Chosen of Elune10256020.100Spell Data
Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Dot / Debuff on Target Moonfire16481250.283Mastery
Sunfire16481550.283Mastery
Waning Twilight39395710.100
Sunfire 11800 6.3% 17.4 18.04s 203295 207618 Direct 17.4 8722 17986 12262 38.2%
Periodic 308.0 7734 15984 10787 37.0% 99.6%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.39 17.39 307.96 307.96 16.39 0.9792 0.9719 3535104.21 3535104.21 0.00% 11175.76 207617.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.79% 10.74 3 19 8722.39 5460 15360 8715.53 7580 10047 93730 93730 0.00%
crit 38.21% 6.64 1 16 17985.85 11138 29833 17983.53 13695 24222 119504 119504 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 63.00% 194.01 136 255 7734.06 9 13363 7732.53 7275 8118 1500478 1500478 0.00%
crit 37.00% 113.95 72 160 15984.34 5992 27261 15985.72 14994 17146 1821392 1821392 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.26
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    st
    [J]:1.60
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [R]:15.79
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (3100) 0.0% (1.7%) 8.5 30.88s 109889 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.45 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 1614 0.9% 8.5 30.88s 57220 0 Direct 8.5 44589 90902 57217 27.3%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.45 8.45 0.00 0.00 0.00 0.0000 0.0000 483719.54 483719.54 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.73% 6.15 0 21 44589.09 44043 50512 44576.79 0 49974 274151 274151 0.00%
crit 27.27% 2.31 0 9 90901.90 89847 103045 81955.09 0 103045 209568 209568 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:39522.22
  • base_dd_max:39522.22
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 1486 0.8% 16.4 15.04s 27170 0 Direct 16.4 21206 43223 27171 27.1%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.39 16.39 0.00 0.00 0.00 0.0000 0.0000 445252.17 445252.17 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.91% 11.95 2 33 21205.77 20957 24036 21203.79 20957 22625 253378 253378 0.00%
crit 27.09% 4.44 0 14 43222.99 42752 49033 42689.00 0 49033 191874 191874 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18805.57
  • base_dd_max:18805.57
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 17437 9.4% 114.6 2.56s 45551 47738 Direct 114.2 30402 63779 45714 45.9%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 114.64 114.23 0.00 0.00 0.00 0.9542 0.0000 5221728.39 5221728.39 0.00% 47737.59 47737.59
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.13% 61.83 36 89 30401.60 12615 101055 30403.14 27408 33965 1879697 1879697 0.00%
crit 45.87% 52.40 29 79 63779.16 25734 208373 63782.21 54964 72090 3342032 3342032 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    st
    [M]:0.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
    st
    [Y]:112.95

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.400Spell Data
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
447+460 2p+2p
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+460 2p+2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+460 2p+2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+460 2p+2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 182.90s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    st
    [N]:2.00
  • if_expr:variable.cd_condition_st

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.7 70.28s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.66 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+460 2p+2p
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:57075.72
  • base_dd_max:57075.72
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.32s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.75 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+460 2p+2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.75
Elemental Potion of Ultimate Power 1.5 307.37s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.46 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.46
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
Warrior of Elune 6.1 48.33s

Stats Details: Warrior Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.13 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Warrior Of Elune

  • id:202425
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202425
  • name:Warrior of Elune
  • school:arcane
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.

Action Priority List

    st
    [O]:6.13
  • if_expr:variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 8.7 1.4 36.2s 33.9s 8.5s 24.89% 28.75% 1.4 (6.9) 8.5

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.4s
  • trigger_min/max:2.8s / 51.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:22.10% / 27.81%

Stack Uptimes

  • balance_of_all_things_arcane_1:2.87%
  • balance_of_all_things_arcane_2:2.93%
  • balance_of_all_things_arcane_3:2.99%
  • balance_of_all_things_arcane_4:3.01%
  • balance_of_all_things_arcane_5:3.03%
  • balance_of_all_things_arcane_6:3.28%
  • balance_of_all_things_arcane_7:3.38%
  • balance_of_all_things_arcane_8:3.39%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 18.0 3.5 17.0s 14.1s 8.4s 50.39% 54.47% 3.5 (20.3) 17.4

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 50.8s
  • trigger_min/max:0.0s / 39.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.2s
  • uptime_min/max:46.03% / 54.32%

Stack Uptimes

  • balance_of_all_things_nature_1:5.84%
  • balance_of_all_things_nature_2:5.94%
  • balance_of_all_things_nature_3:6.05%
  • balance_of_all_things_nature_4:6.17%
  • balance_of_all_things_nature_5:6.32%
  • balance_of_all_things_nature_6:6.49%
  • balance_of_all_things_nature_7:6.67%
  • balance_of_all_things_nature_8:6.91%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Best Friends with Aerwynn 2.8 0.0 71.2s 71.2s 10.8s 10.01% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 323.9s
  • trigger_min/max:12.0s / 323.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 34.53%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.89%
  • best_friends_with_aerwynn_2:0.90%
  • best_friends_with_aerwynn_3:0.90%
  • best_friends_with_aerwynn_4:0.90%
  • best_friends_with_aerwynn_5:0.91%
  • best_friends_with_aerwynn_6:0.91%
  • best_friends_with_aerwynn_7:0.91%
  • best_friends_with_aerwynn_8:0.92%
  • best_friends_with_aerwynn_9:0.92%
  • best_friends_with_aerwynn_10:0.92%
  • best_friends_with_aerwynn_11:0.93%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 113.7s 71.2s 45.0s 33.19% 0.00% 69.7 (69.7) 0.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 353.8s
  • trigger_min/max:12.0s / 323.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 304.9s
  • uptime_min/max:0.00% / 93.72%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.19%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.4s 70.4s 10.8s 9.93% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 322.7s
  • trigger_min/max:12.0s / 322.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 32.59%

Stack Uptimes

  • best_friends_with_pip_1:0.89%
  • best_friends_with_pip_2:0.89%
  • best_friends_with_pip_3:0.89%
  • best_friends_with_pip_4:0.90%
  • best_friends_with_pip_5:0.90%
  • best_friends_with_pip_6:0.90%
  • best_friends_with_pip_7:0.91%
  • best_friends_with_pip_8:0.91%
  • best_friends_with_pip_9:0.91%
  • best_friends_with_pip_10:0.91%
  • best_friends_with_pip_11:0.92%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 113.3s 70.4s 45.2s 32.69% 0.00% 68.4 (68.4) 0.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 340.5s
  • trigger_min/max:12.0s / 322.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 277.6s
  • uptime_min/max:0.00% / 95.62%

Stack Uptimes

  • best_friends_with_pip_static_1:32.69%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 69.9s 69.9s 10.8s 10.20% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 326.9s
  • trigger_min/max:12.0s / 326.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 34.44%

Stack Uptimes

  • best_friends_with_urctos_1:0.91%
  • best_friends_with_urctos_2:0.91%
  • best_friends_with_urctos_3:0.92%
  • best_friends_with_urctos_4:0.92%
  • best_friends_with_urctos_5:0.92%
  • best_friends_with_urctos_6:0.93%
  • best_friends_with_urctos_7:0.93%
  • best_friends_with_urctos_8:0.93%
  • best_friends_with_urctos_9:0.94%
  • best_friends_with_urctos_10:0.94%
  • best_friends_with_urctos_11:0.94%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 1.0 113.1s 69.9s 45.9s 34.13% 0.00% 70.6 (70.6) 0.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 353.0s
  • trigger_min/max:12.0s / 326.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 308.3s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:34.13%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 61.5s 58.0s 49.6s 79.99% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 325.0s
  • trigger_min/max:15.0s / 295.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 353.0s
  • uptime_min/max:47.47% / 100.00%

Stack Uptimes

  • corrupting_rage_1:79.99%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Denizen of the Dream 8.5 0.0 45.3s 32.2s 41.1s 57.06% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_denizen_of_the_dream
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 256.9s
  • trigger_min/max:0.0s / 140.4s
  • trigger_pct:99.98%
  • duration_min/max:0.0s / 211.4s
  • uptime_min/max:22.33% / 94.78%

Stack Uptimes

  • denizen_of_the_dream_1:38.62%
  • denizen_of_the_dream_2:14.24%
  • denizen_of_the_dream_3:3.47%
  • denizen_of_the_dream_4:0.65%
  • denizen_of_the_dream_5:0.11%
  • denizen_of_the_dream_6:0.02%
  • denizen_of_the_dream_7:0.02%

Spelldata

  • id:394076
  • name:Denizen of the Dream
  • tooltip:
  • description:{$@spelldesc394065=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Dreamstate 15.5 0.4 20.0s 20.7s 3.1s 16.10% 21.43% 0.4 (0.6) 0.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 56.1s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.6s
  • uptime_min/max:9.31% / 25.79%

Stack Uptimes

  • dreamstate_1:9.68%
  • dreamstate_2:6.42%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 7.1 1.0 45.5s 45.0s 20.6s 49.17% 52.45% 1.0 (1.0) 6.8

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.6s
  • trigger_min/max:12.0s / 89.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:44.10% / 56.11%

Stack Uptimes

  • eclipse_lunar_1:49.17%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 13.8 5.7 22.5s 15.7s 20.2s 92.57% 95.95% 5.7 (5.7) 12.8

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 69.1s
  • trigger_min/max:0.0s / 55.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 68.0s
  • uptime_min/max:90.37% / 94.71%

Stack Uptimes

  • eclipse_solar_1:92.57%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 307.2s 307.2s 27.4s 13.13% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.3s
  • trigger_min/max:300.0s / 328.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.89% / 18.00%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.13%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Friend of the Fae 5.2 3.3 55.5s 32.2s 24.8s 43.27% 43.21% 3.3 (3.3) 4.8

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_friend_of_the_fae
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 177.2s
  • trigger_min/max:0.0s / 140.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 123.6s
  • uptime_min/max:14.92% / 78.95%

Stack Uptimes

  • friend_of_the_fae_1:43.27%

Spelldata

  • id:394083
  • name:Friend of the Fae
  • tooltip:Arcane and Nature damage increased by {$=}w1%.
  • description:{$@spelldesc394081=When a Faerie Dragon is summoned, your spells deal {$394083m1=10}% increased damage for {$394083d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 7.1 0.0 45.0s 45.0s 20.2s 48.25% 51.18% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.6s
  • trigger_min/max:12.0s / 89.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:43.34% / 54.97%

Stack Uptimes

  • incarnation_chosen_of_elune_1:48.25%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.6 0.0 99.9s 99.9s 19.4s 23.17% 0.00% 0.0 (0.0) 3.2

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:55.09

Trigger Details

  • interval_min/max:90.0s / 126.3s
  • trigger_min/max:90.0s / 126.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.28% / 26.02%

Stack Uptimes

  • kindled_soul_5:1.10%
  • kindled_soul_10:1.14%
  • kindled_soul_15:1.14%
  • kindled_soul_20:1.14%
  • kindled_soul_25:1.14%
  • kindled_soul_30:1.15%
  • kindled_soul_35:1.15%
  • kindled_soul_40:1.15%
  • kindled_soul_45:1.16%
  • kindled_soul_50:1.16%
  • kindled_soul_55:1.16%
  • kindled_soul_60:1.16%
  • kindled_soul_65:1.17%
  • kindled_soul_70:1.17%
  • kindled_soul_75:1.17%
  • kindled_soul_80:1.18%
  • kindled_soul_85:1.18%
  • kindled_soul_90:1.18%
  • kindled_soul_95:1.19%
  • kindled_soul_100:1.19%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Grace 12.8 0.0 20.7s 20.7s 5.9s 25.32% 0.00% 0.0 (0.0) 12.5

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.8s / 69.6s
  • trigger_min/max:12.8s / 69.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:19.75% / 29.33%

Stack Uptimes

  • natures_grace_1:25.32%

Spelldata

  • id:393959
  • name:Nature's Grace
  • tooltip:Haste increased by {$s1=10}%.
  • description:{$@spelldesc393958=After an Eclipse ends, you gain {$393959s1=10}% Haste for {$393959d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Vigil 3.7 0.0 90.3s 90.3s 14.7s 18.43% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.9s
  • trigger_min/max:90.0s / 91.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.54% / 21.04%

Stack Uptimes

  • natures_vigil_1:18.43%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.4 0.1 74.8s 68.8s 7.7s 6.21% 6.93% 0.1 (0.1) 1.3

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 329.9s
  • trigger_min/max:0.1s / 329.9s
  • trigger_pct:14.89%
  • duration_min/max:0.0s / 26.6s
  • uptime_min/max:0.00% / 25.70%

Stack Uptimes

  • owlkin_frenzy_1:6.21%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 8.1 107.4 39.0s 39.0s 34.9s 93.91% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:25.1s / 50.9s
  • trigger_min/max:25.1s / 50.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 48.9s
  • uptime_min/max:90.49% / 96.68%

Stack Uptimes

  • primordial_arcanic_pulsar_4:5.00%
  • primordial_arcanic_pulsar_8:5.58%
  • primordial_arcanic_pulsar_12:6.51%
  • primordial_arcanic_pulsar_16:6.98%
  • primordial_arcanic_pulsar_20:6.35%
  • primordial_arcanic_pulsar_24:6.13%
  • primordial_arcanic_pulsar_28:8.08%
  • primordial_arcanic_pulsar_32:7.87%
  • primordial_arcanic_pulsar_36:6.64%
  • primordial_arcanic_pulsar_40:7.08%
  • primordial_arcanic_pulsar_44:6.93%
  • primordial_arcanic_pulsar_48:7.08%
  • primordial_arcanic_pulsar_52:7.13%
  • primordial_arcanic_pulsar_56:6.54%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 18.5 4.1 16.8s 14.1s 6.4s 39.54% 39.78% 4.1 (4.1) 18.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 49.7s
  • trigger_min/max:0.0s / 39.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.6s
  • uptime_min/max:36.24% / 42.14%

Stack Uptimes

  • solstice_1:39.54%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 20.8 93.8 14.7s 2.6s 14.1s 97.27% 0.00% 52.7 (52.7) 7.4

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 21.0s
  • trigger_min/max:0.8s / 10.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:93.69% / 99.14%

Stack Uptimes

  • starlord_1:9.64%
  • starlord_2:15.57%
  • starlord_3:72.06%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Wafting Devotion 4.3 1.2 61.1s 45.7s 16.5s 23.65% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 226.4s
  • trigger_min/max:0.0s / 224.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 62.5s
  • uptime_min/max:5.09% / 57.10%

Stack Uptimes

  • wafting_devotion_1:23.65%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Warrior of Elune 6.1 0.0 48.3s 48.3s 22.0s 44.98% 44.02% 0.0 (0.0) 2.4

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_warrior_of_elune
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:45.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 82.2s
  • trigger_min/max:45.0s / 82.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s
  • uptime_min/max:33.83% / 51.89%

Stack Uptimes

  • warrior_of_elune_1:22.21%
  • warrior_of_elune_2:4.80%
  • warrior_of_elune_3:17.96%

Spelldata

  • id:202425
  • name:Warrior of Elune
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.
  • max_stacks:0
  • duration:25.00
  • cooldown:45.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Denizen of the Dream 8.5 2.0 19.0 32.2s 0.0s 140.3s
Primordial Arcanic Pulsar 7.1 6.0 9.0 40.8s 29.8s 51.4s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.08% 0.00% 1.62% 0.5s 0.0s 2.6s
Astral Smolder 77.41% 54.07% 92.50% 14.7s 0.0s 104.0s
Incarnation (Total) 48.25% 43.34% 54.97% 20.2s 0.0s 54.0s
Incarnation (Pulsar) 27.97% 25.93% 30.19% 11.8s 0.0s 12.0s
Lunar Eclipse Only 0.92% 0.72% 1.14% 2.7s 2.6s 2.7s
Solar Eclipse Only 44.32% 36.11% 50.32% 10.8s 0.0s 15.0s
No Eclipse 6.48% 4.16% 8.70% 1.5s 0.0s 3.6s
Friend of the Fae 43.27% 14.92% 78.95% 24.8s 0.0s 123.6s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Warrior of Elune7.0600.00037.22643.39726.04969.965
Full Moon
New Moon
Half Moon		0.3550.00025.1776.0165.35330.903

Eclipse Utilization

NoneSolarLunarBoth
Wrath5.104.5%55.8849.6%0.000.0%51.6645.9%
Starfire25.0592.6%0.000.0%2.007.4%0.000.0%
Starsurge0.000.0%46.1840.3%0.000.0%68.3559.7%
New Moon0.040.7%0.162.6%0.000.0%5.8096.7%
Half Moon0.000.1%0.315.4%0.000.0%5.3694.5%
Full Moon0.232.0%3.1727.4%0.080.7%8.0769.9%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
447+460 2p+2p
Nature's BalanceAstral Power99.44198.765.50%2.000.110.06%
Full MoonAstral Power5.28263.607.30%49.950.290.11%
Half MoonAstral Power5.67136.153.77%24.000.000.00%
MoonfireAstral Power14.3285.832.38%6.000.060.07%
New MoonAstral Power6.0071.991.99%12.000.000.00%
Orbit BreakerAstral Power6.26186.745.17%29.831.050.56%
Shooting Stars (Moonfire)Astral Power93.81187.425.19%2.000.190.10%
Shooting Stars (Sunfire)Astral Power94.12188.055.21%2.000.190.10%
StarfireAstral Power27.05396.8410.99%14.672.820.71%
SunfireAstral Power17.39104.302.89%6.000.010.01%
WrathAstral Power114.641791.6649.61%15.630.000.00%
Usage Type Count Total Tot% Avg RPE APR
447+460 2p+2p
StarsurgeAstral Power 115.263640.13100.00%31.5831.786324.31
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 696920.0 3248.87 3819.90 1405048.9 525721.4 -356257.0 696920.0
Astral Power 70.0 12.05 12.07 4.8 24.1 0.0 100.0

Statistics & Data Analysis

Fight Length
447+460 2p+2p Fight Length
Count 5069
Mean 299.81
Minimum 240.00
Maximum 359.99
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 34.3925
5th Percentile 246.50
95th Percentile 354.33
( 95th Percentile - 5th Percentile ) 107.83
Mean Distribution
Standard Deviation 0.4831
95.00% Confidence Interval ( 298.86 - 300.76 )
Normalized 95.00% Confidence Interval ( 99.68% - 100.32% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 506
0.1% Error 50551
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1010
DPS
447+460 2p+2p Damage Per Second
Count 5069
Mean 186087.06
Minimum 163961.10
Maximum 211971.70
Spread ( max - min ) 48010.60
Range [ ( max - min ) / 2 * 100% ] 12.90%
Standard Deviation 6714.8724
5th Percentile 175463.28
95th Percentile 197428.70
( 95th Percentile - 5th Percentile ) 21965.42
Mean Distribution
Standard Deviation 94.3141
95.00% Confidence Interval ( 185902.21 - 186271.91 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5002
0.1 Scale Factor Error with Delta=300 384911
0.05 Scale Factor Error with Delta=300 1539641
0.01 Scale Factor Error with Delta=300 38491001
Priority Target DPS
447+460 2p+2p Priority Target Damage Per Second
Count 5069
Mean 186087.06
Minimum 163961.10
Maximum 211971.70
Spread ( max - min ) 48010.60
Range [ ( max - min ) / 2 * 100% ] 12.90%
Standard Deviation 6714.8724
5th Percentile 175463.28
95th Percentile 197428.70
( 95th Percentile - 5th Percentile ) 21965.42
Mean Distribution
Standard Deviation 94.3141
95.00% Confidence Interval ( 185902.21 - 186271.91 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5002
0.1 Scale Factor Error with Delta=300 384911
0.05 Scale Factor Error with Delta=300 1539641
0.01 Scale Factor Error with Delta=300 38491001
DPS(e)
447+460 2p+2p Damage Per Second (Effective)
Count 5069
Mean 186087.06
Minimum 163961.10
Maximum 211971.70
Spread ( max - min ) 48010.60
Range [ ( max - min ) / 2 * 100% ] 12.90%
Damage
447+460 2p+2p Damage
Count 5069
Mean 54159424.22
Minimum 41096483.36
Maximum 68648821.02
Spread ( max - min ) 27552337.66
Range [ ( max - min ) / 2 * 100% ] 25.44%
DTPS
447+460 2p+2p Damage Taken Per Second
Count 5069
Mean 3817.02
Minimum 1115.55
Maximum 7272.51
Spread ( max - min ) 6156.96
Range [ ( max - min ) / 2 * 100% ] 80.65%
HPS
447+460 2p+2p Healing Per Second
Count 5069
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
447+460 2p+2p Healing Per Second (Effective)
Count 5069
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
447+460 2p+2p Heal
Count 5069
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
447+460 2p+2p Healing Taken Per Second
Count 5069
Mean 3239.46
Minimum 832.07
Maximum 6179.79
Spread ( max - min ) 5347.72
Range [ ( max - min ) / 2 * 100% ] 82.54%
TMI
447+460 2p+2p Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
447+460 2p+2pTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
447+460 2p+2p Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.46 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.58 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.75 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.st
# count action,conditions
J 1.60 sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
K 1.31 moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
0.00 starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
0.00 starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
L 1.00 starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
M 0.00 wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
0.00 celestial_alignment,if=variable.cd_condition_st
N 2.00 incarnation,if=variable.cd_condition_st
0.00 variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
0.00 variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
O 6.13 warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
P 25.12 starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
0.00 wrath,if=variable.enter_eclipse
0.00 variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
0.00 convoke_the_spirits,if=variable.convoke_condition
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+55
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 starfall,if=buff.starweavers_warp.up
0.00 variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
Q 84.70 starsurge,if=variable.starsurge_condition1
R 15.79 sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
S 13.00 moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
T 6.01 new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
U 5.70 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
V 5.34 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
W 12.39 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
X 29.83 starsurge,if=variable.starsurge_condition2
Y 112.95 wrath
Z 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFJKLNDEQQQTQUQVYXYYRXYXYSWQQQYYYYXYYXOTYXYXYWQQRQQYYYYXSYXYXYWQPPQYQRYQYYYYWQQPPSQYYQRUYYOWQQQVXYPPQQSYXRYYQFYYQYPPQQYYYYWQQRSYQYYYPPXETUWQQQOYQRYYXYPPQSYYWQQYQYYYRXYPPXWQYYQSYQYYYXRYYQQQVOTXYPPQQSYYRQQYYFQYNUQQVYXYYQQQRSYQYQYYXYYEWQTQYYQRYYXSYXOYWQQYQYYPPQQYRYYYWQQUQSQYQYYYXPPRQYQYYQYXYYSXPOPQQRYQYYFYYYXXYYPPQQSQRVQTUXXPPYWQQYYQYYRYDSYXEXYOPPQQQYYYYXVXRXWQSQ

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask 447+460 2p+2p 50.0/100: 50% astral_power
Pre precombat 1 food 447+460 2p+2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 2 augmentation 447+460 2p+2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 4 no_cd_talent 447+460 2p+2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 5 on_use_trinket 447+460 2p+2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 6 on_use_trinket 447+460 2p+2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 7 on_use_trinket 447+460 2p+2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 60.0/100: 60% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil 447+460 2p+2p 50.0/100: 50% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.000 st J sunfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.942 st K moonfire Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:01.887 st L starfire Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, corrupting_rage
0:02.736 st N incarnation_chosen_of_elune Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, corrupting_rage
0:02.736 default D potion Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), corrupting_rage
0:02.736 default E use_items Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power
0:02.736 st Q starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:03.592 st Q starsurge Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:04.419 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:05.213 st T new_moon Fluffy_Pillow 14.0/100: 14% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:05.968 st Q starsurge Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:06.733 st U half_moon Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:07.752 st Q starsurge Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:08.520 st V full_moon Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), solstice, starlord(3), dreamstate(2), elemental_potion_of_ultimate_power, kindled_soul(75)
0:10.051 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), dreamstate, elemental_potion_of_ultimate_power, kindled_soul(65)
0:10.807 st X starsurge Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), dreamstate, elemental_potion_of_ultimate_power, kindled_soul(60)
0:11.574 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), elemental_potion_of_ultimate_power, kindled_soul(60)
0:12.330 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), elemental_potion_of_ultimate_power, kindled_soul(55)
0:13.095 st R sunfire Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), elemental_potion_of_ultimate_power, kindled_soul(50)
0:13.863 st X starsurge Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), elemental_potion_of_ultimate_power, kindled_soul(45)
0:14.629 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), elemental_potion_of_ultimate_power, kindled_soul(45)
0:15.398 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), elemental_potion_of_ultimate_power, kindled_soul(40)
0:16.165 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), elemental_potion_of_ultimate_power, kindled_soul(35)
0:16.931 st S moonfire Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.697 st W cancel_buff Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.697 st Q starsurge Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), elemental_potion_of_ultimate_power, kindled_soul(30)
0:18.554 st Q starsurge Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord, elemental_potion_of_ultimate_power, kindled_soul(25)
0:19.378 st Q starsurge Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), elemental_potion_of_ultimate_power, kindled_soul(20)
0:20.172 st Y wrath Fluffy_Pillow 4.0/100: 4% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), elemental_potion_of_ultimate_power, kindled_soul(15)
0:20.940 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), elemental_potion_of_ultimate_power, kindled_soul(10)
0:21.705 st Y wrath Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), elemental_potion_of_ultimate_power, kindled_soul(10)
0:22.474 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), elemental_potion_of_ultimate_power, kindled_soul(5)
0:23.241 st X starsurge Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:24.008 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:24.775 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:25.542 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:26.308 st O warrior_of_elune Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:26.308 st T new_moon Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), corrupting_rage, elemental_potion_of_ultimate_power
0:27.064 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), corrupting_rage, elemental_potion_of_ultimate_power
0:27.832 st X starsurge Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), corrupting_rage, elemental_potion_of_ultimate_power
0:28.598 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), corrupting_rage, elemental_potion_of_ultimate_power
0:29.364 st X starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), corrupting_rage, elemental_potion_of_ultimate_power
0:30.132 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(3), warrior_of_elune(3), corrupting_rage, elemental_potion_of_ultimate_power
0:30.899 st W cancel_buff Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(3), warrior_of_elune(3), corrupting_rage, elemental_potion_of_ultimate_power
0:30.899 st Q starsurge Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, warrior_of_elune(3), corrupting_rage, elemental_potion_of_ultimate_power
0:31.758 st Q starsurge Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord, warrior_of_elune(3), corrupting_rage, elemental_potion_of_ultimate_power
0:32.582 st R sunfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(2), warrior_of_elune(3), corrupting_rage, elemental_potion_of_ultimate_power
0:33.376 st Q starsurge Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(2), warrior_of_elune(3), corrupting_rage
0:34.171 st Q starsurge Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), corrupting_rage
0:34.936 st Y wrath Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(16), solstice, starlord(3), warrior_of_elune(3), corrupting_rage
0:35.702 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), corrupting_rage
0:36.470 st Y wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), corrupting_rage
0:37.235 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), corrupting_rage
0:38.002 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), corrupting_rage
0:38.768 st S moonfire Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), corrupting_rage
0:39.536 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), corrupting_rage
0:40.303 st X starsurge Fluffy_Pillow 76.0/100: 76% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), corrupting_rage
0:41.296 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), corrupting_rage
0:42.292 st X starsurge Fluffy_Pillow 68.0/100: 68% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), corrupting_rage
0:43.286 st Y wrath Fluffy_Pillow 40.0/100: 40% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), corrupting_rage
0:44.281 st W cancel_buff Fluffy_Pillow 56.0/100: 56% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), corrupting_rage
0:44.281 st Q starsurge Fluffy_Pillow 56.0/100: 56% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), warrior_of_elune(3), corrupting_rage
0:45.397 st P starfire Fluffy_Pillow 30.0/100: 30% astral_power denizen_of_the_dream(2), natures_grace, primordial_arcanic_pulsar(32), starlord, warrior_of_elune(3), dreamstate, corrupting_rage
0:46.153 st P starfire Fluffy_Pillow 46.8/100: 47% astral_power denizen_of_the_dream(2), natures_grace, primordial_arcanic_pulsar(32), starlord, warrior_of_elune(2), corrupting_rage
0:46.906 st Q starsurge Fluffy_Pillow 65.6/100: 66% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord, warrior_of_elune, corrupting_rage
0:47.978 st Y wrath Fluffy_Pillow 31.6/100: 32% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(2), warrior_of_elune, corrupting_rage
0:49.011 st Q starsurge Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(2), warrior_of_elune, corrupting_rage
0:50.043 st R sunfire Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune, corrupting_rage
0:51.038 st Y wrath Fluffy_Pillow 25.6/100: 26% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune, corrupting_rage
0:52.131 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), solstice, starlord(3), corrupting_rage
0:53.225 st Y wrath Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), corrupting_rage
0:54.319 st Y wrath Fluffy_Pillow 27.6/100: 28% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), corrupting_rage
0:55.414 st Y wrath Fluffy_Pillow 43.6/100: 44% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos(11), corrupting_rage
0:56.508 st Y wrath Fluffy_Pillow 59.6/100: 60% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos(10), corrupting_rage
0:57.603 st W cancel_buff Fluffy_Pillow 77.6/100: 78% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos(9), corrupting_rage
0:57.603 st Q starsurge Fluffy_Pillow 77.6/100: 78% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), best_friends_with_urctos(9), corrupting_rage
0:58.828 st Q starsurge Fluffy_Pillow 41.6/100: 42% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord, best_friends_with_urctos(8), corrupting_rage
1:00.007 st P starfire Fluffy_Pillow 7.6/100: 8% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(2), best_friends_with_urctos(7), corrupting_rage
1:01.707 st P starfire Fluffy_Pillow 21.6/100: 22% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), starlord(2), dreamstate, best_friends_with_urctos(5)
1:02.636 st S moonfire Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(2), dreamstate, best_friends_with_urctos(4)
1:03.667 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(2), dreamstate, best_friends_with_urctos(3)
1:04.699 st Y wrath Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), best_friends_with_urctos(2)
1:05.453 st Y wrath Fluffy_Pillow 25.6/100: 26% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), best_friends_with_urctos
1:06.449 st Q starsurge Fluffy_Pillow 47.6/100: 48% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3)
1:07.445 st R sunfire Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3)
1:08.440 st U half_moon Fluffy_Pillow 23.6/100: 24% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3)
1:09.766 st Y wrath Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3)
1:10.761 st Y wrath Fluffy_Pillow 69.6/100: 70% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3)
1:11.756 st O warrior_of_elune Fluffy_Pillow 87.6/100: 88% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3)
1:11.756 st W cancel_buff Fluffy_Pillow 87.6/100: 88% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3)
1:11.756 st Q starsurge Fluffy_Pillow 87.6/100: 88% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, warrior_of_elune(3)
1:12.872 st Q starsurge Fluffy_Pillow 61.6/100: 62% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), starlord, warrior_of_elune(3)
1:13.944 st Q starsurge Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(2), warrior_of_elune(3)
1:14.974 st V full_moon Fluffy_Pillow 5.6/100: 6% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3)
1:16.960 st X starsurge Fluffy_Pillow 59.6/100: 60% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), corrupting_rage
1:17.954 st Y wrath Fluffy_Pillow 31.6/100: 32% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), corrupting_rage
1:18.950 st P starfire Fluffy_Pillow 43.6/100: 44% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), dreamstate, corrupting_rage
1:19.705 st P starfire Fluffy_Pillow 62.4/100: 62% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(2), corrupting_rage
1:20.460 st Q starsurge Fluffy_Pillow 79.2/100: 79% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), warrior_of_elune, corrupting_rage
1:21.455 st Q starsurge Fluffy_Pillow 47.2/100: 47% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, corrupting_rage
1:22.451 st S moonfire Fluffy_Pillow 13.2/100: 13% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, corrupting_rage
1:23.447 st Y wrath Fluffy_Pillow 19.2/100: 19% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, corrupting_rage
1:24.443 st X starsurge Fluffy_Pillow 41.2/100: 41% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, corrupting_rage
1:25.440 st R sunfire Fluffy_Pillow 5.2/100: 5% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, corrupting_rage
1:26.535 st Y wrath Fluffy_Pillow 11.2/100: 11% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, corrupting_rage
1:27.631 st Y wrath Fluffy_Pillow 29.2/100: 29% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), warrior_of_elune, corrupting_rage
1:28.857 st Q starsurge Fluffy_Pillow 45.2/100: 45% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), warrior_of_elune, corrupting_rage
1:30.084 default F natures_vigil 447+460 2p+2p 13.2/100: 13% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord, warrior_of_elune, corrupting_rage
1:30.084 st Y wrath Fluffy_Pillow 13.2/100: 13% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord, warrior_of_elune, corrupting_rage
1:31.262 st Y wrath Fluffy_Pillow 29.2/100: 29% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord, warrior_of_elune, corrupting_rage
1:32.440 st Q starsurge Fluffy_Pillow 45.2/100: 45% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord, warrior_of_elune, corrupting_rage
1:33.618 st Y wrath Fluffy_Pillow 11.2/100: 11% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, corrupting_rage
1:34.752 st P starfire Fluffy_Pillow 21.2/100: 21% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, dreamstate, corrupting_rage
1:35.507 st P starfire Fluffy_Pillow 70.0/100: 70% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), starlord(2)
1:36.435 st Q starsurge Fluffy_Pillow 84.0/100: 84% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(2)
1:37.467 st Q starsurge Fluffy_Pillow 48.0/100: 48% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3)
1:38.461 st Y wrath Fluffy_Pillow 12.0/100: 12% astral_power natures_vigil, balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3)
1:39.457 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3)
1:40.453 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power natures_vigil, balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3)
1:41.448 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power natures_vigil, balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(44), solstice, starlord(3)
1:42.543 st W cancel_buff Fluffy_Pillow 86.0/100: 86% astral_power natures_vigil, balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), wafting_devotion
1:42.543 st Q starsurge Fluffy_Pillow 86.0/100: 86% astral_power natures_vigil, balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(44), wafting_devotion
1:43.676 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power natures_vigil, balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(48), starlord, wafting_devotion
1:44.766 st R sunfire Fluffy_Pillow 14.0/100: 14% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(2), wafting_devotion
1:45.817 st S moonfire Fluffy_Pillow 22.0/100: 22% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(2), wafting_devotion
1:46.867 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(2), wafting_devotion
1:47.918 st Q starsurge Fluffy_Pillow 46.0/100: 46% astral_power eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(2), wafting_devotion
1:48.968 st Y wrath Fluffy_Pillow 12.0/100: 12% astral_power eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), wafting_devotion
1:49.980 st Y wrath Fluffy_Pillow 28.0/100: 28% astral_power eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), wafting_devotion
1:50.992 st Y wrath Fluffy_Pillow 44.0/100: 44% astral_power eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), wafting_devotion, corrupting_rage
1:52.004 st P starfire Fluffy_Pillow 56.0/100: 56% astral_power natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), dreamstate, wafting_devotion, corrupting_rage
1:52.759 st P starfire Fluffy_Pillow 68.0/100: 68% astral_power natures_grace, primordial_arcanic_pulsar(56), starlord(3), wafting_devotion, corrupting_rage
1:53.588 st X starsurge Fluffy_Pillow 80.0/100: 80% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), wafting_devotion, corrupting_rage
1:54.510 default E use_items Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(3), wafting_devotion, corrupting_rage
1:54.510 st T new_moon Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(3), wafting_devotion, corrupting_rage, kindled_soul(100)
1:55.265 st U half_moon Fluffy_Pillow 64.0/100: 64% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(3), best_friends_with_urctos(11), wafting_devotion, corrupting_rage, kindled_soul(100)
1:56.381 st W cancel_buff Fluffy_Pillow 90.0/100: 90% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(3), best_friends_with_urctos(10), wafting_devotion, corrupting_rage, kindled_soul(95)
1:56.381 st Q starsurge Fluffy_Pillow 90.0/100: 90% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, best_friends_with_urctos(10), wafting_devotion, corrupting_rage, kindled_soul(95)
1:57.317 st Q starsurge Fluffy_Pillow 68.0/100: 68% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord, best_friends_with_urctos(9), wafting_devotion, corrupting_rage, kindled_soul(90)
1:58.219 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), best_friends_with_urctos(8), wafting_devotion, corrupting_rage, kindled_soul(85)
1:59.172 st O warrior_of_elune Fluffy_Pillow 18.0/100: 18% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), best_friends_with_urctos(7), wafting_devotion, corrupting_rage, kindled_soul(80)
1:59.172 st Y wrath Fluffy_Pillow 18.0/100: 18% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos(7), wafting_devotion, corrupting_rage, kindled_soul(80)
2:00.095 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_urctos(6), wafting_devotion, corrupting_rage, kindled_soul(75)
2:01.017 st R sunfire Fluffy_Pillow 10.0/100: 10% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_urctos(5), wafting_devotion, corrupting_rage, kindled_soul(70)
2:01.941 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_urctos(4), wafting_devotion, corrupting_rage, kindled_soul(65)
2:02.863 st Y wrath Fluffy_Pillow 34.0/100: 34% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_urctos(4), corrupting_rage, kindled_soul(60)
2:03.857 st X starsurge Fluffy_Pillow 52.0/100: 52% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_urctos(3), corrupting_rage, kindled_soul(55)
2:04.852 st Y wrath Fluffy_Pillow 28.0/100: 28% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_urctos(2), corrupting_rage, kindled_soul(50)
2:05.848 st P starfire Fluffy_Pillow 38.0/100: 38% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos, corrupting_rage, kindled_soul(45)
2:06.602 st P starfire Fluffy_Pillow 58.8/100: 59% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), corrupting_rage, kindled_soul(40)
2:07.357 st Q starsurge Fluffy_Pillow 77.6/100: 78% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, corrupting_rage, kindled_soul(40)
2:08.352 st S moonfire Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, corrupting_rage, kindled_soul(35)
2:09.347 st Y wrath Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, corrupting_rage, kindled_soul(30)
2:10.342 st Y wrath Fluffy_Pillow 71.6/100: 72% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, corrupting_rage, kindled_soul(25)
2:11.337 st W cancel_buff Fluffy_Pillow 91.6/100: 92% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, corrupting_rage, kindled_soul(20)
2:11.337 st Q starsurge Fluffy_Pillow 91.6/100: 92% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, warrior_of_elune, corrupting_rage, kindled_soul(20)
2:12.452 st Q starsurge Fluffy_Pillow 57.6/100: 58% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord, warrior_of_elune, corrupting_rage, kindled_soul(15)
2:13.628 st Y wrath Fluffy_Pillow 21.6/100: 22% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune, corrupting_rage, kindled_soul(5)
2:14.763 st Q starsurge Fluffy_Pillow 37.6/100: 38% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune, corrupting_rage
2:15.898 st Y wrath Fluffy_Pillow 3.6/100: 4% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, corrupting_rage
2:16.993 st Y wrath Fluffy_Pillow 21.6/100: 22% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, corrupting_rage
2:18.087 st Y wrath Fluffy_Pillow 39.6/100: 40% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, corrupting_rage
2:19.182 st R sunfire Fluffy_Pillow 57.6/100: 58% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, corrupting_rage
2:20.276 st X starsurge Fluffy_Pillow 63.6/100: 64% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, corrupting_rage
2:21.372 st Y wrath Fluffy_Pillow 29.6/100: 30% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, corrupting_rage
2:22.468 st P starfire Fluffy_Pillow 39.6/100: 40% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, dreamstate, corrupting_rage
2:23.221 st P starfire Fluffy_Pillow 56.4/100: 56% astral_power denizen_of_the_dream(3), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(3), corrupting_rage
2:24.117 st X starsurge Fluffy_Pillow 70.4/100: 70% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), corrupting_rage
2:25.112 st W cancel_buff Fluffy_Pillow 36.4/100: 36% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(4), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), corrupting_rage
2:25.112 st Q starsurge Fluffy_Pillow 36.4/100: 36% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(4), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, corrupting_rage
2:26.227 st Y wrath Fluffy_Pillow 0.4/100: 0% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(4), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord, corrupting_rage
2:27.300 st Y wrath Fluffy_Pillow 20.4/100: 20% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(4), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord, corrupting_rage
2:28.371 st Q starsurge Fluffy_Pillow 38.4/100: 38% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(4), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord, corrupting_rage
2:29.549 st S moonfire Fluffy_Pillow 2.4/100: 2% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(4), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(2), corrupting_rage
2:30.682 st Y wrath Fluffy_Pillow 10.4/100: 10% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(4), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(2), corrupting_rage
2:31.816 st Q starsurge Fluffy_Pillow 58.4/100: 58% astral_power balance_of_all_things_nature, denizen_of_the_dream(4), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(2), corrupting_rage
2:32.950 st Y wrath Fluffy_Pillow 24.4/100: 24% astral_power denizen_of_the_dream(4), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), corrupting_rage
2:34.044 st Y wrath Fluffy_Pillow 42.4/100: 42% astral_power denizen_of_the_dream(4), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), corrupting_rage
2:35.137 st Y wrath Fluffy_Pillow 58.4/100: 58% astral_power denizen_of_the_dream(4), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), corrupting_rage
2:36.233 st X starsurge Fluffy_Pillow 76.4/100: 76% astral_power denizen_of_the_dream(4), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3)
2:37.327 st R sunfire Fluffy_Pillow 42.4/100: 42% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3)
2:38.323 st Y wrath Fluffy_Pillow 52.4/100: 52% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), best_friends_with_pip(11), best_friends_with_pip_static
2:39.318 st Y wrath Fluffy_Pillow 70.4/100: 70% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), best_friends_with_pip(10), best_friends_with_pip_static
2:40.314 st Q starsurge Fluffy_Pillow 88.4/100: 88% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, best_friends_with_pip(9), best_friends_with_pip_static
2:41.429 st Q starsurge Fluffy_Pillow 62.4/100: 62% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord, best_friends_with_pip(8), best_friends_with_pip_static
2:42.500 st Q starsurge Fluffy_Pillow 36.4/100: 36% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(2), best_friends_with_pip(7), best_friends_with_pip_static
2:43.530 st V full_moon Fluffy_Pillow 10.4/100: 10% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip(6), best_friends_with_pip_static
2:45.517 st O warrior_of_elune Fluffy_Pillow 62.4/100: 62% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip(4), best_friends_with_pip_static
2:45.517 st T new_moon Fluffy_Pillow 62.4/100: 62% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_pip(4), best_friends_with_pip_static
2:46.273 st X starsurge Fluffy_Pillow 74.4/100: 74% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_pip(3), best_friends_with_pip_static
2:47.268 st Y wrath Fluffy_Pillow 46.4/100: 46% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_pip(2), best_friends_with_pip_static
2:48.266 st P starfire Fluffy_Pillow 58.4/100: 58% astral_power denizen_of_the_dream(3), natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip, best_friends_with_pip_static
2:49.022 st P starfire Fluffy_Pillow 75.2/100: 75% astral_power denizen_of_the_dream(3), natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(2), best_friends_with_pip_static
2:49.776 st Q starsurge Fluffy_Pillow 94.0/100: 94% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(3), eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static
2:50.771 st Q starsurge Fluffy_Pillow 58.0/100: 58% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(3), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static
2:51.767 st S moonfire Fluffy_Pillow 28.0/100: 28% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, corrupting_rage
2:52.763 st Y wrath Fluffy_Pillow 36.0/100: 36% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, corrupting_rage
2:53.760 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, corrupting_rage
2:54.755 st R sunfire Fluffy_Pillow 72.0/100: 72% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, corrupting_rage
2:55.848 st Q starsurge Fluffy_Pillow 80.0/100: 80% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(24), warrior_of_elune, best_friends_with_pip_static, corrupting_rage
2:57.072 st Q starsurge Fluffy_Pillow 46.0/100: 46% astral_power eclipse_solar, primordial_arcanic_pulsar(28), starlord, warrior_of_elune, best_friends_with_pip_static, corrupting_rage
2:58.252 st Y wrath Fluffy_Pillow 10.0/100: 10% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune, best_friends_with_pip_static, corrupting_rage
2:59.387 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune, best_friends_with_pip_static, corrupting_rage
3:00.522 default F natures_vigil 447+460 2p+2p 44.0/100: 44% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:00.522 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:01.572 st Y wrath Fluffy_Pillow 8.0/100: 8% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:02.586 st N incarnation_chosen_of_elune Fluffy_Pillow 26.0/100: 26% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:02.736 st U half_moon Fluffy_Pillow 28.0/100: 28% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), solstice, starlord(3), warrior_of_elune, dreamstate(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:03.961 st Q starsurge Fluffy_Pillow 58.0/100: 58% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), solstice, starlord(3), warrior_of_elune, dreamstate(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:04.883 st Q starsurge Fluffy_Pillow 32.0/100: 32% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune, dreamstate(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:05.805 st V full_moon Fluffy_Pillow 4.0/100: 4% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), solstice, starlord(3), warrior_of_elune, dreamstate(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:07.643 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), solstice, starlord(3), warrior_of_elune, dreamstate, best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:08.398 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), solstice, starlord(3), warrior_of_elune, dreamstate, best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:09.320 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:10.074 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:10.996 st Q starsurge Fluffy_Pillow 86.0/100: 86% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:12.029 st Q starsurge Fluffy_Pillow 64.0/100: 64% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord, best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:13.021 st Q starsurge Fluffy_Pillow 36.0/100: 36% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:13.974 st R sunfire Fluffy_Pillow 8.0/100: 8% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:14.895 st S moonfire Fluffy_Pillow 14.0/100: 14% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:15.816 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), best_friends_with_pip_static, corrupting_rage
3:16.811 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), best_friends_with_pip_static, corrupting_rage
3:17.807 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_pip_static, corrupting_rage
3:18.803 st Q starsurge Fluffy_Pillow 36.0/100: 36% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_pip_static, corrupting_rage
3:19.798 st Y wrath Fluffy_Pillow 8.0/100: 8% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), best_friends_with_pip_static, corrupting_rage
3:20.793 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), best_friends_with_pip_static, corrupting_rage
3:21.787 st X starsurge Fluffy_Pillow 42.0/100: 42% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), best_friends_with_pip_static, corrupting_rage
3:22.783 st Y wrath Fluffy_Pillow 14.0/100: 14% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip_static, corrupting_rage
3:23.778 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip_static, corrupting_rage
3:24.773 default E use_items Fluffy_Pillow 48.0/100: 48% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip_static, corrupting_rage
3:24.773 st W cancel_buff Fluffy_Pillow 48.0/100: 48% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
3:24.773 st Q starsurge Fluffy_Pillow 48.0/100: 48% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
3:25.886 st T new_moon Fluffy_Pillow 20.0/100: 20% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord, best_friends_with_pip_static, corrupting_rage, kindled_soul(95)
3:26.639 st Q starsurge Fluffy_Pillow 32.0/100: 32% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord, best_friends_with_pip_static, corrupting_rage, kindled_soul(95)
3:27.710 st Y wrath Fluffy_Pillow 8.0/100: 8% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(90)
3:28.742 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(85)
3:29.775 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(75)
3:30.806 st R sunfire Fluffy_Pillow 46.0/100: 46% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(70)
3:31.801 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(65)
3:32.796 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(60)
3:33.791 st X starsurge Fluffy_Pillow 88.0/100: 88% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(55)
3:34.786 st S moonfire Fluffy_Pillow 60.0/100: 60% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(50)
3:35.781 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(45)
3:36.776 st X starsurge Fluffy_Pillow 84.0/100: 84% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(40)
3:37.772 st O warrior_of_elune Fluffy_Pillow 58.0/100: 58% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(40)
3:37.772 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(40)
3:38.770 st W cancel_buff Fluffy_Pillow 74.0/100: 74% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(35)
3:38.770 st Q starsurge Fluffy_Pillow 74.0/100: 74% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), warrior_of_elune(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(35)
3:39.885 st Q starsurge Fluffy_Pillow 48.0/100: 48% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, warrior_of_elune(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(25)
3:40.956 st Y wrath Fluffy_Pillow 20.0/100: 20% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(20)
3:41.989 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(15)
3:43.021 st Y wrath Fluffy_Pillow 12.0/100: 12% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(10)
3:44.017 st Y wrath Fluffy_Pillow 28.0/100: 28% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(5)
3:45.013 st P starfire Fluffy_Pillow 40.0/100: 40% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip_static, corrupting_rage
3:45.767 st P starfire Fluffy_Pillow 56.8/100: 57% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(2), best_friends_with_pip_static, corrupting_rage
3:46.522 st Q starsurge Fluffy_Pillow 73.6/100: 74% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, corrupting_rage
3:47.517 st Q starsurge Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, corrupting_rage
3:48.513 st Y wrath Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, corrupting_rage
3:49.509 st R sunfire Fluffy_Pillow 29.6/100: 30% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, corrupting_rage
3:50.505 st Y wrath Fluffy_Pillow 39.6/100: 40% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, corrupting_rage
3:51.500 st Y wrath Fluffy_Pillow 57.6/100: 58% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, wafting_devotion
3:52.512 st Y wrath Fluffy_Pillow 73.6/100: 74% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune, best_friends_with_urctos(11), best_friends_with_urctos_static, wafting_devotion
3:53.524 st W cancel_buff Fluffy_Pillow 93.6/100: 94% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune, best_friends_with_urctos(10), best_friends_with_urctos_static, wafting_devotion
3:53.524 st Q starsurge Fluffy_Pillow 93.6/100: 94% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), warrior_of_elune, best_friends_with_urctos(10), best_friends_with_urctos_static, wafting_devotion
3:54.658 st Q starsurge Fluffy_Pillow 59.6/100: 60% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord, warrior_of_elune, best_friends_with_urctos(9), best_friends_with_urctos_static, wafting_devotion
3:55.747 st U half_moon Fluffy_Pillow 23.6/100: 24% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), warrior_of_elune, best_friends_with_urctos(8), best_friends_with_urctos_static, wafting_devotion
3:57.018 st Q starsurge Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(2), warrior_of_elune, best_friends_with_urctos(7), best_friends_with_urctos_static, wafting_devotion
3:57.971 st S moonfire Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(6), best_friends_with_urctos_static, wafting_devotion
3:58.894 st Q starsurge Fluffy_Pillow 35.6/100: 36% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(5), best_friends_with_urctos_static, wafting_devotion
3:59.815 st Y wrath Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion
4:00.735 st Q starsurge Fluffy_Pillow 29.6/100: 30% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune, best_friends_with_urctos(3), best_friends_with_urctos_static, wafting_devotion
4:01.658 st Y wrath Fluffy_Pillow 5.6/100: 6% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune, best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion
4:02.581 st Y wrath Fluffy_Pillow 21.6/100: 22% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune, best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion
4:03.503 st Y wrath Fluffy_Pillow 39.6/100: 40% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion
4:04.425 st X starsurge Fluffy_Pillow 57.6/100: 58% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_urctos_static, wafting_devotion
4:05.347 st P starfire Fluffy_Pillow 29.6/100: 30% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), best_friends_with_urctos_static, wafting_devotion
4:06.725 st P starfire Fluffy_Pillow 43.6/100: 44% astral_power denizen_of_the_dream(3), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), starlord(3), dreamstate, best_friends_with_urctos_static, corrupting_rage
4:07.620 st R sunfire Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), dreamstate, best_friends_with_urctos_static, corrupting_rage
4:08.616 st Q starsurge Fluffy_Pillow 63.6/100: 64% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), solstice, dreamstate, best_friends_with_urctos_static, corrupting_rage
4:09.730 st Y wrath Fluffy_Pillow 29.6/100: 30% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord, best_friends_with_urctos_static, corrupting_rage
4:10.484 st Q starsurge Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, corrupting_rage
4:11.556 st Y wrath Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage
4:12.588 st Y wrath Fluffy_Pillow 35.6/100: 36% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage
4:13.621 st Q starsurge Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(2), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, corrupting_rage
4:14.755 st Y wrath Fluffy_Pillow 19.6/100: 20% astral_power balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, corrupting_rage
4:15.850 st X starsurge Fluffy_Pillow 37.6/100: 38% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, corrupting_rage
4:16.943 st Y wrath Fluffy_Pillow 1.6/100: 2% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, corrupting_rage
4:18.039 st Y wrath Fluffy_Pillow 21.6/100: 22% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, corrupting_rage
4:19.134 st S moonfire Fluffy_Pillow 37.6/100: 38% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, corrupting_rage
4:20.228 st X starsurge Fluffy_Pillow 43.6/100: 44% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static, corrupting_rage
4:21.324 st P starfire Fluffy_Pillow 9.6/100: 10% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
4:22.963 st O warrior_of_elune Fluffy_Pillow 21.6/100: 22% astral_power denizen_of_the_dream(2), natures_grace, primordial_arcanic_pulsar(36), starlord(3), dreamstate(2), best_friends_with_aerwynn_static
4:22.963 st P starfire Fluffy_Pillow 21.6/100: 22% astral_power denizen_of_the_dream(2), natures_grace, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn_static
4:23.718 st Q starsurge Fluffy_Pillow 72.4/100: 72% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, warrior_of_elune(2), dreamstate, best_friends_with_aerwynn_static
4:24.831 st Q starsurge Fluffy_Pillow 42.4/100: 42% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord, warrior_of_elune(2), dreamstate, best_friends_with_aerwynn_static
4:25.904 st R sunfire Fluffy_Pillow 8.4/100: 8% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), warrior_of_elune(2), dreamstate, best_friends_with_urctos(10), best_friends_with_urctos_static
4:26.935 st Y wrath Fluffy_Pillow 16.4/100: 16% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), warrior_of_elune(2), best_friends_with_urctos(9), best_friends_with_urctos_static
4:27.691 st Q starsurge Fluffy_Pillow 36.4/100: 36% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), warrior_of_elune(2), best_friends_with_urctos(9), best_friends_with_urctos_static
4:28.722 st Y wrath Fluffy_Pillow 4.4/100: 4% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord(3), warrior_of_elune(2), best_friends_with_urctos(8), best_friends_with_urctos_static
4:29.818 st Y wrath Fluffy_Pillow 20.4/100: 20% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(2), best_friends_with_urctos(7), best_friends_with_urctos_static
4:30.912 default F natures_vigil 447+460 2p+2p 38.4/100: 38% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(2), best_friends_with_urctos(5), best_friends_with_urctos_static
4:30.912 st Y wrath Fluffy_Pillow 38.4/100: 38% astral_power natures_vigil, balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(2), best_friends_with_urctos(5), best_friends_with_urctos_static
4:32.008 st Y wrath Fluffy_Pillow 54.4/100: 54% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(2), best_friends_with_urctos(4), best_friends_with_urctos_static
4:33.103 st Y wrath Fluffy_Pillow 74.4/100: 74% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(2), best_friends_with_urctos(3), best_friends_with_urctos_static
4:34.196 st X starsurge Fluffy_Pillow 90.4/100: 90% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(2), best_friends_with_urctos(2), best_friends_with_urctos_static
4:35.290 st X starsurge Fluffy_Pillow 54.4/100: 54% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(2), best_friends_with_urctos, best_friends_with_urctos_static
4:36.385 st Y wrath Fluffy_Pillow 20.4/100: 20% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(2), best_friends_with_urctos_static
4:37.479 st Y wrath Fluffy_Pillow 36.4/100: 36% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(2), best_friends_with_urctos_static, corrupting_rage
4:38.573 st P starfire Fluffy_Pillow 46.4/100: 46% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(2), dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:39.327 st P starfire Fluffy_Pillow 65.2/100: 65% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(56), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:40.080 st Q starsurge Fluffy_Pillow 82.0/100: 82% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:41.113 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:42.014 st S moonfire Fluffy_Pillow 24.0/100: 24% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:42.881 st Q starsurge Fluffy_Pillow 30.0/100: 30% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:43.749 st R sunfire Fluffy_Pillow 6.0/100: 6% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(8), solstice, starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:44.587 st V full_moon Fluffy_Pillow 14.0/100: 14% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:46.426 st Q starsurge Fluffy_Pillow 66.0/100: 66% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:47.347 st T new_moon Fluffy_Pillow 42.0/100: 42% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:48.101 st U half_moon Fluffy_Pillow 56.0/100: 56% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:49.327 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:50.250 st X starsurge Fluffy_Pillow 54.0/100: 54% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:51.172 st P starfire Fluffy_Pillow 28.0/100: 28% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:52.553 st P starfire Fluffy_Pillow 40.0/100: 40% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(20), starlord(3), dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:53.308 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:54.063 st W cancel_buff Fluffy_Pillow 74.0/100: 74% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:54.063 st Q starsurge Fluffy_Pillow 74.0/100: 74% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:55.094 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:56.087 st Y wrath Fluffy_Pillow 6.0/100: 6% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:57.041 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:57.996 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:58.948 st Y wrath Fluffy_Pillow 6.0/100: 6% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:59.959 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
5:00.972 st R sunfire Fluffy_Pillow 42.0/100: 42% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
5:01.985 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
5:02.998 default D potion Fluffy_Pillow 64.0/100: 64% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
5:02.998 st S moonfire Fluffy_Pillow 64.0/100: 64% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:04.011 st Y wrath Fluffy_Pillow 72.0/100: 72% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:05.025 st X starsurge Fluffy_Pillow 88.0/100: 88% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:06.039 default E use_items Fluffy_Pillow 56.0/100: 56% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:06.039 st X starsurge Fluffy_Pillow 56.0/100: 56% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
5:07.052 st Y wrath Fluffy_Pillow 20.0/100: 20% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
5:08.146 st O warrior_of_elune Fluffy_Pillow 34.0/100: 34% astral_power denizen_of_the_dream(3), friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord(3), dreamstate(2), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
5:08.146 st P starfire Fluffy_Pillow 34.0/100: 34% astral_power denizen_of_the_dream(3), friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
5:08.901 st P starfire Fluffy_Pillow 52.8/100: 53% astral_power denizen_of_the_dream(3), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
5:09.655 st Q starsurge Fluffy_Pillow 73.6/100: 74% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, warrior_of_elune(2), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
5:10.769 st Q starsurge Fluffy_Pillow 71.6/100: 72% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, warrior_of_elune(2), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
5:11.840 st Q starsurge Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), warrior_of_elune(2), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
5:12.872 st Y wrath Fluffy_Pillow 7.6/100: 8% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), warrior_of_elune(2), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
5:13.866 st Y wrath Fluffy_Pillow 25.6/100: 26% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(3), warrior_of_elune(2), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
5:14.960 st Y wrath Fluffy_Pillow 45.6/100: 46% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(2), best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
5:16.053 st Y wrath Fluffy_Pillow 63.6/100: 64% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(2), best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
5:17.148 st X starsurge Fluffy_Pillow 79.6/100: 80% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(2), best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
5:18.242 st V full_moon Fluffy_Pillow 47.6/100: 48% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(2), best_friends_with_pip(8), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
5:20.427 st X starsurge Fluffy_Pillow 99.6/100: 100% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(2), best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
5:21.520 st R sunfire Fluffy_Pillow 67.6/100: 68% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(2), best_friends_with_pip(5), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
5:22.515 st X starsurge Fluffy_Pillow 73.6/100: 74% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(2), best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
5:23.512 st W cancel_buff Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(2), best_friends_with_pip(3), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
5:23.512 st Q starsurge Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, warrior_of_elune(2), best_friends_with_pip(3), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
5:24.626 st S moonfire Fluffy_Pillow 25.6/100: 26% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord, warrior_of_elune(2), best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
5:25.697 st Q starsurge Fluffy_Pillow 35.6/100: 36% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord, warrior_of_elune(2), best_friends_with_pip, best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)

Stats

Level Bonus (70) Race Bonus (tauren) Raid-Buffed Unbuffed Gear Amount
Strength 898 2 986 900 0
Agility 2089 -2 2173 2087 0
Stamina 3848 2 34846 33187 29270
Intellect 2089 -2 13344 12540 9856 (5981)
Spirit 0 0 0 0 0
Health 696920 696920 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13344 12540 0
Crit 27.03% 20.82% 2847
Haste 22.82% 22.82% 3880
Versatility 6.13% 1.13% 232
Mana Regen 2560 2560 0
Attack Power 13878 13042 0
Mastery 28.93% 28.93% 7473
Armor 4406 4406 4406
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 466.00
Local Head Benevolent Embersage's Casque
ilevel: 470, stats: { 585 Armor, +3163 Sta, +655 Crit, +307 Haste, +786 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }, enchant: incandescent_essence
Local Neck Eye of the Rising Flame
ilevel: 470, stats: { +1779 Sta, +233 Haste, +1397 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Life-Bound Shoulderpads
ilevel: 447, stats: { 456 Armor, +1796 Sta, +328 Mastery, +328 Haste, +476 AgiInt }
item effects: { equip: Toxified }
Local Chest Benevolent Embersage's Robe
ilevel: 460, stats: { 727 Armor, +2804 Sta, +639 Crit, +284 Mastery, +716 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 470, stats: { 439 Armor, +2372 Sta, +497 Haste, +224 Mastery, +590 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 460, stats: { 636 Armor, +2804 Sta, +630 Haste, +293 Mastery, +716 AgiInt }, enchant: { +155 StrAgiInt, +41 Vers (lambent_armor_kit_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 470, stats: { 488 Armor, +2372 Sta, +257 Crit, +412 Haste, +590 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Thermal Bindings
ilevel: 470, stats: { 390 Armor, +1779 Sta, +178 Crit, +363 Mastery, +442 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Benevolent Embersage's Talons
ilevel: 447, stats: { 373 Armor, +1796 Sta, +191 Vers, +464 Mastery, +476 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 470, stats: { +1779 Sta, +466 Haste, +1165 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 470, stats: { +1779 Sta, +1118 Crit, +512 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 470, stats: { +747 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 470, stats: { +687 Mastery }
item effects: { use: Balefire Branch }
Local Back Drape of the Loyal Vassal
ilevel: 470, stats: { 312 Armor, +1779 Sta, +305 Haste, +236 Mastery, +442 StrAgiInt }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 470, weapon: { 508 - 654, 2.6 }, stats: { +393 Int, +1896 Int, +1581 Sta, +145 Haste, +335 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 470, stats: { +1206 Int, +1581 Sta, +162 Haste, +319 Mastery }

Talents

RowDruid Talents [31]
1
2
3
4
5
6
7
8
9
10
RowBalance Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

druid="447+460 2p+2p"
source=default
spec=balance
level=70
race=tauren
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:hissing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Balance APL can be found at https://balance-simc.github.io/Balance-SimC/balance.txt

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=470,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=470,gem_id=192961/192961/192961
shoulders=lifebound_shoulderpads,id=193406,bonus_id=8836/1576/8797/8960,ilevel=447,crafted_stats=49/36
back=drape_of_the_loyal_vassal,id=158375,bonus_id=4795,ilevel=470
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=460,enchant_id=6625
wrists=thermal_bindings,id=134461,bonus_id=4795,ilevel=470,gem_id=192961
hands=benevolent_embersages_talons,id=207255,bonus_id=4795,ilevel=447
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=460,enchant_id=6830
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=470
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=470
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=470
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=470,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=470

# Gear Summary
# gear_ilvl=465.88
# gear_stamina=29270
# gear_intellect=9856
# gear_crit_rating=2847
# gear_haste_rating=3880
# gear_mastery_rating=7473
# gear_versatility_rating=232
# gear_armor=4406
# set_bonus=tier30_2pc=1
# set_bonus=tier31_2pc=1

447+470 2p+2p : 188583 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
188583.0 188583.0 186.2 / 0.099% 26294.6 / 13.9% 15156.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.1 12.1 Astral Power 0.00% 66.4 100.1% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
447+470 2p+2p 188583
Astral Smolder 12025 6.4% 63.9 4.68s 56486 0 Periodic 116.5 30983 0 30983 0.0% 77.6%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 63.90 0.00 116.51 116.51 48.07 0.0000 2.0000 3609494.63 3609494.63 0.00% 15489.47 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 116.51 75 158 30982.71 7987 103384 30989.79 23581 38377 3609495 3609495 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Denizen of the Dream 0 (5267) 0.0% (2.8%) 8.5 32.33s 187024 0

Stats Details: Denizen Of The Dream

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.46 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Denizen Of The Dream

  • id:394065
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394065
  • name:Denizen of the Dream
  • school:physical
  • tooltip:
  • description:Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.
    Fey Missile 16660  / 5267 2.8% 148.2 1.77s 10679 8202 Direct 147.3 8301 17251 10744 27.3%

Stats Details: Fey Missile

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 148.19 147.29 0.00 0.00 0.00 1.3020 0.0000 1582474.43 1582474.43 0.00% 8201.64 8201.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.71% 107.09 16 282 8301.49 6241 14410 8292.25 7327 9932 889006 889006 0.00%
crit 27.29% 40.20 8 104 17251.47 11397 29974 17235.38 14923 21533 693468 693468 0.00%

Action Details: Fey Missile

  • id:188046
  • school:astral
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.536
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.236000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:188046
  • name:Fey Missile
  • school:astral
  • tooltip:
  • description:{$@spelldesc187875=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$188083d=30 seconds}.}

Action Priority List

    default
    [ ]:4614.22
Hungering Shadowflame 2925 1.6% 17.2 16.42s 51207 0 Direct 17.2 39734 81388 51215 27.6%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.18 17.18 0.00 0.00 0.00 0.0000 0.0000 879683.78 879683.78 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.42% 12.44 3 26 39733.60 26959 154597 39576.54 26959 98887 494211 494211 0.00%
crit 27.58% 4.74 0 13 81388.30 54997 315378 80270.02 0 301918 385473 385473 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24191.79
  • base_dd_max:24191.79
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 5588 3.0% 34.0 8.83s 49407 0 Direct 33.9 38595 78684 49537 27.3%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.01 33.92 0.00 0.00 0.00 0.0000 0.0000 1680384.38 1680384.38 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.69% 24.65 8 45 38595.47 38162 43768 38594.54 38162 39868 951459 951459 0.00%
crit 27.31% 9.26 1 23 78684.28 77851 89287 78684.31 77851 84998 728926 728926 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:34245.43
  • base_dd_max:34245.43
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 12141 6.4% 14.4 21.60s 253769 260155 Direct 14.4 8990 18648 12310 34.4%
Periodic 308.2 8109 17129 11255 34.9% 99.6%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.37 14.37 308.22 308.22 13.37 0.9755 0.9708 3645811.15 3645811.15 0.00% 11639.15 260154.93
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 65.63% 9.43 2 16 8989.99 6768 16226 8983.97 7730 11253 84772 84772 0.00%
crit 34.37% 4.94 0 12 18647.82 14260 33101 18569.06 0 26938 92083 92083 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 65.12% 200.72 142 272 8109.34 379 14821 8111.41 7742 8591 1627684 1627684 0.00%
crit 34.88% 107.49 67 155 17129.21 2510 30236 17136.56 16032 18611 1841272 1841272 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.39

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.39
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    st
    [K]:1.29
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [S]:13.07
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
New Moon (Talent) 0 (16766) 0.0% (8.9%) 17.0 17.89s 296587 246818

Stats Details: Moons Talent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.98 0.00 0.00 0.00 0.00 1.2017 0.0000 0.00 0.00 0.00% 246817.72 246817.72

Action Details: Moons Talent

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
    Full Moon 6059 3.2% 5.3 62.85s 344605 184830 Direct 5.3 235854 476363 346818 46.1%

Stats Details: Full Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.30 5.26 0.00 0.00 0.00 1.8646 0.0000 1824826.74 1824826.74 0.00% 184830.01 184830.01
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.90% 2.84 0 6 235853.55 161225 379659 231570.55 0 371505 669001 669001 0.00%
crit 46.10% 2.43 0 6 476363.43 328899 770259 456097.95 0 735367 1155826 1155826 0.00%

Action Details: Full Moon

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:50.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Action Priority List

    st
    [V]:5.36
  • if_expr:astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    New Moon 4573 2.4% 6.0 53.29s 228279 302614 Direct 6.0 148777 318975 229704 47.5%

Stats Details: New Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.01 5.97 0.00 0.00 0.00 0.7545 0.0000 1370841.15 1370841.15 0.00% 302613.94 302613.94
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.45% 3.13 0 7 148776.51 81273 227014 146562.99 0 222790 465752 465752 0.00%
crit 47.55% 2.84 0 7 318975.29 182376 469530 314597.10 0 456025 905089 905089 0.00%

Action Details: New Moon

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Action Priority List

    st
    [T]:6.02
  • if_expr:astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Half Moon 6135 3.3% 5.7 57.60s 324036 263590 Direct 5.6 209930 426717 326044 53.6%

Stats Details: Half Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.68 5.64 0.00 0.00 0.00 1.2293 0.0000 1840647.71 1840647.71 0.00% 263589.82 263589.82
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 46.41% 2.62 0 7 209930.09 116830 326742 203287.22 0 306672 549774 549774 0.00%
crit 53.59% 3.02 0 7 426716.65 262166 666553 420001.68 0 646184 1290873 1290873 0.00%

Action Details: Half Moon

  • id:274282
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:24.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.875000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274282
  • name:Half Moon
  • school:astral
  • tooltip:
  • description:Deals {$s1=0} Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates {$=}{{$m3=240}/10} Astral Power.|r

Action Priority List

    st
    [U]:5.71
  • if_expr:astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (18157) 0.0% (9.6%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 7075 3.8% 94.3 3.16s 22550 0 Direct 94.0 15200 32221 22612 43.5%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 94.27 94.01 0.00 0.00 0.00 0.0000 0.0000 2125838.91 2125838.91 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.45% 53.07 26 85 15199.60 9997 28740 15199.69 13918 16952 806640 806640 0.00%
crit 43.55% 40.94 20 67 32220.67 20393 59507 32231.34 28521 36458 1319199 1319199 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 7092 3.8% 94.6 3.15s 22536 0 Direct 94.3 15182 32171 22597 43.6%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 94.56 94.31 0.00 0.00 0.00 0.0000 0.0000 2131077.40 2131077.40 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.36% 53.15 27 86 15181.94 9964 29170 15183.09 13835 16879 806973 806973 0.00%
crit 43.64% 41.16 18 69 32171.22 20327 59507 32178.36 28997 36265 1324105 1324105 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 3989 2.1% 6.3 48.13s 190281 0 Direct 6.3 127952 271340 190851 43.9%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.30 6.28 0.00 0.00 0.00 0.0000 0.0000 1198793.87 1198793.87 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.10% 3.52 0 8 127952.12 83846 238775 126868.79 0 212267 450734 450734 0.00%
crit 43.90% 2.76 0 8 271340.10 171045 500731 263633.48 0 463739 748059 748059 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 4943 2.6% 26.2 11.48s 56865 63106 Direct 27.2 38645 78750 54780 40.2%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.18 27.18 0.00 0.00 0.00 0.9011 0.0000 1488554.97 1488554.97 0.00% 63106.45 63106.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.78% 16.25 5 29 38644.95 17273 70824 38659.16 31683 46290 627857 627857 0.00%
crit 40.22% 10.93 1 23 78749.50 35237 139855 78773.37 43158 96017 860698 860698 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    st
    [L]:1.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
    st
    [P]:25.25
  • if_expr:variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Warrior of Elune2024251-1.000Spell DataNo-stacks
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Starsurge 57735 (78017) 30.6% (41.3%) 115.0 2.59s 203634 204401 Direct 114.7 (152.5) 103377 217961 151007 41.6% (42.1%)

Stats Details: Starsurge

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 114.97 114.73 0.00 0.00 0.00 0.9962 0.0000 17325198.27 17325198.27 0.00% 204400.83 204400.83
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.43% 67.04 39 94 103376.51 66909 193235 103394.98 96578 111678 6929709 6929709 0.00%
crit 41.57% 47.69 28 71 217960.66 136301 394199 218087.56 199409 242546 10395489 10395489 0.00%

Action Details: Starsurge

  • id:78674
  • school:astral
  • range:45.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:36.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.455000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.18

Spelldata

  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$s1=0} Astral damage.

Action Priority List

    st
    [Q]:84.75
  • if_expr:variable.starsurge_condition1
    st
    [X]:30.21
  • if_expr:variable.starsurge_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Flat Cost Incarnation: Chosen of Elune1025603-8.000Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Goldrinn's Fang 20282 10.7% 38.0 7.69s 160322 0 Direct 37.8 108755 228622 161073 43.7%

Stats Details: Goldrinns Fang

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.96 37.78 0.00 0.00 0.00 0.0000 0.0000 6085646.78 6085646.78 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.35% 21.29 7 42 108754.70 79631 202057 108769.92 95268 133664 2315126 2315126 0.00%
crit 43.65% 16.49 5 32 228622.27 162447 412196 228726.58 191793 281381 3770520 3770520 0.00%

Action Details: Goldrinns Fang

  • id:394047
  • school:astral
  • range:60.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.852000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10

Spelldata

  • id:394047
  • name:Goldrinn's Fang
  • school:astral
  • tooltip:Deals {$m1=0} Arcane damage.
  • description:Deals {$m1=0} Arcane damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountPower of Goldrinn3940462PCT1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Friend of the Fae39408310.100Spell Data
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Incarnation: Chosen of Elune10256020.100Spell Data
Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Dot / Debuff on Target Moonfire16481250.283Mastery
Sunfire16481550.283Mastery
Waning Twilight39395710.100
Sunfire 11962 6.3% 17.4 18.04s 206137 210667 Direct 17.4 8822 18201 12374 37.9%
Periodic 309.2 7825 16163 10927 37.2% 99.9%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.43 17.43 309.17 309.17 16.43 0.9785 0.9709 3593985.54 3593985.54 0.00% 11329.42 210667.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 62.12% 10.83 2 20 8822.12 5526 15259 8813.73 7545 10359 95551 95551 0.00%
crit 37.88% 6.60 1 15 18201.05 11273 31258 18197.07 11411 23320 120220 120220 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 62.80% 194.15 136 258 7824.61 91 13474 7823.06 7450 8225 1519136 1519136 0.00%
crit 37.20% 115.02 77 162 16163.05 508 27487 16163.81 15260 17309 1859078 1859078 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.26
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    st
    [J]:1.57
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [R]:15.86
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (3098) 0.0% (1.6%) 8.5 31.82s 110100 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.46 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 1612 0.9% 8.5 31.82s 57295 0 Direct 8.5 44596 90899 57301 27.4%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.46 8.46 0.00 0.00 0.00 0.0000 0.0000 484463.87 484463.87 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.57% 6.14 0 16 44596.46 44043 50512 44536.65 0 49974 273653 273653 0.00%
crit 27.43% 2.32 0 9 90898.96 89847 103045 82469.34 0 103045 210811 210811 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:39522.22
  • base_dd_max:39522.22
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 1486 0.8% 16.4 15.35s 27234 0 Direct 16.4 21208 43239 27238 27.4%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.40 16.40 0.00 0.00 0.00 0.0000 0.0000 446501.39 446501.39 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.64% 11.91 1 29 21208.30 20957 24036 21207.82 20957 23437 252585 252585 0.00%
crit 27.36% 4.48 0 15 43238.63 42752 49033 42450.91 0 49033 193917 193917 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18805.57
  • base_dd_max:18805.57
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 17692 9.4% 115.1 2.55s 46161 48419 Direct 114.7 30760 64451 46322 46.2%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 115.09 114.70 0.00 0.00 0.00 0.9534 0.0000 5312870.93 5312870.93 0.00% 48419.44 48419.44
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.81% 61.72 33 89 30760.02 12768 96576 30755.95 27451 34023 1898544 1898544 0.00%
crit 46.19% 52.98 32 79 64450.97 26046 203907 64461.80 56376 75546 3414327 3414327 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    st
    [M]:0.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
    st
    [Y]:113.38

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.400Spell Data
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
447+470 2p+2p
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+470 2p+2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+470 2p+2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+470 2p+2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 183.86s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    st
    [N]:2.00
  • if_expr:variable.cd_condition_st

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.7 60.02s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.66 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+470 2p+2p
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:57075.72
  • base_dd_max:57075.72
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.32s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.75 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+470 2p+2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.75
Elemental Potion of Ultimate Power 1.5 307.64s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.48
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
Warrior of Elune 6.1 48.30s

Stats Details: Warrior Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.15 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Warrior Of Elune

  • id:202425
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202425
  • name:Warrior of Elune
  • school:arcane
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.

Action Priority List

    st
    [O]:6.14
  • if_expr:variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 8.7 1.5 36.3s 33.9s 8.6s 24.85% 28.71% 1.5 (6.9) 8.5

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.7s
  • trigger_min/max:2.8s / 49.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:21.92% / 27.80%

Stack Uptimes

  • balance_of_all_things_arcane_1:2.86%
  • balance_of_all_things_arcane_2:2.92%
  • balance_of_all_things_arcane_3:2.99%
  • balance_of_all_things_arcane_4:3.01%
  • balance_of_all_things_arcane_5:3.02%
  • balance_of_all_things_arcane_6:3.28%
  • balance_of_all_things_arcane_7:3.38%
  • balance_of_all_things_arcane_8:3.39%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 18.1 3.5 17.0s 14.1s 8.4s 50.41% 54.49% 3.5 (20.4) 17.5

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 50.8s
  • trigger_min/max:0.0s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.3s
  • uptime_min/max:46.01% / 53.66%

Stack Uptimes

  • balance_of_all_things_nature_1:5.84%
  • balance_of_all_things_nature_2:5.93%
  • balance_of_all_things_nature_3:6.05%
  • balance_of_all_things_nature_4:6.17%
  • balance_of_all_things_nature_5:6.32%
  • balance_of_all_things_nature_6:6.49%
  • balance_of_all_things_nature_7:6.68%
  • balance_of_all_things_nature_8:6.92%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Best Friends with Aerwynn 2.8 0.0 70.0s 70.0s 10.8s 10.14% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 334.6s
  • trigger_min/max:12.0s / 334.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 35.33%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.91%
  • best_friends_with_aerwynn_2:0.91%
  • best_friends_with_aerwynn_3:0.91%
  • best_friends_with_aerwynn_4:0.91%
  • best_friends_with_aerwynn_5:0.92%
  • best_friends_with_aerwynn_6:0.92%
  • best_friends_with_aerwynn_7:0.92%
  • best_friends_with_aerwynn_8:0.93%
  • best_friends_with_aerwynn_9:0.93%
  • best_friends_with_aerwynn_10:0.93%
  • best_friends_with_aerwynn_11:0.94%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 112.2s 70.0s 45.7s 33.77% 0.00% 70.5 (70.5) 0.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 335.5s
  • trigger_min/max:12.0s / 334.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 283.6s
  • uptime_min/max:0.00% / 95.37%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.77%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 71.3s 71.3s 10.8s 9.89% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 338.1s
  • trigger_min/max:12.0s / 338.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 33.04%

Stack Uptimes

  • best_friends_with_pip_1:0.88%
  • best_friends_with_pip_2:0.89%
  • best_friends_with_pip_3:0.89%
  • best_friends_with_pip_4:0.89%
  • best_friends_with_pip_5:0.90%
  • best_friends_with_pip_6:0.90%
  • best_friends_with_pip_7:0.90%
  • best_friends_with_pip_8:0.90%
  • best_friends_with_pip_9:0.91%
  • best_friends_with_pip_10:0.91%
  • best_friends_with_pip_11:0.91%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 114.3s 71.3s 45.3s 32.96% 0.00% 69.2 (69.2) 0.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 353.2s
  • trigger_min/max:12.0s / 338.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 282.1s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:32.96%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 70.6s 70.6s 10.8s 9.98% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 313.3s
  • trigger_min/max:12.0s / 313.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 31.88%

Stack Uptimes

  • best_friends_with_urctos_1:0.89%
  • best_friends_with_urctos_2:0.89%
  • best_friends_with_urctos_3:0.90%
  • best_friends_with_urctos_4:0.90%
  • best_friends_with_urctos_5:0.90%
  • best_friends_with_urctos_6:0.91%
  • best_friends_with_urctos_7:0.91%
  • best_friends_with_urctos_8:0.91%
  • best_friends_with_urctos_9:0.92%
  • best_friends_with_urctos_10:0.92%
  • best_friends_with_urctos_11:0.92%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 113.4s 70.6s 45.3s 33.27% 0.00% 70.1 (70.1) 0.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 348.0s
  • trigger_min/max:12.0s / 313.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 277.2s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.27%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.66%

Stack Uptimes

  • bloodlust_1:13.48%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.8 0.0 62.3s 58.9s 50.6s 80.35% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 358.0s
  • trigger_min/max:15.0s / 287.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 359.6s
  • uptime_min/max:53.01% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.35%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Denizen of the Dream 8.5 0.0 45.3s 32.3s 41.2s 56.94% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_denizen_of_the_dream
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 239.5s
  • trigger_min/max:0.0s / 160.5s
  • trigger_pct:99.98%
  • duration_min/max:0.0s / 239.0s
  • uptime_min/max:19.76% / 97.86%

Stack Uptimes

  • denizen_of_the_dream_1:38.51%
  • denizen_of_the_dream_2:14.27%
  • denizen_of_the_dream_3:3.44%
  • denizen_of_the_dream_4:0.63%
  • denizen_of_the_dream_5:0.11%
  • denizen_of_the_dream_6:0.04%
  • denizen_of_the_dream_7:0.06%

Spelldata

  • id:394076
  • name:Denizen of the Dream
  • tooltip:
  • description:{$@spelldesc394065=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Dreamstate 15.5 0.4 20.0s 20.7s 3.1s 16.05% 21.42% 0.4 (0.7) 0.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 56.6s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.7s
  • uptime_min/max:9.32% / 25.70%

Stack Uptimes

  • dreamstate_1:9.63%
  • dreamstate_2:6.42%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 7.1 1.0 45.4s 44.9s 20.6s 49.12% 52.37% 1.0 (1.0) 6.9

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.6s
  • trigger_min/max:12.0s / 89.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:44.09% / 56.09%

Stack Uptimes

  • eclipse_lunar_1:49.12%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 13.8 5.8 22.4s 15.6s 20.1s 92.60% 95.96% 5.8 (5.8) 12.9

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 69.3s
  • trigger_min/max:0.0s / 55.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.8s
  • uptime_min/max:90.49% / 94.64%

Stack Uptimes

  • eclipse_solar_1:92.60%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 307.0s 307.0s 27.3s 13.25% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.1s
  • trigger_min/max:300.0s / 328.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 30.0s
  • uptime_min/max:9.88% / 18.03%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.25%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Friend of the Fae 5.2 3.2 55.6s 32.3s 24.8s 43.16% 43.10% 3.2 (3.2) 4.8

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_friend_of_the_fae
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 192.0s
  • trigger_min/max:0.0s / 160.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 117.7s
  • uptime_min/max:13.17% / 85.98%

Stack Uptimes

  • friend_of_the_fae_1:43.16%

Spelldata

  • id:394083
  • name:Friend of the Fae
  • tooltip:Arcane and Nature damage increased by {$=}w1%.
  • description:{$@spelldesc394081=When a Faerie Dragon is summoned, your spells deal {$394083m1=10}% increased damage for {$394083d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 7.1 0.0 44.9s 44.9s 20.2s 48.20% 51.10% 0.0 (0.0) 6.9

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.6s
  • trigger_min/max:12.0s / 89.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:43.33% / 54.96%

Stack Uptimes

  • incarnation_chosen_of_elune_1:48.20%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.6 0.0 99.9s 99.9s 19.5s 23.24% 0.00% 0.0 (0.0) 3.2

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:55.09

Trigger Details

  • interval_min/max:90.0s / 125.6s
  • trigger_min/max:90.0s / 125.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.27% / 26.14%

Stack Uptimes

  • kindled_soul_5:1.10%
  • kindled_soul_10:1.14%
  • kindled_soul_15:1.14%
  • kindled_soul_20:1.15%
  • kindled_soul_25:1.15%
  • kindled_soul_30:1.15%
  • kindled_soul_35:1.15%
  • kindled_soul_40:1.16%
  • kindled_soul_45:1.16%
  • kindled_soul_50:1.16%
  • kindled_soul_55:1.17%
  • kindled_soul_60:1.17%
  • kindled_soul_65:1.17%
  • kindled_soul_70:1.17%
  • kindled_soul_75:1.18%
  • kindled_soul_80:1.18%
  • kindled_soul_85:1.18%
  • kindled_soul_90:1.19%
  • kindled_soul_95:1.19%
  • kindled_soul_100:1.19%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Grace 12.9 0.0 20.6s 20.6s 5.9s 25.37% 0.00% 0.0 (0.0) 12.6

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.8s / 69.6s
  • trigger_min/max:12.8s / 69.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:19.48% / 29.34%

Stack Uptimes

  • natures_grace_1:25.37%

Spelldata

  • id:393959
  • name:Nature's Grace
  • tooltip:Haste increased by {$s1=10}%.
  • description:{$@spelldesc393958=After an Eclipse ends, you gain {$393959s1=10}% Haste for {$393959d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Vigil 3.7 0.0 90.3s 90.3s 14.7s 18.41% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 92.0s
  • trigger_min/max:90.0s / 92.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.58% / 21.05%

Stack Uptimes

  • natures_vigil_1:18.41%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.4 0.1 75.2s 68.9s 7.7s 6.23% 6.90% 0.1 (0.1) 1.3

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 323.0s
  • trigger_min/max:0.0s / 323.0s
  • trigger_pct:15.00%
  • duration_min/max:0.0s / 30.2s
  • uptime_min/max:0.00% / 28.11%

Stack Uptimes

  • owlkin_frenzy_1:6.23%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 8.1 107.8 39.0s 39.0s 34.9s 93.94% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:25.0s / 50.4s
  • trigger_min/max:25.0s / 50.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.6s
  • uptime_min/max:90.48% / 96.52%

Stack Uptimes

  • primordial_arcanic_pulsar_4:4.99%
  • primordial_arcanic_pulsar_8:5.60%
  • primordial_arcanic_pulsar_12:6.49%
  • primordial_arcanic_pulsar_16:6.97%
  • primordial_arcanic_pulsar_20:6.40%
  • primordial_arcanic_pulsar_24:6.09%
  • primordial_arcanic_pulsar_28:8.04%
  • primordial_arcanic_pulsar_32:7.91%
  • primordial_arcanic_pulsar_36:6.64%
  • primordial_arcanic_pulsar_40:7.10%
  • primordial_arcanic_pulsar_44:6.92%
  • primordial_arcanic_pulsar_48:7.09%
  • primordial_arcanic_pulsar_52:7.19%
  • primordial_arcanic_pulsar_56:6.50%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 18.5 4.1 16.7s 14.1s 6.4s 39.56% 39.80% 4.1 (4.1) 18.1

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 49.1s
  • trigger_min/max:0.0s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.9s
  • uptime_min/max:36.33% / 42.22%

Stack Uptimes

  • solstice_1:39.56%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 20.8 94.2 14.7s 2.6s 14.1s 97.25% 0.00% 53.0 (53.0) 7.5

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 20.1s
  • trigger_min/max:0.8s / 10.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:93.58% / 99.06%

Stack Uptimes

  • starlord_1:9.58%
  • starlord_2:15.53%
  • starlord_3:72.14%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Wafting Devotion 4.3 1.2 61.2s 45.4s 16.5s 23.73% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 195.9s
  • trigger_min/max:0.0s / 192.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 73.5s
  • uptime_min/max:5.22% / 54.93%

Stack Uptimes

  • wafting_devotion_1:23.73%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Warrior of Elune 6.1 0.0 48.3s 48.3s 22.0s 44.85% 43.91% 0.0 (0.0) 2.4

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_warrior_of_elune
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:45.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 81.9s
  • trigger_min/max:45.0s / 81.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s
  • uptime_min/max:34.55% / 50.84%

Stack Uptimes

  • warrior_of_elune_1:21.92%
  • warrior_of_elune_2:4.93%
  • warrior_of_elune_3:17.99%

Spelldata

  • id:202425
  • name:Warrior of Elune
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.
  • max_stacks:0
  • duration:25.00
  • cooldown:45.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Denizen of the Dream 8.5 2.0 21.0 32.3s 0.0s 160.5s
Primordial Arcanic Pulsar 7.1 6.0 9.0 40.7s 29.6s 49.7s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.08% 0.00% 1.44% 0.5s 0.0s 3.4s
Astral Smolder 77.74% 60.38% 92.69% 14.8s 0.0s 120.0s
Incarnation (Total) 48.20% 43.33% 54.96% 20.2s 0.0s 54.0s
Incarnation (Pulsar) 27.98% 25.83% 30.05% 11.8s 0.0s 12.0s
Lunar Eclipse Only 0.92% 0.72% 1.14% 2.7s 2.6s 2.7s
Solar Eclipse Only 44.40% 36.53% 50.37% 10.8s 0.0s 15.0s
No Eclipse 6.46% 4.23% 8.42% 1.5s 0.0s 3.5s
Friend of the Fae 43.16% 13.17% 85.98% 24.8s 0.0s 117.7s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Warrior of Elune7.0610.00036.94043.51426.46471.616
Full Moon
New Moon
Half Moon		0.3510.00019.6085.9635.37525.286

Eclipse Utilization

NoneSolarLunarBoth
Wrath5.114.5%56.3149.8%0.000.0%51.6745.7%
Starfire25.1892.6%0.000.0%2.007.4%0.000.0%
Starsurge0.000.0%46.4640.4%0.000.0%68.5059.6%
New Moon0.040.7%0.162.7%0.000.0%5.8096.6%
Half Moon0.000.1%0.325.6%0.000.0%5.3694.3%
Full Moon0.232.0%3.1827.4%0.080.7%8.1069.9%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
447+470 2p+2p
Nature's BalanceAstral Power99.73199.345.50%2.000.110.06%
Full MoonAstral Power5.29264.407.29%49.950.280.10%
Half MoonAstral Power5.68136.383.76%24.000.000.00%
MoonfireAstral Power14.3686.122.38%6.000.060.07%
New MoonAstral Power6.0172.061.99%12.000.000.00%
Orbit BreakerAstral Power6.30187.975.18%29.831.040.55%
Shooting Stars (Moonfire)Astral Power94.27188.355.19%2.000.200.11%
Shooting Stars (Sunfire)Astral Power94.57188.945.21%2.000.200.10%
StarfireAstral Power27.18398.7811.00%14.672.750.69%
SunfireAstral Power17.43104.582.88%6.000.020.02%
WrathAstral Power115.091798.8749.61%15.630.000.00%
Usage Type Count Total Tot% Avg RPE APR
447+470 2p+2p
StarsurgeAstral Power 115.693654.60100.00%31.5931.796405.85
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 712000.0 3255.79 3825.12 1431396.1 540808.4 -147555.0 712000.0
Astral Power 70.0 12.06 12.08 4.7 24.1 0.0 100.0

Statistics & Data Analysis

Fight Length
447+470 2p+2p Fight Length
Count 5081
Mean 300.69
Minimum 240.04
Maximum 360.00
Spread ( max - min ) 119.95
Range [ ( max - min ) / 2 * 100% ] 19.95%
Standard Deviation 34.5974
5th Percentile 246.48
95th Percentile 354.02
( 95th Percentile - 5th Percentile ) 107.55
Mean Distribution
Standard Deviation 0.4854
95.00% Confidence Interval ( 299.73 - 301.64 )
Normalized 95.00% Confidence Interval ( 99.68% - 100.32% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 509
0.1% Error 50858
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1022
DPS
447+470 2p+2p Damage Per Second
Count 5081
Mean 188583.01
Minimum 164618.63
Maximum 221531.95
Spread ( max - min ) 56913.32
Range [ ( max - min ) / 2 * 100% ] 15.09%
Standard Deviation 6773.1679
5th Percentile 177794.90
95th Percentile 200004.55
( 95th Percentile - 5th Percentile ) 22209.66
Mean Distribution
Standard Deviation 95.0205
95.00% Confidence Interval ( 188396.77 - 188769.24 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 4956
0.1 Scale Factor Error with Delta=300 391623
0.05 Scale Factor Error with Delta=300 1566489
0.01 Scale Factor Error with Delta=300 39162225
Priority Target DPS
447+470 2p+2p Priority Target Damage Per Second
Count 5081
Mean 188583.01
Minimum 164618.63
Maximum 221531.95
Spread ( max - min ) 56913.32
Range [ ( max - min ) / 2 * 100% ] 15.09%
Standard Deviation 6773.1679
5th Percentile 177794.90
95th Percentile 200004.55
( 95th Percentile - 5th Percentile ) 22209.66
Mean Distribution
Standard Deviation 95.0205
95.00% Confidence Interval ( 188396.77 - 188769.24 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 4956
0.1 Scale Factor Error with Delta=300 391623
0.05 Scale Factor Error with Delta=300 1566489
0.01 Scale Factor Error with Delta=300 39162225
DPS(e)
447+470 2p+2p Damage Per Second (Effective)
Count 5081
Mean 188583.01
Minimum 164618.63
Maximum 221531.95
Spread ( max - min ) 56913.32
Range [ ( max - min ) / 2 * 100% ] 15.09%
Damage
447+470 2p+2p Damage
Count 5081
Mean 55044621.46
Minimum 41838159.71
Maximum 69798390.19
Spread ( max - min ) 27960230.48
Range [ ( max - min ) / 2 * 100% ] 25.40%
DTPS
447+470 2p+2p Damage Taken Per Second
Count 5081
Mean 3827.61
Minimum 1119.23
Maximum 6952.76
Spread ( max - min ) 5833.53
Range [ ( max - min ) / 2 * 100% ] 76.20%
HPS
447+470 2p+2p Healing Per Second
Count 5081
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
447+470 2p+2p Healing Per Second (Effective)
Count 5081
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
447+470 2p+2p Heal
Count 5081
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
447+470 2p+2p Healing Taken Per Second
Count 5081
Mean 3249.99
Minimum 521.82
Maximum 6303.42
Spread ( max - min ) 5781.61
Range [ ( max - min ) / 2 * 100% ] 88.95%
TMI
447+470 2p+2p Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
447+470 2p+2pTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
447+470 2p+2p Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.48 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.59 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.75 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.st
# count action,conditions
J 1.57 sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
K 1.29 moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
0.00 starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
0.00 starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
L 1.00 starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
M 0.00 wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
0.00 celestial_alignment,if=variable.cd_condition_st
N 2.00 incarnation,if=variable.cd_condition_st
0.00 variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
0.00 variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
O 6.14 warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
P 25.25 starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
0.00 wrath,if=variable.enter_eclipse
0.00 variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
0.00 convoke_the_spirits,if=variable.convoke_condition
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+55
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 starfall,if=buff.starweavers_warp.up
0.00 variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
Q 84.75 starsurge,if=variable.starsurge_condition1
R 15.86 sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
S 13.07 moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
T 6.02 new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
U 5.71 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
V 5.36 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
W 12.32 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
X 30.21 starsurge,if=variable.starsurge_condition2
Y 113.38 wrath
Z 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFJKLNDEQQQTQUQVYXYYXRYXYSWQQYQYYYYXYYOXTXYYXYRWQQQYQQYYYSYXYXYXPPQQRYQYYYYYXXPPQSYYQRUQVOQYYWQQQYPPQYQSRYYYWQFQYYQYPPQQYQYYRYQSQETUQYQYYYXYOWQPPQQRYYQSYYXYWQYYPPQQRQYYYYWQQSYQVQQTQRYYWQPOPQYQYQYYSYXYRQQYPFPQYNQUQVXYWQQYQRSQYYYEYXXYWQYQTYQYYRXYYXSYQOQQYYYXPPQQURYYWQQQYSYPPQQYYYYWQQRYQYYPPQYSWQQYQYORYYYXFYXVQQQTYYSXRPPQYXYYQQYYQYYPPQRXSYWQQYYQOYYYXEQUVWQQQRYYSPPDQQYYYWQQYYQRYPPQYXYYSQQTQUYXRY

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask 447+470 2p+2p 50.0/100: 50% astral_power
Pre precombat 1 food 447+470 2p+2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 2 augmentation 447+470 2p+2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 4 no_cd_talent 447+470 2p+2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 5 on_use_trinket 447+470 2p+2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 6 on_use_trinket 447+470 2p+2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 7 on_use_trinket 447+470 2p+2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 60.0/100: 60% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil 447+470 2p+2p 50.0/100: 50% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.000 st J sunfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.943 st K moonfire Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:01.886 st L starfire Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, corrupting_rage
0:02.735 st N incarnation_chosen_of_elune Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage
0:02.735 default D potion Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage
0:02.735 default E use_items Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
0:02.735 st Q starsurge Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:03.591 st Q starsurge Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, dreamstate(2), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:04.413 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), dreamstate(2), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:05.207 st T new_moon Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), dreamstate(2), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:05.962 st Q starsurge Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), dreamstate(2), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:06.717 st U half_moon Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), dreamstate(2), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:07.659 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), dreamstate(2), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
0:08.412 st V full_moon Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), solstice, starlord(3), dreamstate(2), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:09.826 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), dreamstate, best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:10.578 st X starsurge Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), dreamstate, best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:11.333 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:12.088 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:12.842 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:13.597 st R sunfire Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:14.351 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:15.106 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:15.862 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:16.615 st S moonfire Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:17.370 st W cancel_buff Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.370 st Q starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:18.163 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:18.926 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:19.680 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:20.433 st Y wrath Fluffy_Pillow 12.0/100: 12% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:21.187 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:21.953 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:22.718 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:23.484 st X starsurge Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
0:24.249 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
0:25.015 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
0:25.780 st O warrior_of_elune Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
0:25.780 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
0:26.545 st T new_moon Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
0:27.300 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
0:28.065 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
0:28.830 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
0:29.596 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
0:30.361 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
0:31.127 st R sunfire Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
0:31.893 st W cancel_buff Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
0:31.893 st Q starsurge Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
0:32.749 st Q starsurge Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord, warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage
0:33.574 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(2), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage
0:34.367 st Y wrath Fluffy_Pillow 12.0/100: 12% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage
0:35.132 st Q starsurge Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage
0:35.898 st Q starsurge Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage
0:36.664 st Y wrath Fluffy_Pillow 8.0/100: 8% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage
0:37.430 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage
0:38.197 st Y wrath Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage
0:38.959 st S moonfire Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage
0:39.724 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage
0:40.488 st X starsurge Fluffy_Pillow 84.0/100: 84% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage
0:41.482 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage
0:42.476 st X starsurge Fluffy_Pillow 74.0/100: 74% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage
0:43.471 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage
0:44.464 st X starsurge Fluffy_Pillow 62.0/100: 62% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage
0:45.457 st P starfire Fluffy_Pillow 40.0/100: 40% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn_static, corrupting_rage
0:46.211 st P starfire Fluffy_Pillow 56.8/100: 57% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), best_friends_with_aerwynn_static, corrupting_rage
0:46.966 st Q starsurge Fluffy_Pillow 73.6/100: 74% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(32), solstice, warrior_of_elune, best_friends_with_aerwynn_static, corrupting_rage
0:48.079 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord, warrior_of_elune, best_friends_with_aerwynn_static, corrupting_rage
0:49.150 st R sunfire Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, best_friends_with_aerwynn_static, corrupting_rage
0:50.180 st Y wrath Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, best_friends_with_aerwynn_static, corrupting_rage
0:51.211 st Q starsurge Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starlord(2), best_friends_with_aerwynn_static, corrupting_rage
0:52.346 st Y wrath Fluffy_Pillow 5.6/100: 6% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
0:53.440 st Y wrath Fluffy_Pillow 21.6/100: 22% astral_power balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
0:54.534 st Y wrath Fluffy_Pillow 39.6/100: 40% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
0:55.628 st Y wrath Fluffy_Pillow 55.6/100: 56% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
0:56.720 st Y wrath Fluffy_Pillow 71.6/100: 72% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
0:57.814 st X starsurge Fluffy_Pillow 89.6/100: 90% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
0:58.905 st X starsurge Fluffy_Pillow 53.6/100: 54% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
0:59.998 st P starfire Fluffy_Pillow 17.6/100: 18% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
1:01.635 st P starfire Fluffy_Pillow 31.6/100: 32% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), starlord(3), dreamstate, best_friends_with_aerwynn_static, corrupting_rage
1:02.531 st Q starsurge Fluffy_Pillow 45.6/100: 46% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, dreamstate, best_friends_with_aerwynn_static, corrupting_rage
1:03.643 st S moonfire Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, dreamstate, best_friends_with_aerwynn_static, corrupting_rage
1:04.713 st Y wrath Fluffy_Pillow 19.6/100: 20% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, best_friends_with_aerwynn_static, corrupting_rage
1:05.466 st Y wrath Fluffy_Pillow 35.6/100: 36% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage
1:06.539 st Q starsurge Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage
1:07.610 st R sunfire Fluffy_Pillow 19.6/100: 20% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage
1:08.639 st U half_moon Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage
1:10.011 st Q starsurge Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), best_friends_with_urctos(6), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:10.966 st V full_moon Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_urctos(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:12.802 st O warrior_of_elune Fluffy_Pillow 81.6/100: 82% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), starlord(3), best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:12.802 st Q starsurge Fluffy_Pillow 81.6/100: 82% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), starlord(3), warrior_of_elune(3), best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:13.723 st Y wrath Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), best_friends_with_urctos(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:14.644 st Y wrath Fluffy_Pillow 69.6/100: 70% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:15.564 st W cancel_buff Fluffy_Pillow 87.6/100: 88% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:15.564 st Q starsurge Fluffy_Pillow 87.6/100: 88% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), warrior_of_elune(3), best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:16.595 st Q starsurge Fluffy_Pillow 59.6/100: 60% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord, warrior_of_elune(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:17.585 st Q starsurge Fluffy_Pillow 31.6/100: 32% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(2), warrior_of_elune(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:18.538 st Y wrath Fluffy_Pillow 5.6/100: 6% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_urctos(11), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:19.458 st P starfire Fluffy_Pillow 15.6/100: 16% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos(10), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:20.213 st P starfire Fluffy_Pillow 32.4/100: 32% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_urctos(9), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:20.968 st Q starsurge Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(8), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:21.888 st Y wrath Fluffy_Pillow 19.2/100: 19% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(7), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:22.809 st Q starsurge Fluffy_Pillow 37.2/100: 37% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(6), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:23.727 st S moonfire Fluffy_Pillow 5.2/100: 5% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:24.648 st R sunfire Fluffy_Pillow 17.2/100: 17% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage
1:25.740 st Y wrath Fluffy_Pillow 25.2/100: 25% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage
1:26.832 st Y wrath Fluffy_Pillow 43.2/100: 43% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage
1:27.925 st Y wrath Fluffy_Pillow 61.2/100: 61% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage
1:29.019 st W cancel_buff Fluffy_Pillow 77.2/100: 77% astral_power eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:29.019 st Q starsurge Fluffy_Pillow 77.2/100: 77% astral_power eclipse_solar, primordial_arcanic_pulsar(28), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:30.151 default F natures_vigil 447+470 2p+2p 43.2/100: 43% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord, warrior_of_elune, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:30.151 st Q starsurge Fluffy_Pillow 43.2/100: 43% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(32), starlord, warrior_of_elune, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:31.242 st Y wrath Fluffy_Pillow 9.2/100: 9% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion
1:32.291 st Y wrath Fluffy_Pillow 25.2/100: 25% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion
1:33.339 st Q starsurge Fluffy_Pillow 45.2/100: 45% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion
1:34.390 st Y wrath Fluffy_Pillow 9.2/100: 9% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion
1:35.400 st P starfire Fluffy_Pillow 51.2/100: 51% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, dreamstate, best_friends_with_urctos_static, wafting_devotion
1:36.155 st P starfire Fluffy_Pillow 70.0/100: 70% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_urctos_static, wafting_devotion
1:36.984 st Q starsurge Fluffy_Pillow 84.0/100: 84% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_urctos_static, wafting_devotion
1:37.905 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_urctos_static, wafting_devotion
1:38.825 st Y wrath Fluffy_Pillow 18.0/100: 18% astral_power natures_vigil, balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_urctos_static, wafting_devotion
1:39.745 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power natures_vigil, balance_of_all_things_nature(6), eclipse_solar, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_urctos_static, wafting_devotion
1:40.666 st Y wrath Fluffy_Pillow 6.0/100: 6% astral_power natures_vigil, balance_of_all_things_nature(5), eclipse_solar, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(52), solstice, starlord(3), best_friends_with_urctos_static, wafting_devotion
1:41.588 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power natures_vigil, balance_of_all_things_nature(4), eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(52), solstice, starlord(3), best_friends_with_urctos_static, wafting_devotion
1:42.600 st R sunfire Fluffy_Pillow 44.0/100: 44% astral_power natures_vigil, balance_of_all_things_nature(3), eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(52), solstice, starlord(3), best_friends_with_urctos_static, wafting_devotion
1:43.613 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power natures_vigil, balance_of_all_things_nature(2), eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_urctos_static, wafting_devotion
1:44.624 st Q starsurge Fluffy_Pillow 70.0/100: 70% astral_power natures_vigil, balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), best_friends_with_urctos_static
1:45.848 st S moonfire Fluffy_Pillow 36.0/100: 36% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord, best_friends_with_urctos_static
1:47.023 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord, best_friends_with_urctos_static, corrupting_rage
1:48.199 default E use_items Fluffy_Pillow 10.0/100: 10% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(2), best_friends_with_urctos_static, corrupting_rage
1:48.199 st T new_moon Fluffy_Pillow 10.0/100: 10% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(2), best_friends_with_urctos_static, corrupting_rage, kindled_soul(100)
1:48.953 st U half_moon Fluffy_Pillow 22.0/100: 22% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(2), best_friends_with_urctos_static, corrupting_rage, kindled_soul(100)
1:50.327 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(2), best_friends_with_urctos_static, kindled_soul(90)
1:51.358 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_urctos_static, kindled_soul(85)
1:52.352 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_urctos_static, kindled_soul(80)
1:53.346 st Y wrath Fluffy_Pillow 18.0/100: 18% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(8), starlord(3), best_friends_with_urctos_static, kindled_soul(75)
1:54.341 st Y wrath Fluffy_Pillow 36.0/100: 36% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(8), starlord(3), best_friends_with_urctos_static, kindled_soul(70)
1:55.336 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(8), starlord(3), best_friends_with_urctos_static, kindled_soul(65)
1:56.331 st X starsurge Fluffy_Pillow 70.0/100: 70% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), best_friends_with_urctos_static, kindled_soul(60)
1:57.326 st Y wrath Fluffy_Pillow 44.0/100: 44% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_urctos_static, kindled_soul(55)
1:58.320 st O warrior_of_elune Fluffy_Pillow 60.0/100: 60% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_urctos_static, kindled_soul(50)
1:58.320 st W cancel_buff Fluffy_Pillow 60.0/100: 60% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, kindled_soul(50)
1:58.320 st Q starsurge Fluffy_Pillow 60.0/100: 60% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), warrior_of_elune(3), best_friends_with_urctos_static, kindled_soul(50)
1:59.433 st P starfire Fluffy_Pillow 32.0/100: 32% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), starlord, warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, kindled_soul(45)
2:00.187 st P starfire Fluffy_Pillow 50.8/100: 51% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), starlord, warrior_of_elune(2), best_friends_with_urctos_static, kindled_soul(45)
2:00.941 st Q starsurge Fluffy_Pillow 69.6/100: 70% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord, warrior_of_elune, best_friends_with_urctos_static, kindled_soul(40)
2:02.011 st Q starsurge Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(2), warrior_of_elune, best_friends_with_urctos_static, kindled_soul(35)
2:03.042 st R sunfire Fluffy_Pillow 7.6/100: 8% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, kindled_soul(30)
2:04.036 st Y wrath Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage, kindled_soul(25)
2:05.030 st Y wrath Fluffy_Pillow 31.6/100: 32% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage, kindled_soul(20)
2:06.123 st Q starsurge Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(15)
2:07.216 st S moonfire Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(5)
2:08.309 st Y wrath Fluffy_Pillow 23.6/100: 24% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage
2:09.402 st Y wrath Fluffy_Pillow 43.6/100: 44% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, corrupting_rage
2:10.495 st X starsurge Fluffy_Pillow 61.6/100: 62% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, corrupting_rage
2:11.586 st Y wrath Fluffy_Pillow 27.6/100: 28% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, corrupting_rage
2:12.681 st W cancel_buff Fluffy_Pillow 45.6/100: 46% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, corrupting_rage
2:12.681 st Q starsurge Fluffy_Pillow 45.6/100: 46% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), warrior_of_elune, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, corrupting_rage
2:13.904 st Y wrath Fluffy_Pillow 9.6/100: 10% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord, warrior_of_elune, best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, corrupting_rage
2:15.081 st Y wrath Fluffy_Pillow 27.6/100: 28% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord, warrior_of_elune, best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, corrupting_rage
2:16.258 st P starfire Fluffy_Pillow 69.6/100: 70% astral_power natures_grace, primordial_arcanic_pulsar(36), starlord, warrior_of_elune, dreamstate, best_friends_with_aerwynn, best_friends_with_aerwynn_static, corrupting_rage
2:17.011 st P starfire Fluffy_Pillow 88.4/100: 88% astral_power natures_grace, primordial_arcanic_pulsar(36), starlord, best_friends_with_aerwynn, best_friends_with_aerwynn_static, corrupting_rage
2:17.973 st Q starsurge Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord, best_friends_with_aerwynn_static, corrupting_rage
2:19.043 st Q starsurge Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), best_friends_with_aerwynn_static, corrupting_rage
2:20.073 st R sunfire Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:21.067 st Q starsurge Fluffy_Pillow 46.0/100: 46% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:22.062 st Y wrath Fluffy_Pillow 10.0/100: 10% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:23.157 st Y wrath Fluffy_Pillow 28.0/100: 28% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:24.249 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:25.343 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:26.435 st W cancel_buff Fluffy_Pillow 82.0/100: 82% astral_power eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:26.435 st Q starsurge Fluffy_Pillow 82.0/100: 82% astral_power eclipse_solar, primordial_arcanic_pulsar(48), best_friends_with_aerwynn_static, corrupting_rage
2:27.657 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord, best_friends_with_aerwynn_static, corrupting_rage
2:28.833 st S moonfire Fluffy_Pillow 18.0/100: 18% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(2), best_friends_with_aerwynn_static, corrupting_rage
2:29.967 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(2), best_friends_with_aerwynn_static, corrupting_rage
2:31.101 st Q starsurge Fluffy_Pillow 46.0/100: 46% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(2), best_friends_with_aerwynn_static, corrupting_rage
2:32.234 st V full_moon Fluffy_Pillow 12.0/100: 12% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:34.220 st Q starsurge Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:35.215 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:36.210 st T new_moon Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:36.965 st Q starsurge Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:37.961 st R sunfire Fluffy_Pillow 6.0/100: 6% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:38.956 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:39.950 st Y wrath Fluffy_Pillow 36.0/100: 36% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:40.945 st W cancel_buff Fluffy_Pillow 56.0/100: 56% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:40.945 st Q starsurge Fluffy_Pillow 56.0/100: 56% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), best_friends_with_aerwynn_static, corrupting_rage
2:42.055 st P starfire Fluffy_Pillow 30.0/100: 30% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord, best_friends_with_aerwynn_static, corrupting_rage
2:43.657 st O warrior_of_elune Fluffy_Pillow 42.0/100: 42% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord, dreamstate(2), best_friends_with_aerwynn_static, corrupting_rage
2:43.657 st P starfire Fluffy_Pillow 42.0/100: 42% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord, warrior_of_elune(3), dreamstate, best_friends_with_aerwynn_static, corrupting_rage
2:44.412 st Q starsurge Fluffy_Pillow 58.8/100: 59% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord, warrior_of_elune(3), dreamstate, best_friends_with_aerwynn_static, corrupting_rage
2:45.483 st Y wrath Fluffy_Pillow 26.8/100: 27% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(2), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage
2:46.238 st Q starsurge Fluffy_Pillow 44.8/100: 45% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(2), warrior_of_elune(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:47.192 st Y wrath Fluffy_Pillow 10.8/100: 11% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:48.113 st Q starsurge Fluffy_Pillow 62.8/100: 63% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune(3), best_friends_with_pip(11), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:49.034 st Y wrath Fluffy_Pillow 26.8/100: 27% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune(3), best_friends_with_pip(10), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:49.956 st Y wrath Fluffy_Pillow 44.8/100: 45% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), best_friends_with_pip(9), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:50.966 st S moonfire Fluffy_Pillow 60.8/100: 61% astral_power balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), best_friends_with_pip(8), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:51.979 st Y wrath Fluffy_Pillow 70.8/100: 71% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), best_friends_with_pip(7), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:52.991 st X starsurge Fluffy_Pillow 86.8/100: 87% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), best_friends_with_pip(6), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:54.001 st Y wrath Fluffy_Pillow 52.8/100: 53% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), best_friends_with_pip(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:55.015 st R sunfire Fluffy_Pillow 68.8/100: 69% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), best_friends_with_pip(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:56.025 st Q starsurge Fluffy_Pillow 78.8/100: 79% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), warrior_of_elune(3), best_friends_with_pip(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:57.157 st Q starsurge Fluffy_Pillow 44.8/100: 45% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, warrior_of_elune(3), best_friends_with_pip(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:58.246 st Y wrath Fluffy_Pillow 10.8/100: 11% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune(3), best_friends_with_pip, best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:59.296 st P starfire Fluffy_Pillow 20.8/100: 21% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune(3), dreamstate, best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:00.050 default F natures_vigil 447+470 2p+2p 39.6/100: 40% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune(2), dreamstate, best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:00.151 st P starfire Fluffy_Pillow 39.6/100: 40% astral_power natures_vigil, denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:00.904 st Q starsurge Fluffy_Pillow 58.4/100: 58% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:01.857 st Y wrath Fluffy_Pillow 26.4/100: 26% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:02.779 st N incarnation_chosen_of_elune Fluffy_Pillow 46.4/100: 46% astral_power natures_vigil, balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:02.779 st Q starsurge Fluffy_Pillow 46.4/100: 46% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), warrior_of_elune, dreamstate(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:03.616 st U half_moon Fluffy_Pillow 24.4/100: 24% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), warrior_of_elune, dreamstate(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:04.730 st Q starsurge Fluffy_Pillow 50.4/100: 50% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord(3), warrior_of_elune, dreamstate(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:05.649 st V full_moon Fluffy_Pillow 26.4/100: 26% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), warrior_of_elune, dreamstate(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:07.551 st X starsurge Fluffy_Pillow 82.4/100: 82% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), warrior_of_elune, dreamstate(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:08.472 st Y wrath Fluffy_Pillow 58.4/100: 58% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), solstice, starlord(3), warrior_of_elune, dreamstate, best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:09.226 st W cancel_buff Fluffy_Pillow 76.4/100: 76% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), dreamstate, best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:09.226 st Q starsurge Fluffy_Pillow 76.4/100: 76% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), dreamstate, best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:10.256 st Q starsurge Fluffy_Pillow 50.4/100: 50% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord, dreamstate, best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:11.246 st Y wrath Fluffy_Pillow 22.4/100: 22% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:12.002 st Q starsurge Fluffy_Pillow 42.4/100: 42% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:12.956 st R sunfire Fluffy_Pillow 16.4/100: 16% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:13.878 st S moonfire Fluffy_Pillow 22.4/100: 22% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:14.799 st Q starsurge Fluffy_Pillow 30.4/100: 30% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:15.722 st Y wrath Fluffy_Pillow 6.4/100: 6% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip_static, corrupting_rage
3:16.715 st Y wrath Fluffy_Pillow 24.4/100: 24% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip_static, corrupting_rage
3:17.711 st Y wrath Fluffy_Pillow 42.4/100: 42% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip_static, corrupting_rage
3:18.705 default E use_items Fluffy_Pillow 60.4/100: 60% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip_static, corrupting_rage
3:18.705 st Y wrath Fluffy_Pillow 60.4/100: 60% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
3:19.699 st X starsurge Fluffy_Pillow 78.4/100: 78% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
3:20.693 st X starsurge Fluffy_Pillow 50.4/100: 50% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(95)
3:21.687 st Y wrath Fluffy_Pillow 24.4/100: 24% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(90)
3:22.683 st W cancel_buff Fluffy_Pillow 40.4/100: 40% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(85)
3:22.683 st Q starsurge Fluffy_Pillow 40.4/100: 40% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), best_friends_with_pip_static, corrupting_rage, kindled_soul(85)
3:23.795 st Y wrath Fluffy_Pillow 12.4/100: 12% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord, best_friends_with_pip_static, corrupting_rage, kindled_soul(75)
3:24.865 st Q starsurge Fluffy_Pillow 30.4/100: 30% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord, best_friends_with_pip_static, corrupting_rage, kindled_soul(70)
3:25.935 st T new_moon Fluffy_Pillow 2.4/100: 2% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(65)
3:26.690 st Y wrath Fluffy_Pillow 16.4/100: 16% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(65)
3:27.722 st Q starsurge Fluffy_Pillow 66.4/100: 66% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(2), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage, kindled_soul(55)
3:28.752 st Y wrath Fluffy_Pillow 40.4/100: 40% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage, kindled_soul(50)
3:29.746 st Y wrath Fluffy_Pillow 56.4/100: 56% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage, kindled_soul(45)
3:30.740 st R sunfire Fluffy_Pillow 76.4/100: 76% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage, kindled_soul(40)
3:31.734 st X starsurge Fluffy_Pillow 82.4/100: 82% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage, kindled_soul(35)
3:32.728 st Y wrath Fluffy_Pillow 54.4/100: 54% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage, kindled_soul(30)
3:33.723 st Y wrath Fluffy_Pillow 72.4/100: 72% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(25)
3:34.717 st X starsurge Fluffy_Pillow 90.4/100: 90% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage, kindled_soul(20)
3:35.711 st S moonfire Fluffy_Pillow 64.4/100: 64% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(15)
3:36.705 st Y wrath Fluffy_Pillow 72.4/100: 72% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage, kindled_soul(10)
3:37.699 st Q starsurge Fluffy_Pillow 88.4/100: 88% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(40), best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage, kindled_soul(10)
3:38.812 st O warrior_of_elune Fluffy_Pillow 62.4/100: 62% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(44), starlord, best_friends_with_urctos_static, corrupting_rage
3:38.812 st Q starsurge Fluffy_Pillow 62.4/100: 62% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(44), starlord, warrior_of_elune(3), best_friends_with_urctos_static, corrupting_rage
3:39.882 st Q starsurge Fluffy_Pillow 36.4/100: 36% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(48), starlord(2), warrior_of_elune(3), best_friends_with_urctos_static, corrupting_rage
3:40.912 st Y wrath Fluffy_Pillow 10.4/100: 10% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, corrupting_rage
3:41.905 st Y wrath Fluffy_Pillow 26.4/100: 26% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, corrupting_rage
3:42.899 st Y wrath Fluffy_Pillow 44.4/100: 44% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, corrupting_rage
3:43.895 st X starsurge Fluffy_Pillow 60.4/100: 60% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, corrupting_rage
3:44.891 st P starfire Fluffy_Pillow 32.4/100: 32% astral_power natures_grace, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, corrupting_rage
3:45.647 st P starfire Fluffy_Pillow 53.2/100: 53% astral_power natures_grace, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(2), best_friends_with_urctos_static, corrupting_rage
3:46.401 st Q starsurge Fluffy_Pillow 74.0/100: 74% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static
3:47.395 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static
3:48.301 st U half_moon Fluffy_Pillow 18.0/100: 18% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, best_friends_with_pip(11), best_friends_with_pip_static
3:49.505 st R sunfire Fluffy_Pillow 42.0/100: 42% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, best_friends_with_pip(10), best_friends_with_pip_static
3:50.410 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, best_friends_with_pip(9), best_friends_with_pip_static
3:51.315 st Y wrath Fluffy_Pillow 72.0/100: 72% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, best_friends_with_pip(8), best_friends_with_pip_static
3:52.309 st W cancel_buff Fluffy_Pillow 88.0/100: 88% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, best_friends_with_pip(7), best_friends_with_pip_static
3:52.309 st Q starsurge Fluffy_Pillow 88.0/100: 88% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, warrior_of_elune, best_friends_with_pip(7), best_friends_with_pip_static
3:53.421 st Q starsurge Fluffy_Pillow 60.0/100: 60% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord, warrior_of_elune, best_friends_with_pip(6), best_friends_with_pip_static
3:54.491 st Q starsurge Fluffy_Pillow 34.0/100: 34% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(2), warrior_of_elune, best_friends_with_pip(5), best_friends_with_pip_static
3:55.523 st Y wrath Fluffy_Pillow 8.0/100: 8% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, best_friends_with_pip(4), best_friends_with_pip_static
3:56.517 st S moonfire Fluffy_Pillow 24.0/100: 24% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, best_friends_with_pip(3), best_friends_with_pip_static
3:57.512 st Y wrath Fluffy_Pillow 34.0/100: 34% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, best_friends_with_pip(2), best_friends_with_pip_static
3:58.507 st P starfire Fluffy_Pillow 46.0/100: 46% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, dreamstate, best_friends_with_pip, best_friends_with_pip_static
3:59.262 st P starfire Fluffy_Pillow 64.8/100: 65% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(3), best_friends_with_pip_static
4:00.158 st Q starsurge Fluffy_Pillow 78.8/100: 79% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), best_friends_with_pip_static
4:01.152 st Q starsurge Fluffy_Pillow 44.8/100: 45% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), best_friends_with_pip_static, corrupting_rage
4:02.145 st Y wrath Fluffy_Pillow 12.8/100: 13% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), best_friends_with_pip_static, corrupting_rage
4:03.139 st Y wrath Fluffy_Pillow 32.8/100: 33% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), best_friends_with_pip_static, corrupting_rage
4:04.135 st Y wrath Fluffy_Pillow 50.8/100: 51% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), best_friends_with_pip_static, corrupting_rage
4:05.130 st Y wrath Fluffy_Pillow 68.8/100: 69% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(24), solstice, starlord(3), best_friends_with_pip_static, corrupting_rage
4:06.222 st W cancel_buff Fluffy_Pillow 88.8/100: 89% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_pip_static, corrupting_rage
4:06.222 st Q starsurge Fluffy_Pillow 88.8/100: 89% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(24), best_friends_with_pip_static, corrupting_rage
4:07.447 st Q starsurge Fluffy_Pillow 52.8/100: 53% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(28), starlord, best_friends_with_pip_static, corrupting_rage
4:08.623 st R sunfire Fluffy_Pillow 18.8/100: 19% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), best_friends_with_pip_static, corrupting_rage
4:09.757 st Y wrath Fluffy_Pillow 26.8/100: 27% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), best_friends_with_pip_static, corrupting_rage
4:10.888 st Q starsurge Fluffy_Pillow 42.8/100: 43% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), best_friends_with_pip_static, corrupting_rage
4:12.020 st Y wrath Fluffy_Pillow 10.8/100: 11% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_pip_static, corrupting_rage
4:13.111 st Y wrath Fluffy_Pillow 26.8/100: 27% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_pip_static, corrupting_rage
4:14.204 st P starfire Fluffy_Pillow 76.8/100: 77% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_pip_static, corrupting_rage
4:15.842 st P starfire Fluffy_Pillow 90.8/100: 91% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage
4:16.737 st Q starsurge Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage
4:17.730 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_pip_static, corrupting_rage
4:18.484 st S moonfire Fluffy_Pillow 84.0/100: 84% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_pip_static
4:19.478 st W cancel_buff Fluffy_Pillow 90.0/100: 90% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_pip_static
4:19.478 st Q starsurge Fluffy_Pillow 90.0/100: 90% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, best_friends_with_pip_static
4:20.590 st Q starsurge Fluffy_Pillow 54.0/100: 54% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, best_friends_with_pip_static
4:21.661 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(2), best_friends_with_pip_static
4:22.793 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(2), best_friends_with_pip_static
4:23.925 st Y wrath Fluffy_Pillow 6.0/100: 6% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_pip_static
4:25.018 st O warrior_of_elune Fluffy_Pillow 24.0/100: 24% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_pip_static
4:25.018 st R sunfire Fluffy_Pillow 24.0/100: 24% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_pip_static
4:26.113 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_pip_static
4:27.205 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_pip_static
4:28.300 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_pip_static
4:29.392 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_pip_static
4:30.486 default F natures_vigil 447+470 2p+2p 48.0/100: 48% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_pip_static
4:30.486 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_pip_static
4:31.578 st X starsurge Fluffy_Pillow 64.0/100: 64% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_pip_static
4:32.671 st V full_moon Fluffy_Pillow 34.0/100: 34% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), best_friends_with_pip_static
4:34.655 st Q starsurge Fluffy_Pillow 94.0/100: 94% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, warrior_of_elune(3), best_friends_with_pip_static, corrupting_rage
4:35.768 st Q starsurge Fluffy_Pillow 68.0/100: 68% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, warrior_of_elune(3), best_friends_with_pip_static, corrupting_rage
4:36.840 st Q starsurge Fluffy_Pillow 46.0/100: 46% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), warrior_of_elune(3), best_friends_with_pip_static, corrupting_rage
4:37.871 st T new_moon Fluffy_Pillow 18.0/100: 18% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, corrupting_rage
4:38.626 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, corrupting_rage
4:39.622 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, corrupting_rage
4:40.617 st S moonfire Fluffy_Pillow 66.0/100: 66% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, corrupting_rage
4:41.612 st X starsurge Fluffy_Pillow 74.0/100: 74% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, corrupting_rage
4:42.607 st R sunfire Fluffy_Pillow 48.0/100: 48% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, corrupting_rage
4:43.601 st P starfire Fluffy_Pillow 56.0/100: 56% astral_power natures_vigil, denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip_static, corrupting_rage
4:44.358 st P starfire Fluffy_Pillow 72.8/100: 73% astral_power natures_vigil, denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(2), best_friends_with_pip_static, corrupting_rage
4:45.113 st Q starsurge Fluffy_Pillow 95.6/100: 96% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, corrupting_rage
4:46.107 st Y wrath Fluffy_Pillow 61.6/100: 62% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, corrupting_rage
4:47.100 st X starsurge Fluffy_Pillow 79.6/100: 80% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, corrupting_rage
4:48.095 st Y wrath Fluffy_Pillow 47.6/100: 48% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, corrupting_rage
4:49.089 st Y wrath Fluffy_Pillow 63.6/100: 64% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, corrupting_rage
4:50.084 st Q starsurge Fluffy_Pillow 83.6/100: 84% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), solstice, best_friends_with_pip_static, corrupting_rage
4:51.306 st Q starsurge Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord, best_friends_with_pip_static, corrupting_rage
4:52.483 st Y wrath Fluffy_Pillow 15.6/100: 16% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(2), best_friends_with_pip_static, corrupting_rage
4:53.617 st Y wrath Fluffy_Pillow 31.6/100: 32% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(2), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, corrupting_rage
4:54.752 st Q starsurge Fluffy_Pillow 49.6/100: 50% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(2), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage
4:55.885 st Y wrath Fluffy_Pillow 13.6/100: 14% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage
4:56.978 st Y wrath Fluffy_Pillow 31.6/100: 32% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
4:57.988 st P starfire Fluffy_Pillow 49.6/100: 50% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
4:59.502 st P starfire Fluffy_Pillow 65.6/100: 66% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), starlord(3), dreamstate, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
5:00.330 st Q starsurge Fluffy_Pillow 79.6/100: 80% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(3), dreamstate, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
5:01.250 st R sunfire Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), dreamstate, best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
5:02.170 st X starsurge Fluffy_Pillow 83.6/100: 84% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), dreamstate, best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
5:03.091 st S moonfire Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), dreamstate, best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
5:04.011 st Y wrath Fluffy_Pillow 59.6/100: 60% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
5:04.766 st W cancel_buff Fluffy_Pillow 79.6/100: 80% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
5:04.766 st Q starsurge Fluffy_Pillow 79.6/100: 80% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
5:05.796 st Q starsurge Fluffy_Pillow 45.6/100: 46% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
5:06.885 st Y wrath Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
5:07.935 st Y wrath Fluffy_Pillow 29.6/100: 30% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
5:08.986 st Q starsurge Fluffy_Pillow 47.6/100: 48% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
5:10.035 st O warrior_of_elune Fluffy_Pillow 13.6/100: 14% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
5:10.035 st Y wrath Fluffy_Pillow 13.6/100: 14% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
5:11.047 st Y wrath Fluffy_Pillow 29.6/100: 30% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
5:12.057 st Y wrath Fluffy_Pillow 47.6/100: 48% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage
5:13.152 st X starsurge Fluffy_Pillow 63.6/100: 64% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage
5:14.246 default E use_items Fluffy_Pillow 31.6/100: 32% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage
5:14.246 st Q starsurge Fluffy_Pillow 31.6/100: 32% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(100)
5:15.241 st U half_moon Fluffy_Pillow 7.6/100: 8% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(100)
5:16.565 st V full_moon Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(90)
5:18.551 st W cancel_buff Fluffy_Pillow 91.6/100: 92% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(80)
5:18.551 st Q starsurge Fluffy_Pillow 91.6/100: 92% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(80)
5:19.664 st Q starsurge Fluffy_Pillow 65.6/100: 66% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord, warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(75)
5:20.735 st Q starsurge Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(2), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(70)
5:21.767 st R sunfire Fluffy_Pillow 11.6/100: 12% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(65)
5:22.762 st Y wrath Fluffy_Pillow 17.6/100: 18% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(60)
5:23.756 st Y wrath Fluffy_Pillow 35.6/100: 36% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage, kindled_soul(55)
5:24.751 st S moonfire Fluffy_Pillow 55.6/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage, kindled_soul(50)
5:25.746 st P starfire Fluffy_Pillow 61.6/100: 62% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage, kindled_soul(45)
5:26.500 st P starfire Fluffy_Pillow 78.4/100: 78% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(2), best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage, kindled_soul(40)
5:27.255 default D potion Fluffy_Pillow 97.2/100: 97% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage, kindled_soul(35)
5:27.255 st Q starsurge Fluffy_Pillow 97.2/100: 97% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
5:28.249 st Q starsurge Fluffy_Pillow 63.2/100: 63% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
5:29.242 st Y wrath Fluffy_Pillow 29.2/100: 29% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
5:30.236 st Y wrath Fluffy_Pillow 47.2/100: 47% astral_power balance_of_all_things_nature(5), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
5:31.231 st Y wrath Fluffy_Pillow 65.2/100: 65% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
5:32.323 st W cancel_buff Fluffy_Pillow 83.2/100: 83% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
5:32.323 st Q starsurge Fluffy_Pillow 83.2/100: 83% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), solstice, warrior_of_elune, best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
5:33.547 st Q starsurge Fluffy_Pillow 51.2/100: 51% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord, warrior_of_elune, best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
5:34.722 st Y wrath Fluffy_Pillow 17.2/100: 17% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:35.855 st Y wrath Fluffy_Pillow 35.2/100: 35% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(2), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:36.989 st Q starsurge Fluffy_Pillow 55.2/100: 55% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(2), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:38.123 st R sunfire Fluffy_Pillow 19.2/100: 19% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:39.218 st Y wrath Fluffy_Pillow 27.2/100: 27% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:40.312 st P starfire Fluffy_Pillow 43.2/100: 43% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:41.950 st P starfire Fluffy_Pillow 55.2/100: 55% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), starlord(3), dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:42.777 st Q starsurge Fluffy_Pillow 69.2/100: 69% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(3), dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:43.699 st Y wrath Fluffy_Pillow 35.2/100: 35% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:44.452 st X starsurge Fluffy_Pillow 55.2/100: 55% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:45.372 st Y wrath Fluffy_Pillow 21.2/100: 21% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:46.292 st Y wrath Fluffy_Pillow 69.2/100: 69% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:47.211 st S moonfire Fluffy_Pillow 85.2/100: 85% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:48.131 st Q starsurge Fluffy_Pillow 95.2/100: 95% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), solstice, best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:49.265 st Q starsurge Fluffy_Pillow 61.2/100: 61% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord, best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:50.355 st T new_moon Fluffy_Pillow 27.2/100: 27% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:51.109 st Q starsurge Fluffy_Pillow 41.2/100: 41% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:52.158 st U half_moon Fluffy_Pillow 7.2/100: 7% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:53.505 st Y wrath Fluffy_Pillow 31.2/100: 31% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:54.518 st X starsurge Fluffy_Pillow 51.2/100: 51% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:55.530 st R sunfire Fluffy_Pillow 19.2/100: 19% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:56.453 st Y wrath Fluffy_Pillow 25.2/100: 25% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (tauren) Raid-Buffed Unbuffed Gear Amount
Strength 898 2 986 900 0
Agility 2089 -2 2173 2087 0
Stamina 3848 2 35600 33905 29988
Intellect 2089 -2 13499 12687 9996 (6121)
Spirit 0 0 0 0 0
Health 712000 712000 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13499 12687 0
Crit 27.17% 20.96% 2873
Haste 22.98% 22.98% 3906
Versatility 6.13% 1.13% 232
Mana Regen 2560 2560 0
Attack Power 14039 13194 0
Mastery 28.99% 28.99% 7497
Armor 4506 4506 4506
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 467.00
Local Head Benevolent Embersage's Casque
ilevel: 470, stats: { 585 Armor, +3163 Sta, +655 Crit, +307 Haste, +786 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }, enchant: incandescent_essence
Local Neck Eye of the Rising Flame
ilevel: 470, stats: { +1779 Sta, +233 Haste, +1397 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Life-Bound Shoulderpads
ilevel: 447, stats: { 456 Armor, +1796 Sta, +328 Mastery, +328 Haste, +476 AgiInt }
item effects: { equip: Toxified }
Local Chest Benevolent Embersage's Robe
ilevel: 470, stats: { 780 Armor, +3163 Sta, +665 Crit, +296 Mastery, +786 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 470, stats: { 439 Armor, +2372 Sta, +497 Haste, +224 Mastery, +590 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 470, stats: { 683 Armor, +3163 Sta, +656 Haste, +305 Mastery, +786 AgiInt }, enchant: { +155 StrAgiInt, +41 Vers (lambent_armor_kit_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 470, stats: { 488 Armor, +2372 Sta, +257 Crit, +412 Haste, +590 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Thermal Bindings
ilevel: 470, stats: { 390 Armor, +1779 Sta, +178 Crit, +363 Mastery, +442 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Benevolent Embersage's Talons
ilevel: 447, stats: { 373 Armor, +1796 Sta, +191 Vers, +464 Mastery, +476 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 470, stats: { +1779 Sta, +466 Haste, +1165 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 470, stats: { +1779 Sta, +1118 Crit, +512 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 470, stats: { +747 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 470, stats: { +687 Mastery }
item effects: { use: Balefire Branch }
Local Back Drape of the Loyal Vassal
ilevel: 470, stats: { 312 Armor, +1779 Sta, +305 Haste, +236 Mastery, +442 StrAgiInt }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 470, weapon: { 508 - 654, 2.6 }, stats: { +393 Int, +1896 Int, +1581 Sta, +145 Haste, +335 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 470, stats: { +1206 Int, +1581 Sta, +162 Haste, +319 Mastery }

Talents

RowDruid Talents [31]
1
2
3
4
5
6
7
8
9
10
RowBalance Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

druid="447+470 2p+2p"
source=default
spec=balance
level=70
race=tauren
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:hissing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Balance APL can be found at https://balance-simc.github.io/Balance-SimC/balance.txt

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=470,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=470,gem_id=192961/192961/192961
shoulders=lifebound_shoulderpads,id=193406,bonus_id=8836/1576/8797/8960,ilevel=447,crafted_stats=49/36
back=drape_of_the_loyal_vassal,id=158375,bonus_id=4795,ilevel=470
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=470,enchant_id=6625
wrists=thermal_bindings,id=134461,bonus_id=4795,ilevel=470,gem_id=192961
hands=benevolent_embersages_talons,id=207255,bonus_id=4795,ilevel=447
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=470,enchant_id=6830
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=470
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=470
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=470
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=470,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=470

# Gear Summary
# gear_ilvl=467.13
# gear_stamina=29988
# gear_intellect=9996
# gear_crit_rating=2873
# gear_haste_rating=3906
# gear_mastery_rating=7497
# gear_versatility_rating=232
# gear_armor=4506
# set_bonus=tier30_2pc=1
# set_bonus=tier31_2pc=1

460 T31 2p : 183894 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
183893.7 183893.7 183.2 / 0.100% 26586.9 / 14.5% 14756.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.1 12.1 Astral Power 0.00% 66.4 99.9% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
460 T31 2p 183894
Astral Smolder 12111 6.6% 63.6 4.62s 57096 0 Periodic 116.1 31259 0 31259 0.0% 77.3%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 63.56 0.00 116.09 116.09 47.81 0.0000 2.0000 3629130.41 3629130.41 0.00% 15630.07 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 116.09 75 155 31259.41 8061 106703 31262.91 23924 39852 3629130 3629130 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Denizen of the Dream 0 (5352) 0.0% (2.9%) 8.5 31.50s 188275 0

Stats Details: Denizen Of The Dream

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.52 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Denizen Of The Dream

  • id:394065
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394065
  • name:Denizen of the Dream
  • school:physical
  • tooltip:
  • description:Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.
    Fey Missile 16277  / 5352 2.9% 149.1 1.72s 10755 8264 Direct 148.2 8376 17404 10823 27.1%

Stats Details: Fey Missile

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 149.12 148.20 0.00 0.00 0.00 1.3014 0.0000 1603831.09 1603831.09 0.00% 8264.27 8264.27
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.90% 108.04 22 257 8375.87 6306 14521 8369.37 7488 9673 904888 904888 0.00%
crit 27.10% 40.16 5 100 17404.05 13116 30205 17392.35 15133 20560 698943 698943 0.00%

Action Details: Fey Missile

  • id:188046
  • school:astral
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.529
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.236000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:188046
  • name:Fey Missile
  • school:astral
  • tooltip:
  • description:{$@spelldesc187875=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$188083d=30 seconds}.}

Action Priority List

    default
    [ ]:4822.03
Hungering Shadowflame 2926 1.6% 17.1 16.82s 51247 0 Direct 17.1 40071 81223 51236 27.1%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.15 17.15 0.00 0.00 0.00 0.0000 0.0000 878673.35 878673.35 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.86% 12.49 3 27 40071.21 26983 154715 39937.55 26983 98937 500719 500719 0.00%
crit 27.14% 4.65 0 14 81222.87 55045 315618 79585.77 0 315618 377954 377954 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24191.79
  • base_dd_max:24191.79
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 5579 3.0% 33.8 8.67s 49462 0 Direct 33.7 38634 78747 49597 27.3%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.84 33.75 0.00 0.00 0.00 0.0000 0.0000 1673694.06 1673694.06 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.67% 24.53 9 44 38633.70 38195 43801 38632.50 38195 40228 947502 947502 0.00%
crit 27.33% 9.22 1 23 78747.12 77919 89355 78755.08 77919 83827 726192 726192 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:34245.43
  • base_dd_max:34245.43
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 10215 5.6% 14.3 21.62s 213441 218924 Direct 14.3 7569 15673 10329 34.1%
Periodic 307.8 6824 14409 9463 34.8% 99.4%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.34 14.34 307.80 307.80 13.34 0.9750 0.9701 3060989.46 3060989.46 0.00% 9792.60 218923.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 65.93% 9.46 3 16 7569.04 5112 13622 7563.49 6600 9304 71571 71571 0.00%
crit 34.07% 4.89 0 12 15672.71 11992 27790 15617.22 0 22957 76577 76577 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 65.21% 200.72 141 263 6824.27 1420 12440 6826.20 6504 7320 1369772 1369772 0.00%
crit 34.79% 107.08 65 154 14409.17 2684 25378 14416.13 13599 15532 1543070 1543070 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    st
    [K]:1.29
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [S]:13.04
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
New Moon (Talent) 0 (16978) 0.0% (9.2%) 17.0 17.98s 300134 250019

Stats Details: Moons Talent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.96 0.00 0.00 0.00 0.00 1.2005 0.0000 0.00 0.00 0.00% 250019.02 250019.02

Action Details: Moons Talent

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
    Full Moon 6142 3.4% 5.3 63.04s 349324 187543 Direct 5.3 238377 481640 351222 46.4%

Stats Details: Full Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.29 5.26 0.00 0.00 0.00 1.8627 0.0000 1847107.50 1847107.50 0.00% 187542.64 187542.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.61% 2.82 0 6 238377.31 163080 379468 232971.96 0 353783 672071 672071 0.00%
crit 46.39% 2.44 0 6 481640.48 318219 795555 461423.90 0 750835 1175036 1175036 0.00%

Action Details: Full Moon

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:50.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Action Priority List

    st
    [V]:5.35
  • if_expr:astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    New Moon 4626 2.5% 6.0 53.61s 230539 305550 Direct 6.0 149959 323374 232027 47.3%

Stats Details: New Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.01 5.97 0.00 0.00 0.00 0.7545 0.0000 1384448.24 1384448.24 0.00% 305550.26 305550.26
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.66% 3.14 0 7 149958.75 89571 232142 147537.03 0 207786 471192 471192 0.00%
crit 47.34% 2.82 0 7 323374.24 184475 473570 318963.24 0 458449 913256 913256 0.00%

Action Details: New Moon

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Action Priority List

    st
    [T]:6.02
  • if_expr:astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Half Moon 6209 3.4% 5.7 58.08s 327984 266920 Direct 5.6 212157 431372 329813 53.6%

Stats Details: Half Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.67 5.64 0.00 0.00 0.00 1.2288 0.0000 1858831.50 1858831.50 0.00% 266920.09 266920.09
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 46.36% 2.61 0 7 212156.67 119618 329536 205828.99 0 322480 554333 554333 0.00%
crit 53.64% 3.02 0 7 431371.67 277237 681604 425102.34 0 610327 1304498 1304498 0.00%

Action Details: Half Moon

  • id:274282
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:24.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.875000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274282
  • name:Half Moon
  • school:astral
  • tooltip:
  • description:Deals {$s1=0} Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates {$=}{{$m3=240}/10} Astral Power.|r

Action Priority List

    st
    [U]:5.70
  • if_expr:astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (15961) 0.0% (8.7%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 5960 3.2% 94.1 3.18s 18996 0 Direct 93.8 12811 27178 19047 43.4%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 94.07 93.82 0.00 0.00 0.00 0.0000 0.0000 1786989.83 1786989.83 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.60% 53.10 28 88 12810.57 8426 24514 12811.81 11639 14161 680264 680264 0.00%
crit 43.40% 40.72 18 68 27178.39 17190 50009 27182.47 24236 31218 1106726 1106726 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 5978 3.3% 94.5 3.20s 18969 0 Direct 94.2 12787 27143 19019 43.4%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 94.49 94.23 0.00 0.00 0.00 0.0000 0.0000 1792299.26 1792299.26 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.59% 53.33 25 85 12787.20 8394 24514 12789.11 11589 14172 681936 681936 0.00%
crit 43.41% 40.91 19 75 27142.82 17124 50009 27148.94 24712 30434 1110363 1110363 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 4023 2.2% 6.3 48.50s 192134 0 Direct 6.3 129172 274238 192645 43.8%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.28 6.26 0.00 0.00 0.00 0.0000 0.0000 1206350.20 1206350.20 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.21% 3.52 0 8 129172.43 84760 236983 128173.07 0 196966 454576 454576 0.00%
crit 43.79% 2.74 0 8 274238.33 172910 490144 266783.33 0 460426 751774 751774 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 4980 2.7% 26.1 11.49s 57362 63707 Direct 27.1 39023 79475 55244 40.1%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.09 27.09 0.00 0.00 0.00 0.9004 0.0000 1496344.76 1496344.76 0.00% 63706.78 63706.78
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.90% 16.23 6 27 39022.69 17442 72423 39040.43 30895 45062 633187 633187 0.00%
crit 40.10% 10.86 2 22 79475.20 35582 145146 79458.16 57210 93574 863157 863157 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    st
    [L]:1.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
    st
    [P]:25.16
  • if_expr:variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Warrior of Elune2024251-1.000Spell DataNo-stacks
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Starsurge 58310 (78758) 31.7% (42.8%) 114.8 2.60s 205452 206352 Direct 114.6 (152.1) 104556 220381 152412 41.3% (41.9%)

Stats Details: Starsurge

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 114.80 114.56 0.00 0.00 0.00 0.9956 0.0000 17461494.03 17461494.03 0.00% 206352.14 206352.14
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.68% 67.23 42 95 104556.46 66727 194869 104577.71 97028 113509 7029277 7029277 0.00%
crit 41.32% 47.33 27 72 220381.04 139448 397533 220512.40 202897 251365 10432217 10432217 0.00%

Action Details: Starsurge

  • id:78674
  • school:astral
  • range:45.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:36.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.455000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.18

Spelldata

  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$s1=0} Astral damage.

Action Priority List

    st
    [Q]:84.69
  • if_expr:variable.starsurge_condition1
    st
    [X]:30.11
  • if_expr:variable.starsurge_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Flat Cost Incarnation: Chosen of Elune1025603-8.000Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Goldrinn's Fang 20449 11.1% 37.7 7.92s 162278 0 Direct 37.6 110027 231358 163006 43.7%

Stats Details: Goldrinns Fang

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.74 37.57 0.00 0.00 0.00 0.0000 0.0000 6124142.45 6124142.45 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.33% 21.16 7 40 110027.20 80548 203766 110073.34 97689 133342 2328448 2328448 0.00%
crit 43.67% 16.41 4 32 231357.74 164317 415683 231443.76 194901 278516 3795695 3795695 0.00%

Action Details: Goldrinns Fang

  • id:394047
  • school:astral
  • range:60.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.852000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10

Spelldata

  • id:394047
  • name:Goldrinn's Fang
  • school:astral
  • tooltip:Deals {$m1=0} Arcane damage.
  • description:Deals {$m1=0} Arcane damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountPower of Goldrinn3940462PCT1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Friend of the Fae39408310.100Spell Data
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Incarnation: Chosen of Elune10256020.100Spell Data
Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Dot / Debuff on Target Moonfire16481250.283Mastery
Sunfire16481550.283Mastery
Waning Twilight39395710.100
Sunfire 10065 5.5% 17.4 18.05s 173479 177426 Direct 17.4 7426 15299 10431 38.2%
Periodic 308.8 6583 13597 9186 37.1% 99.7%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.40 17.40 308.76 308.76 16.39 0.9778 0.9701 3017835.84 3017835.84 0.00% 9533.58 177425.82
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.81% 10.75 3 19 7425.70 4647 12583 7419.41 6435 8702 79859 79859 0.00%
crit 38.19% 6.64 0 16 15298.87 9480 26518 15284.70 0 20124 101629 101629 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 62.89% 194.19 139 258 6583.29 168 11309 6582.22 6259 7005 1278425 1278425 0.00%
crit 37.11% 114.57 71 165 13597.47 3409 23071 13598.21 12819 14461 1557922 1557922 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    st
    [J]:1.59
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [R]:15.81
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (3112) 0.0% (1.7%) 8.5 32.31s 110014 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.48 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 1620 0.9% 8.5 32.31s 57251 0 Direct 8.5 44622 90973 57256 27.2%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.48 8.48 0.00 0.00 0.00 0.0000 0.0000 485636.55 485636.55 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.76% 6.17 0 16 44622.46 44081 50551 44551.43 0 49204 275390 275390 0.00%
crit 27.24% 2.31 0 11 90972.67 89925 103124 82875.94 0 103124 210246 210246 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:39522.22
  • base_dd_max:39522.22
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 1493 0.8% 16.4 15.59s 27219 0 Direct 16.4 21223 43259 27221 27.2%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.44 16.44 0.00 0.00 0.00 0.0000 0.0000 447573.88 447573.88 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.79% 11.97 1 29 21222.80 20975 24054 21225.41 20975 22977 254014 254014 0.00%
crit 27.21% 4.47 0 14 43258.74 42790 49070 42714.37 0 49070 193560 193560 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18805.57
  • base_dd_max:18805.57
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 17856 9.7% 115.0 2.55s 46548 48858 Direct 114.6 31051 65099 46716 46.0%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 114.98 114.57 0.00 0.00 0.00 0.9527 0.0000 5352102.34 5352102.34 0.00% 48858.01 48858.01
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.00% 61.86 36 90 31050.51 12885 97852 31053.32 27732 34933 1920946 1920946 0.00%
crit 46.00% 52.71 29 81 65099.47 26286 207108 65106.02 57138 74768 3431157 3431157 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    st
    [M]:0.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
    st
    [Y]:113.29

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.400Spell Data
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
460 T31 2p
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31 2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31 2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31 2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 182.78s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    st
    [N]:2.00
  • if_expr:variable.cd_condition_st

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.6 66.03s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.63 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31 2p
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:57075.72
  • base_dd_max:57075.72
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.33s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.75 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31 2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.75
Elemental Potion of Ultimate Power 1.5 305.76s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.47
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
Warrior of Elune 6.1 48.18s

Stats Details: Warrior Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.15 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Warrior Of Elune

  • id:202425
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202425
  • name:Warrior of Elune
  • school:arcane
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.

Action Priority List

    st
    [O]:6.14
  • if_expr:variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 8.7 1.5 36.3s 33.9s 8.6s 24.89% 28.77% 1.5 (7.0) 8.5

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.5s
  • trigger_min/max:3.7s / 50.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:22.20% / 27.80%

Stack Uptimes

  • balance_of_all_things_arcane_1:2.86%
  • balance_of_all_things_arcane_2:2.93%
  • balance_of_all_things_arcane_3:2.99%
  • balance_of_all_things_arcane_4:3.02%
  • balance_of_all_things_arcane_5:3.03%
  • balance_of_all_things_arcane_6:3.28%
  • balance_of_all_things_arcane_7:3.39%
  • balance_of_all_things_arcane_8:3.39%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 18.0 3.5 17.1s 14.1s 8.4s 50.41% 54.50% 3.5 (20.4) 17.4

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 50.8s
  • trigger_min/max:0.0s / 40.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.5s
  • uptime_min/max:46.17% / 53.63%

Stack Uptimes

  • balance_of_all_things_nature_1:5.83%
  • balance_of_all_things_nature_2:5.93%
  • balance_of_all_things_nature_3:6.05%
  • balance_of_all_things_nature_4:6.17%
  • balance_of_all_things_nature_5:6.33%
  • balance_of_all_things_nature_6:6.50%
  • balance_of_all_things_nature_7:6.68%
  • balance_of_all_things_nature_8:6.92%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Best Friends with Aerwynn 2.8 0.0 70.7s 70.7s 10.8s 9.90% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 340.5s
  • trigger_min/max:12.0s / 340.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 34.80%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.89%
  • best_friends_with_aerwynn_2:0.89%
  • best_friends_with_aerwynn_3:0.89%
  • best_friends_with_aerwynn_4:0.89%
  • best_friends_with_aerwynn_5:0.90%
  • best_friends_with_aerwynn_6:0.90%
  • best_friends_with_aerwynn_7:0.90%
  • best_friends_with_aerwynn_8:0.91%
  • best_friends_with_aerwynn_9:0.91%
  • best_friends_with_aerwynn_10:0.91%
  • best_friends_with_aerwynn_11:0.92%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 115.6s 70.7s 46.0s 33.13% 0.00% 69.2 (69.2) 0.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 344.8s
  • trigger_min/max:12.0s / 340.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 315.5s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.13%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.4s 70.4s 10.8s 10.04% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 327.4s
  • trigger_min/max:12.0s / 327.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 32.39%

Stack Uptimes

  • best_friends_with_pip_1:0.90%
  • best_friends_with_pip_2:0.90%
  • best_friends_with_pip_3:0.90%
  • best_friends_with_pip_4:0.91%
  • best_friends_with_pip_5:0.91%
  • best_friends_with_pip_6:0.91%
  • best_friends_with_pip_7:0.92%
  • best_friends_with_pip_8:0.92%
  • best_friends_with_pip_9:0.92%
  • best_friends_with_pip_10:0.92%
  • best_friends_with_pip_11:0.93%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 115.1s 70.4s 46.2s 33.48% 0.00% 69.0 (69.0) 0.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 344.8s
  • trigger_min/max:12.0s / 327.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 288.0s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.48%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 70.2s 70.2s 10.8s 10.08% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 333.9s
  • trigger_min/max:12.0s / 333.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 33.18%

Stack Uptimes

  • best_friends_with_urctos_1:0.90%
  • best_friends_with_urctos_2:0.90%
  • best_friends_with_urctos_3:0.91%
  • best_friends_with_urctos_4:0.91%
  • best_friends_with_urctos_5:0.91%
  • best_friends_with_urctos_6:0.92%
  • best_friends_with_urctos_7:0.92%
  • best_friends_with_urctos_8:0.92%
  • best_friends_with_urctos_9:0.93%
  • best_friends_with_urctos_10:0.93%
  • best_friends_with_urctos_11:0.93%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 114.8s 70.2s 45.6s 33.39% 0.00% 69.2 (69.2) 0.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:13.0s / 346.8s
  • trigger_min/max:12.0s / 333.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 305.5s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.39%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.51% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.51%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 62.0s 58.1s 50.1s 80.17% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 322.0s
  • trigger_min/max:15.0s / 322.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 359.8s
  • uptime_min/max:43.42% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.17%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Denizen of the Dream 8.5 0.0 45.1s 32.0s 41.1s 57.23% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_denizen_of_the_dream
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 248.0s
  • trigger_min/max:0.0s / 139.7s
  • trigger_pct:99.98%
  • duration_min/max:0.0s / 242.3s
  • uptime_min/max:22.02% / 95.04%

Stack Uptimes

  • denizen_of_the_dream_1:38.66%
  • denizen_of_the_dream_2:14.19%
  • denizen_of_the_dream_3:3.64%
  • denizen_of_the_dream_4:0.66%
  • denizen_of_the_dream_5:0.11%
  • denizen_of_the_dream_6:0.03%
  • denizen_of_the_dream_7:0.03%

Spelldata

  • id:394076
  • name:Denizen of the Dream
  • tooltip:
  • description:{$@spelldesc394065=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Dreamstate 15.5 0.4 20.0s 20.7s 3.1s 16.02% 21.39% 0.4 (0.7) 0.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 56.6s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.2s
  • uptime_min/max:9.50% / 25.94%

Stack Uptimes

  • dreamstate_1:9.63%
  • dreamstate_2:6.40%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 7.1 1.0 45.4s 45.0s 20.6s 49.21% 52.46% 1.0 (1.0) 6.8

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.0s
  • trigger_min/max:12.0s / 90.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:44.10% / 56.14%

Stack Uptimes

  • eclipse_lunar_1:49.21%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 13.8 5.7 22.4s 15.7s 20.2s 92.63% 95.97% 5.7 (5.7) 12.9

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 70.1s
  • trigger_min/max:0.0s / 55.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 68.9s
  • uptime_min/max:90.57% / 94.80%

Stack Uptimes

  • eclipse_solar_1:92.63%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 306.8s 306.8s 27.4s 13.21% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.0s
  • trigger_min/max:300.0s / 328.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.87% / 18.03%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.21%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Friend of the Fae 5.2 3.3 55.4s 32.0s 24.8s 43.35% 43.29% 3.3 (3.3) 4.8

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_friend_of_the_fae
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 160.7s
  • trigger_min/max:0.0s / 139.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 126.8s
  • uptime_min/max:14.68% / 82.59%

Stack Uptimes

  • friend_of_the_fae_1:43.35%

Spelldata

  • id:394083
  • name:Friend of the Fae
  • tooltip:Arcane and Nature damage increased by {$=}w1%.
  • description:{$@spelldesc394081=When a Faerie Dragon is summoned, your spells deal {$394083m1=10}% increased damage for {$394083d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 7.1 0.0 45.0s 45.0s 20.3s 48.29% 51.19% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.0s
  • trigger_min/max:12.0s / 90.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:43.34% / 55.00%

Stack Uptimes

  • incarnation_chosen_of_elune_1:48.29%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.6 0.0 99.9s 99.9s 19.5s 23.22% 0.00% 0.0 (0.0) 3.2

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:55.09

Trigger Details

  • interval_min/max:90.0s / 126.4s
  • trigger_min/max:90.0s / 126.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.28% / 26.19%

Stack Uptimes

  • kindled_soul_5:1.10%
  • kindled_soul_10:1.14%
  • kindled_soul_15:1.14%
  • kindled_soul_20:1.14%
  • kindled_soul_25:1.15%
  • kindled_soul_30:1.15%
  • kindled_soul_35:1.15%
  • kindled_soul_40:1.15%
  • kindled_soul_45:1.16%
  • kindled_soul_50:1.16%
  • kindled_soul_55:1.16%
  • kindled_soul_60:1.17%
  • kindled_soul_65:1.17%
  • kindled_soul_70:1.17%
  • kindled_soul_75:1.18%
  • kindled_soul_80:1.18%
  • kindled_soul_85:1.18%
  • kindled_soul_90:1.18%
  • kindled_soul_95:1.19%
  • kindled_soul_100:1.19%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Grace 12.9 0.0 20.6s 20.6s 5.9s 25.35% 0.00% 0.0 (0.0) 12.6

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.8s / 70.2s
  • trigger_min/max:12.8s / 70.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:19.81% / 29.98%

Stack Uptimes

  • natures_grace_1:25.35%

Spelldata

  • id:393959
  • name:Nature's Grace
  • tooltip:Haste increased by {$s1=10}%.
  • description:{$@spelldesc393958=After an Eclipse ends, you gain {$393959s1=10}% Haste for {$393959d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Vigil 3.7 0.0 90.3s 90.3s 14.8s 18.45% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 92.0s
  • trigger_min/max:90.0s / 92.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.54% / 21.04%

Stack Uptimes

  • natures_vigil_1:18.45%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.1 75.1s 69.5s 7.7s 6.29% 6.97% 0.1 (0.1) 1.3

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.3s / 319.4s
  • trigger_min/max:0.0s / 319.4s
  • trigger_pct:15.09%
  • duration_min/max:0.0s / 28.4s
  • uptime_min/max:0.00% / 26.36%

Stack Uptimes

  • owlkin_frenzy_1:6.29%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 8.1 107.7 39.0s 39.0s 34.8s 93.89% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:24.4s / 51.2s
  • trigger_min/max:24.4s / 51.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 48.7s
  • uptime_min/max:90.61% / 96.60%

Stack Uptimes

  • primordial_arcanic_pulsar_4:4.99%
  • primordial_arcanic_pulsar_8:5.57%
  • primordial_arcanic_pulsar_12:6.55%
  • primordial_arcanic_pulsar_16:6.95%
  • primordial_arcanic_pulsar_20:6.38%
  • primordial_arcanic_pulsar_24:6.09%
  • primordial_arcanic_pulsar_28:8.01%
  • primordial_arcanic_pulsar_32:7.92%
  • primordial_arcanic_pulsar_36:6.62%
  • primordial_arcanic_pulsar_40:7.10%
  • primordial_arcanic_pulsar_44:6.96%
  • primordial_arcanic_pulsar_48:7.09%
  • primordial_arcanic_pulsar_52:7.17%
  • primordial_arcanic_pulsar_56:6.50%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 18.5 4.1 16.8s 14.1s 6.4s 39.57% 39.79% 4.1 (4.1) 18.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 49.1s
  • trigger_min/max:0.0s / 40.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.9s
  • uptime_min/max:36.44% / 42.09%

Stack Uptimes

  • solstice_1:39.57%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 20.8 94.0 14.7s 2.6s 14.1s 97.26% 0.00% 52.9 (52.9) 7.5

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 20.8s
  • trigger_min/max:0.8s / 10.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:93.52% / 99.07%

Stack Uptimes

  • starlord_1:9.55%
  • starlord_2:15.51%
  • starlord_3:72.20%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Wafting Devotion 4.3 1.2 61.1s 45.4s 16.5s 23.61% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 210.7s
  • trigger_min/max:0.0s / 203.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 78.6s
  • uptime_min/max:5.14% / 56.62%

Stack Uptimes

  • wafting_devotion_1:23.61%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Warrior of Elune 6.1 0.0 48.3s 48.3s 22.0s 44.96% 44.00% 0.0 (0.0) 2.4

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_warrior_of_elune
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:45.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 81.7s
  • trigger_min/max:45.0s / 81.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s
  • uptime_min/max:34.29% / 51.47%

Stack Uptimes

  • warrior_of_elune_1:22.03%
  • warrior_of_elune_2:4.86%
  • warrior_of_elune_3:18.08%

Spelldata

  • id:202425
  • name:Warrior of Elune
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.
  • max_stacks:0
  • duration:25.00
  • cooldown:45.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Denizen of the Dream 8.5 2.0 21.0 32.0s 0.0s 139.7s
Primordial Arcanic Pulsar 7.1 6.0 9.0 40.7s 29.5s 50.6s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.08% 0.00% 1.42% 0.5s 0.0s 3.4s
Astral Smolder 77.59% 59.91% 95.84% 14.8s 0.0s 102.0s
Incarnation (Total) 48.29% 43.34% 55.00% 20.3s 0.0s 54.0s
Incarnation (Pulsar) 28.03% 25.99% 30.22% 11.8s 0.0s 12.0s
Lunar Eclipse Only 0.92% 0.73% 1.14% 2.7s 2.6s 2.7s
Solar Eclipse Only 44.35% 36.16% 50.30% 10.8s 0.0s 15.0s
No Eclipse 6.42% 4.13% 8.42% 1.5s 0.0s 3.6s
Friend of the Fae 43.35% 14.68% 82.59% 24.8s 0.0s 126.8s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Warrior of Elune7.0480.00036.71743.40726.47069.063
Full Moon
New Moon
Half Moon		0.3510.00019.7335.9635.36925.109

Eclipse Utilization

NoneSolarLunarBoth
Wrath5.094.5%56.1449.7%0.000.0%51.7645.8%
Starfire25.0892.6%0.000.0%2.007.4%0.000.0%
Starsurge0.000.0%46.3040.3%0.000.0%68.5059.7%
New Moon0.040.7%0.172.8%0.000.0%5.8096.6%
Half Moon0.000.0%0.315.5%0.000.0%5.3594.5%
Full Moon0.211.8%3.1927.5%0.080.7%8.0969.9%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
460 T31 2p
Nature's BalanceAstral Power99.52198.925.49%2.000.110.06%
Full MoonAstral Power5.29264.027.29%49.950.280.10%
Half MoonAstral Power5.67136.073.76%24.000.000.00%
MoonfireAstral Power14.3485.952.37%5.990.080.09%
New MoonAstral Power6.0172.061.99%12.000.000.00%
Orbit BreakerAstral Power6.28187.275.17%29.821.100.58%
Shooting Stars (Moonfire)Astral Power94.06187.925.19%2.000.210.11%
Shooting Stars (Sunfire)Astral Power94.49188.775.21%2.000.210.11%
StarfireAstral Power27.08397.4810.98%14.682.850.71%
SunfireAstral Power17.39104.352.88%6.000.010.01%
WrathAstral Power114.991797.2649.65%15.630.000.00%
Usage Type Count Total Tot% Avg RPE APR
460 T31 2p
StarsurgeAstral Power 115.523648.36100.00%31.5831.786464.72
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 721120.0 3271.30 3866.47 1363575.4 542536.2 -386588.5 721120.0
Astral Power 70.0 12.06 12.08 4.9 24.4 0.0 100.0

Statistics & Data Analysis

Fight Length
460 T31 2p Fight Length
Count 5124
Mean 300.05
Minimum 240.02
Maximum 359.93
Spread ( max - min ) 119.91
Range [ ( max - min ) / 2 * 100% ] 19.98%
Standard Deviation 34.4024
5th Percentile 245.95
95th Percentile 353.68
( 95th Percentile - 5th Percentile ) 107.72
Mean Distribution
Standard Deviation 0.4806
95.00% Confidence Interval ( 299.11 - 301.00 )
Normalized 95.00% Confidence Interval ( 99.69% - 100.31% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 505
0.1% Error 50499
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1011
DPS
460 T31 2p Damage Per Second
Count 5124
Mean 183893.67
Minimum 163171.60
Maximum 212220.83
Spread ( max - min ) 49049.23
Range [ ( max - min ) / 2 * 100% ] 13.34%
Standard Deviation 6689.4201
5th Percentile 173350.37
95th Percentile 195332.49
( 95th Percentile - 5th Percentile ) 21982.12
Mean Distribution
Standard Deviation 93.4510
95.00% Confidence Interval ( 183710.51 - 184076.83 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5084
0.1 Scale Factor Error with Delta=300 381998
0.05 Scale Factor Error with Delta=300 1527991
0.01 Scale Factor Error with Delta=300 38199758
Priority Target DPS
460 T31 2p Priority Target Damage Per Second
Count 5124
Mean 183893.67
Minimum 163171.60
Maximum 212220.83
Spread ( max - min ) 49049.23
Range [ ( max - min ) / 2 * 100% ] 13.34%
Standard Deviation 6689.4201
5th Percentile 173350.37
95th Percentile 195332.49
( 95th Percentile - 5th Percentile ) 21982.12
Mean Distribution
Standard Deviation 93.4510
95.00% Confidence Interval ( 183710.51 - 184076.83 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5084
0.1 Scale Factor Error with Delta=300 381998
0.05 Scale Factor Error with Delta=300 1527991
0.01 Scale Factor Error with Delta=300 38199758
DPS(e)
460 T31 2p Damage Per Second (Effective)
Count 5124
Mean 183893.67
Minimum 163171.60
Maximum 212220.83
Spread ( max - min ) 49049.23
Range [ ( max - min ) / 2 * 100% ] 13.34%
Damage
460 T31 2p Damage
Count 5124
Mean 53503643.69
Minimum 40257756.53
Maximum 68567476.92
Spread ( max - min ) 28309720.39
Range [ ( max - min ) / 2 * 100% ] 26.46%
DTPS
460 T31 2p Damage Taken Per Second
Count 5124
Mean 3870.37
Minimum 916.21
Maximum 8348.49
Spread ( max - min ) 7432.28
Range [ ( max - min ) / 2 * 100% ] 96.02%
HPS
460 T31 2p Healing Per Second
Count 5124
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
460 T31 2p Healing Per Second (Effective)
Count 5124
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
460 T31 2p Heal
Count 5124
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
460 T31 2p Healing Taken Per Second
Count 5124
Mean 3264.83
Minimum 720.73
Maximum 6072.95
Spread ( max - min ) 5352.22
Range [ ( max - min ) / 2 * 100% ] 81.97%
TMI
460 T31 2p Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
460 T31 2pTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
460 T31 2p Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.47 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.58 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.75 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.st
# count action,conditions
J 1.59 sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
K 1.29 moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
0.00 starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
0.00 starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
L 1.00 starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
M 0.00 wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
0.00 celestial_alignment,if=variable.cd_condition_st
N 2.00 incarnation,if=variable.cd_condition_st
0.00 variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
0.00 variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
O 6.14 warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
P 25.16 starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
0.00 wrath,if=variable.enter_eclipse
0.00 variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
0.00 convoke_the_spirits,if=variable.convoke_condition
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+55
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 starfall,if=buff.starweavers_warp.up
0.00 variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
Q 84.69 starsurge,if=variable.starsurge_condition1
R 15.81 sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
S 13.04 moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
T 6.02 new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
U 5.70 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
V 5.35 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
W 12.33 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
X 30.11 starsurge,if=variable.starsurge_condition2
Y 113.29 wrath
Z 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFJKLNDEQQQTQUQVYXYYRXYXYSWQQYQYXYYYXYOXTYXYXYRWQQQYYYYXYSXYYXXYPPWQQRYYQYYYYXYPPQQSYQRUQQOQVYWQQYPPQQYSYQRYYYWQFQYYPPQQYYQYYRYQQESTQUQQYYYOXYPPWQQRYQYSYYYXXYYPPQQRYYQYYYYXYSWQPPQQVQQRQOTYXWYQPPQYQSYQYRYYYWQFQYNQUQVQQYYYYWQQQJEKYYYXYYXYTWQQQYRYXYSXYOYXYYQQQPPQUQRYQYYYYWQQPPQKQYYQRYYYYQQYPPQSQYYQYYROWQQYQFVQQTYQYYWQSPPQRQYEUYYXXWYQY

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask 460 T31 2p 50.0/100: 50% astral_power
Pre precombat 1 food 460 T31 2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 2 augmentation 460 T31 2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 4 no_cd_talent 460 T31 2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 5 on_use_trinket 460 T31 2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 6 on_use_trinket 460 T31 2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 7 on_use_trinket 460 T31 2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 60.0/100: 60% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil 460 T31 2p 50.0/100: 50% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.000 st J sunfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.941 st K moonfire Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:01.884 st L starfire Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, corrupting_rage
0:02.731 st N incarnation_chosen_of_elune Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, corrupting_rage
0:02.731 default D potion Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), corrupting_rage
0:02.731 default E use_items Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power
0:02.731 st Q starsurge Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:03.587 st Q starsurge Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:04.413 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), dreamstate(2), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:05.207 st T new_moon Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), dreamstate(2), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:05.960 st Q starsurge Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), dreamstate(2), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:06.725 st U half_moon Fluffy_Pillow 8.0/100: 8% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), dreamstate(2), best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:07.743 st Q starsurge Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), dreamstate(2), best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:08.509 st V full_moon Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), solstice, starlord(3), dreamstate(2), best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:10.036 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), dreamstate, best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:10.791 st X starsurge Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), dreamstate, best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:11.555 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:12.309 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:13.074 st R sunfire Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:13.826 st X starsurge Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:14.579 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:15.334 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:16.087 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:16.844 st S moonfire Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.599 st W cancel_buff Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.599 st Q starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:18.393 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord, best_friends_with_urctos(11), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:19.155 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), best_friends_with_urctos(10), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:19.910 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), best_friends_with_urctos(9), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:20.663 st Y wrath Fluffy_Pillow 14.0/100: 14% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos(8), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:21.417 st X starsurge Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos(8), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:22.173 st Y wrath Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_urctos(7), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:22.927 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_urctos(6), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:23.682 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_urctos(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:24.436 st X starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_urctos(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:25.188 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:25.943 st O warrior_of_elune Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_urctos(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:25.943 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_urctos(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:26.699 st T new_moon Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:27.451 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:28.205 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:28.973 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:29.738 st X starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:30.504 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:31.270 st R sunfire Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:32.037 st W cancel_buff Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:32.037 st Q starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, warrior_of_elune(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:32.894 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord, warrior_of_elune(3), best_friends_with_urctos_static, corrupting_rage
0:33.716 st Q starsurge Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(2), warrior_of_elune(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:34.472 st Y wrath Fluffy_Pillow 0.0/100: 0% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:35.224 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:35.981 st Y wrath Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:36.736 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:37.491 st X starsurge Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:38.245 st Y wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:38.999 st S moonfire Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:39.755 st X starsurge Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:40.510 st Y wrath Fluffy_Pillow 44.0/100: 44% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:41.430 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:42.350 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:43.269 st X starsurge Fluffy_Pillow 52.0/100: 52% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:44.189 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:45.109 st P starfire Fluffy_Pillow 38.0/100: 38% astral_power natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:45.863 st P starfire Fluffy_Pillow 54.8/100: 55% astral_power natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:46.619 st W cancel_buff Fluffy_Pillow 75.6/100: 76% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:46.619 st Q starsurge Fluffy_Pillow 75.6/100: 76% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(32), solstice, warrior_of_elune, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:47.648 st Q starsurge Fluffy_Pillow 39.6/100: 40% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord, warrior_of_elune, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:48.639 st R sunfire Fluffy_Pillow 7.6/100: 8% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
0:49.672 st Y wrath Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
0:50.703 st Y wrath Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
0:51.733 st Q starsurge Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(40), solstice, starlord(2), best_friends_with_urctos_static, corrupting_rage
0:52.866 st Y wrath Fluffy_Pillow 19.6/100: 20% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos_static, corrupting_rage
0:53.957 st Y wrath Fluffy_Pillow 35.6/100: 36% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos_static, corrupting_rage
0:55.049 st Y wrath Fluffy_Pillow 53.6/100: 54% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos_static, corrupting_rage
0:56.141 st Y wrath Fluffy_Pillow 69.6/100: 70% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos_static, corrupting_rage
0:57.233 st X starsurge Fluffy_Pillow 87.6/100: 88% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos_static, corrupting_rage
0:58.327 st Y wrath Fluffy_Pillow 51.6/100: 52% astral_power eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_urctos_static, corrupting_rage
0:59.421 st P starfire Fluffy_Pillow 67.6/100: 68% astral_power eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_urctos_static, corrupting_rage
1:01.055 st P starfire Fluffy_Pillow 83.6/100: 84% astral_power natures_grace, primordial_arcanic_pulsar(48), starlord(3), dreamstate, best_friends_with_urctos_static, corrupting_rage
1:01.950 st Q starsurge Fluffy_Pillow 95.6/100: 96% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, dreamstate, best_friends_with_urctos_static, corrupting_rage
1:03.064 st Q starsurge Fluffy_Pillow 61.6/100: 62% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord, dreamstate, best_friends_with_urctos_static, corrupting_rage
1:04.133 st S moonfire Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(2), dreamstate, best_friends_with_urctos_static, corrupting_rage
1:05.164 st Y wrath Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(2), best_friends_with_urctos_static, corrupting_rage
1:05.919 st Q starsurge Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(2), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage
1:06.950 st R sunfire Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage
1:07.944 st U half_moon Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage
1:09.267 st Q starsurge Fluffy_Pillow 89.6/100: 90% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, solstice, starlord(3), best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage
1:10.261 st Q starsurge Fluffy_Pillow 65.6/100: 66% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage
1:11.255 st O warrior_of_elune Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(3), best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage
1:11.255 st Q starsurge Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage
1:12.248 st V full_moon Fluffy_Pillow 11.6/100: 12% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage
1:14.234 st Y wrath Fluffy_Pillow 61.6/100: 62% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_urctos(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:15.154 st W cancel_buff Fluffy_Pillow 79.6/100: 80% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:15.154 st Q starsurge Fluffy_Pillow 79.6/100: 80% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), warrior_of_elune(3), best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:16.183 st Q starsurge Fluffy_Pillow 53.6/100: 54% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord, warrior_of_elune(3), best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:17.173 st Y wrath Fluffy_Pillow 25.6/100: 26% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(20), starlord(2), warrior_of_elune(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:18.125 st P starfire Fluffy_Pillow 37.6/100: 38% astral_power denizen_of_the_dream(3), friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(20), starlord(2), warrior_of_elune(3), dreamstate, best_friends_with_urctos(11), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:18.880 st P starfire Fluffy_Pillow 54.4/100: 54% astral_power denizen_of_the_dream(3), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(2), warrior_of_elune(3), best_friends_with_urctos(11), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:19.634 st Q starsurge Fluffy_Pillow 73.2/100: 73% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(2), warrior_of_elune(2), best_friends_with_urctos(10), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:20.588 st Q starsurge Fluffy_Pillow 41.2/100: 41% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune(2), best_friends_with_urctos(9), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:21.509 st Y wrath Fluffy_Pillow 9.2/100: 9% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune(2), best_friends_with_urctos(8), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:22.428 st S moonfire Fluffy_Pillow 27.2/100: 27% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune(2), best_friends_with_urctos(7), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:23.349 st Y wrath Fluffy_Pillow 35.2/100: 35% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune(2), best_friends_with_urctos(6), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:24.270 st Q starsurge Fluffy_Pillow 53.2/100: 53% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune(2), best_friends_with_urctos(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:25.282 st R sunfire Fluffy_Pillow 17.2/100: 17% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:26.293 st Y wrath Fluffy_Pillow 23.2/100: 23% astral_power balance_of_all_things_nature, denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), best_friends_with_urctos(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:27.306 st Y wrath Fluffy_Pillow 43.2/100: 43% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:28.319 st Y wrath Fluffy_Pillow 59.2/100: 59% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:29.329 st W cancel_buff Fluffy_Pillow 79.2/100: 79% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), best_friends_with_urctos_static, corrupting_rage
1:29.329 st Q starsurge Fluffy_Pillow 79.2/100: 79% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), warrior_of_elune(2), best_friends_with_urctos_static, corrupting_rage
1:30.552 default F natures_vigil 460 T31 2p 47.2/100: 47% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, warrior_of_elune(2), best_friends_with_urctos_static, corrupting_rage
1:30.552 st Q starsurge Fluffy_Pillow 47.2/100: 47% astral_power natures_vigil, denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, warrior_of_elune(2), best_friends_with_urctos_static, corrupting_rage
1:31.729 st Y wrath Fluffy_Pillow 11.2/100: 11% astral_power natures_vigil, denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune(2), best_friends_with_urctos_static, corrupting_rage
1:32.862 st Y wrath Fluffy_Pillow 27.2/100: 27% astral_power natures_vigil, denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune(2), best_friends_with_urctos_static, corrupting_rage
1:33.995 st P starfire Fluffy_Pillow 39.2/100: 39% astral_power natures_vigil, denizen_of_the_dream(3), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune(2), dreamstate, best_friends_with_urctos_static, corrupting_rage
1:34.749 st P starfire Fluffy_Pillow 56.0/100: 56% astral_power natures_vigil, denizen_of_the_dream(3), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, best_friends_with_urctos_static
1:35.505 st Q starsurge Fluffy_Pillow 72.8/100: 73% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), best_friends_with_urctos_static
1:36.537 st Q starsurge Fluffy_Pillow 42.8/100: 43% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream(3), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_urctos_static
1:37.530 st Y wrath Fluffy_Pillow 10.8/100: 11% astral_power natures_vigil, balance_of_all_things_nature(6), denizen_of_the_dream(3), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_urctos_static
1:38.525 st Y wrath Fluffy_Pillow 28.8/100: 29% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream(3), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_urctos_static
1:39.520 st Q starsurge Fluffy_Pillow 48.8/100: 49% astral_power natures_vigil, balance_of_all_things_nature(4), denizen_of_the_dream(3), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_urctos_static
1:40.512 st Y wrath Fluffy_Pillow 14.8/100: 15% astral_power natures_vigil, balance_of_all_things_nature(3), denizen_of_the_dream(3), eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), best_friends_with_urctos_static
1:41.604 st Y wrath Fluffy_Pillow 30.8/100: 31% astral_power natures_vigil, balance_of_all_things_nature(2), denizen_of_the_dream(3), eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_urctos_static
1:42.696 st R sunfire Fluffy_Pillow 48.8/100: 49% astral_power natures_vigil, balance_of_all_things_nature, denizen_of_the_dream(3), eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_urctos_static
1:43.789 st Y wrath Fluffy_Pillow 54.8/100: 55% astral_power natures_vigil, denizen_of_the_dream(4), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_urctos_static
1:44.881 st Q starsurge Fluffy_Pillow 70.8/100: 71% astral_power natures_vigil, denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), best_friends_with_urctos_static
1:46.105 st Q starsurge Fluffy_Pillow 36.8/100: 37% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord, best_friends_with_urctos_static
1:47.281 default E use_items Fluffy_Pillow 4.8/100: 5% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), best_friends_with_urctos_static
1:47.281 st S moonfire Fluffy_Pillow 4.8/100: 5% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), best_friends_with_urctos_static, kindled_soul(100)
1:48.311 st T new_moon Fluffy_Pillow 12.8/100: 13% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), best_friends_with_urctos_static, kindled_soul(95)
1:49.066 st Q starsurge Fluffy_Pillow 28.8/100: 29% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), best_friends_with_urctos_static, corrupting_rage, kindled_soul(95)
1:50.098 st U half_moon Fluffy_Pillow 2.8/100: 3% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(90)
1:51.420 st Q starsurge Fluffy_Pillow 32.8/100: 33% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(80)
1:52.413 st Q starsurge Fluffy_Pillow 36.8/100: 37% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(75)
1:53.406 st Y wrath Fluffy_Pillow 8.8/100: 9% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(70)
1:54.399 st Y wrath Fluffy_Pillow 28.8/100: 29% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(65)
1:55.393 st Y wrath Fluffy_Pillow 44.8/100: 45% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(60)
1:56.386 st O warrior_of_elune Fluffy_Pillow 60.8/100: 61% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(55)
1:56.386 st X starsurge Fluffy_Pillow 60.8/100: 61% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(55)
1:57.379 st Y wrath Fluffy_Pillow 34.8/100: 35% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(50)
1:58.372 st P starfire Fluffy_Pillow 46.8/100: 47% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, corrupting_rage, kindled_soul(45)
1:59.124 st P starfire Fluffy_Pillow 63.6/100: 64% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(2), best_friends_with_urctos_static, corrupting_rage, kindled_soul(45)
1:59.879 st W cancel_buff Fluffy_Pillow 82.4/100: 82% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage, kindled_soul(40)
1:59.879 st Q starsurge Fluffy_Pillow 82.4/100: 82% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), solstice, warrior_of_elune, best_friends_with_urctos_static, corrupting_rage, kindled_soul(40)
2:00.990 st Q starsurge Fluffy_Pillow 50.4/100: 50% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord, warrior_of_elune, best_friends_with_urctos_static, corrupting_rage, kindled_soul(35)
2:02.059 st R sunfire Fluffy_Pillow 18.4/100: 18% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage, kindled_soul(30)
2:03.091 st Y wrath Fluffy_Pillow 26.4/100: 26% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage, kindled_soul(25)
2:04.120 st Q starsurge Fluffy_Pillow 44.4/100: 44% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(24), solstice, starlord(2), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage, kindled_soul(20)
2:05.254 st Y wrath Fluffy_Pillow 12.4/100: 12% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage, kindled_soul(15)
2:06.346 st S moonfire Fluffy_Pillow 30.4/100: 30% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage, kindled_soul(5)
2:07.439 st Y wrath Fluffy_Pillow 36.4/100: 36% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
2:08.532 st Y wrath Fluffy_Pillow 52.4/100: 52% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
2:09.624 st Y wrath Fluffy_Pillow 70.4/100: 70% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
2:10.719 st X starsurge Fluffy_Pillow 86.4/100: 86% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
2:11.810 st X starsurge Fluffy_Pillow 50.4/100: 50% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
2:12.901 st Y wrath Fluffy_Pillow 16.4/100: 16% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
2:13.993 st Y wrath Fluffy_Pillow 32.4/100: 32% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
2:15.085 st P starfire Fluffy_Pillow 44.4/100: 44% astral_power natures_grace, primordial_arcanic_pulsar(36), warrior_of_elune, dreamstate, best_friends_with_urctos_static, corrupting_rage
2:15.839 st P starfire Fluffy_Pillow 61.2/100: 61% astral_power natures_grace, primordial_arcanic_pulsar(36), best_friends_with_urctos_static, corrupting_rage
2:16.840 st Q starsurge Fluffy_Pillow 73.2/100: 73% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, best_friends_with_urctos_static, corrupting_rage
2:17.952 st Q starsurge Fluffy_Pillow 39.2/100: 39% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:18.942 st R sunfire Fluffy_Pillow 7.2/100: 7% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:19.894 st Y wrath Fluffy_Pillow 15.2/100: 15% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:20.848 st Y wrath Fluffy_Pillow 33.2/100: 33% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), solstice, starlord(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:21.897 st Q starsurge Fluffy_Pillow 53.2/100: 53% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), solstice, starlord(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:22.945 st Y wrath Fluffy_Pillow 19.2/100: 19% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:23.957 st Y wrath Fluffy_Pillow 35.2/100: 35% astral_power balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:24.968 st Y wrath Fluffy_Pillow 53.2/100: 53% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:25.982 st Y wrath Fluffy_Pillow 69.2/100: 69% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:26.993 st X starsurge Fluffy_Pillow 87.2/100: 87% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:28.005 st Y wrath Fluffy_Pillow 55.2/100: 55% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:29.018 st S moonfire Fluffy_Pillow 75.2/100: 75% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:30.030 st W cancel_buff Fluffy_Pillow 83.2/100: 83% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:30.030 st Q starsurge Fluffy_Pillow 83.2/100: 83% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:31.161 st P starfire Fluffy_Pillow 47.2/100: 47% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:32.793 st P starfire Fluffy_Pillow 59.2/100: 59% astral_power denizen_of_the_dream(3), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), starlord, dreamstate, best_friends_with_urctos_static, corrupting_rage
2:33.755 st Q starsurge Fluffy_Pillow 73.2/100: 73% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, dreamstate, best_friends_with_urctos_static, corrupting_rage
2:34.824 st Q starsurge Fluffy_Pillow 43.2/100: 43% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(2), dreamstate, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static
2:35.762 st V full_moon Fluffy_Pillow 15.2/100: 15% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(3), dreamstate, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static
2:37.567 st Q starsurge Fluffy_Pillow 73.2/100: 73% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(3), dreamstate, best_friends_with_aerwynn(8), best_friends_with_aerwynn_static
2:38.469 st Q starsurge Fluffy_Pillow 47.2/100: 47% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), dreamstate, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static
2:39.463 st R sunfire Fluffy_Pillow 23.2/100: 23% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), dreamstate, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static
2:40.456 st Q starsurge Fluffy_Pillow 31.2/100: 31% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), dreamstate, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static
2:41.450 st O warrior_of_elune Fluffy_Pillow 3.2/100: 3% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), dreamstate, best_friends_with_aerwynn(4), best_friends_with_aerwynn_static
2:41.450 st T new_moon Fluffy_Pillow 3.2/100: 3% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn(4), best_friends_with_aerwynn_static
2:42.206 st Y wrath Fluffy_Pillow 17.2/100: 17% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static
2:42.961 st X starsurge Fluffy_Pillow 33.2/100: 33% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static
2:43.955 st W cancel_buff Fluffy_Pillow 7.2/100: 7% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static
2:43.955 st Y wrath Fluffy_Pillow 7.2/100: 7% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), warrior_of_elune(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static
2:45.067 st Q starsurge Fluffy_Pillow 57.2/100: 57% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), warrior_of_elune(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static
2:46.180 st P starfire Fluffy_Pillow 29.2/100: 29% astral_power denizen_of_the_dream(4), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), starlord, warrior_of_elune(3), dreamstate, best_friends_with_aerwynn_static
2:46.936 st P starfire Fluffy_Pillow 46.0/100: 46% astral_power denizen_of_the_dream(4), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), starlord, warrior_of_elune(2), best_friends_with_aerwynn_static
2:47.691 st Q starsurge Fluffy_Pillow 64.8/100: 65% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(4), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, warrior_of_elune, best_friends_with_aerwynn_static
2:48.763 st Y wrath Fluffy_Pillow 32.8/100: 33% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, best_friends_with_aerwynn_static
2:49.793 st Q starsurge Fluffy_Pillow 48.8/100: 49% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, best_friends_with_aerwynn_static, corrupting_rage
2:50.825 st S moonfire Fluffy_Pillow 14.8/100: 15% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn_static
2:51.820 st Y wrath Fluffy_Pillow 26.8/100: 27% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn_static
2:52.912 st Q starsurge Fluffy_Pillow 44.8/100: 45% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn_static
2:54.006 st Y wrath Fluffy_Pillow 14.8/100: 15% astral_power balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_aerwynn_static
2:55.100 st R sunfire Fluffy_Pillow 30.8/100: 31% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_aerwynn_static
2:56.193 st Y wrath Fluffy_Pillow 38.8/100: 39% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_aerwynn_static
2:57.286 st Y wrath Fluffy_Pillow 56.8/100: 57% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_aerwynn_static
2:58.378 st Y wrath Fluffy_Pillow 72.8/100: 73% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_aerwynn_static
2:59.470 st W cancel_buff Fluffy_Pillow 88.8/100: 89% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_aerwynn_static
2:59.470 st Q starsurge Fluffy_Pillow 88.8/100: 89% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), warrior_of_elune, best_friends_with_aerwynn_static
3:00.696 default F natures_vigil 460 T31 2p 58.8/100: 59% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord, warrior_of_elune, best_friends_with_aerwynn_static
3:00.696 st Q starsurge Fluffy_Pillow 58.8/100: 59% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord, warrior_of_elune, best_friends_with_aerwynn_static
3:01.873 st Y wrath Fluffy_Pillow 24.8/100: 25% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(44), starlord(2), warrior_of_elune, best_friends_with_aerwynn_static
3:03.007 st N incarnation_chosen_of_elune Fluffy_Pillow 36.8/100: 37% astral_power natures_vigil, denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(44), starlord(2), warrior_of_elune, dreamstate(2), best_friends_with_aerwynn_static
3:03.007 st Q starsurge Fluffy_Pillow 36.8/100: 37% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), warrior_of_elune, dreamstate(2), best_friends_with_aerwynn_static
3:03.946 st U half_moon Fluffy_Pillow 10.8/100: 11% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), warrior_of_elune, dreamstate(2), best_friends_with_aerwynn_static
3:05.150 st Q starsurge Fluffy_Pillow 36.8/100: 37% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), warrior_of_elune, dreamstate(2), best_friends_with_aerwynn_static, corrupting_rage
3:06.053 st V full_moon Fluffy_Pillow 14.8/100: 15% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), warrior_of_elune, dreamstate(2), best_friends_with_aerwynn_static, corrupting_rage
3:07.855 st Q starsurge Fluffy_Pillow 66.8/100: 67% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), dreamstate(2), best_friends_with_aerwynn_static, corrupting_rage
3:08.759 st Q starsurge Fluffy_Pillow 40.8/100: 41% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), solstice, starlord(3), dreamstate(2), best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage
3:09.754 st Y wrath Fluffy_Pillow 14.8/100: 15% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), dreamstate, best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage
3:10.508 st Y wrath Fluffy_Pillow 34.8/100: 35% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage
3:11.264 st Y wrath Fluffy_Pillow 50.8/100: 51% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_pip(8), best_friends_with_pip_static, corrupting_rage
3:12.260 st Y wrath Fluffy_Pillow 70.8/100: 71% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_pip(7), best_friends_with_pip_static, corrupting_rage
3:13.256 st W cancel_buff Fluffy_Pillow 88.8/100: 89% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage
3:13.256 st Q starsurge Fluffy_Pillow 88.8/100: 89% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage
3:14.368 st Q starsurge Fluffy_Pillow 62.8/100: 63% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, best_friends_with_pip(5), best_friends_with_pip_static, corrupting_rage
3:15.437 st Q starsurge Fluffy_Pillow 38.8/100: 39% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(2), best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage
3:16.467 st J sunfire Fluffy_Pillow 12.8/100: 13% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip(3), best_friends_with_pip_static, corrupting_rage
3:17.460 default E use_items Fluffy_Pillow 18.8/100: 19% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage
3:17.460 st K moonfire Fluffy_Pillow 18.8/100: 19% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
3:18.453 st Y wrath Fluffy_Pillow 26.8/100: 27% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip, best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
3:19.445 st Y wrath Fluffy_Pillow 42.8/100: 43% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(95)
3:20.438 st Y wrath Fluffy_Pillow 58.8/100: 59% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(90)
3:21.432 st X starsurge Fluffy_Pillow 76.8/100: 77% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(85)
3:22.425 st Y wrath Fluffy_Pillow 48.8/100: 49% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(80)
3:23.418 st Y wrath Fluffy_Pillow 64.8/100: 65% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(75)
3:24.412 st X starsurge Fluffy_Pillow 82.8/100: 83% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(70)
3:25.404 st Y wrath Fluffy_Pillow 56.8/100: 57% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(65)
3:26.398 st T new_moon Fluffy_Pillow 74.8/100: 75% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(60)
3:27.154 st W cancel_buff Fluffy_Pillow 90.8/100: 91% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(55)
3:27.154 st Q starsurge Fluffy_Pillow 90.8/100: 91% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), best_friends_with_pip_static, corrupting_rage, kindled_soul(55)
3:28.267 st Q starsurge Fluffy_Pillow 62.8/100: 63% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord, best_friends_with_pip_static, corrupting_rage, kindled_soul(50)
3:29.337 st Q starsurge Fluffy_Pillow 34.8/100: 35% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(45)
3:30.367 st Y wrath Fluffy_Pillow 8.8/100: 9% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(40)
3:31.360 st R sunfire Fluffy_Pillow 24.8/100: 25% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(35)
3:32.353 st Y wrath Fluffy_Pillow 30.8/100: 31% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(30)
3:33.346 st X starsurge Fluffy_Pillow 48.8/100: 49% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(25)
3:34.340 st Y wrath Fluffy_Pillow 20.8/100: 21% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(20)
3:35.332 st S moonfire Fluffy_Pillow 38.8/100: 39% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(15)
3:36.325 st X starsurge Fluffy_Pillow 46.8/100: 47% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(10)
3:37.318 st Y wrath Fluffy_Pillow 50.8/100: 51% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(5)
3:38.312 st O warrior_of_elune Fluffy_Pillow 66.8/100: 67% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_pip_static, corrupting_rage
3:38.312 st Y wrath Fluffy_Pillow 66.8/100: 67% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, corrupting_rage
3:39.305 st X starsurge Fluffy_Pillow 84.8/100: 85% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, corrupting_rage
3:40.299 st Y wrath Fluffy_Pillow 56.8/100: 57% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, corrupting_rage
3:41.292 st Y wrath Fluffy_Pillow 72.8/100: 73% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, corrupting_rage
3:42.285 st Q starsurge Fluffy_Pillow 90.8/100: 91% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), warrior_of_elune(3), best_friends_with_pip_static, corrupting_rage
3:43.397 st Q starsurge Fluffy_Pillow 62.8/100: 63% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord, warrior_of_elune(3), best_friends_with_pip_static, corrupting_rage
3:44.467 st Q starsurge Fluffy_Pillow 34.8/100: 35% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(2), warrior_of_elune(3), best_friends_with_pip_static, corrupting_rage
3:45.498 st P starfire Fluffy_Pillow 8.8/100: 9% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip_static, corrupting_rage
3:46.253 st P starfire Fluffy_Pillow 25.6/100: 26% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(2), best_friends_with_pip_static, corrupting_rage
3:47.007 st Q starsurge Fluffy_Pillow 44.4/100: 44% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage
3:48.001 st U half_moon Fluffy_Pillow 12.4/100: 12% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage
3:49.203 st Q starsurge Fluffy_Pillow 38.4/100: 38% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage
3:50.107 st R sunfire Fluffy_Pillow 14.4/100: 14% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage
3:51.011 st Y wrath Fluffy_Pillow 24.4/100: 24% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage
3:52.004 st Q starsurge Fluffy_Pillow 42.4/100: 42% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage
3:52.998 st Y wrath Fluffy_Pillow 16.4/100: 16% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage
3:53.991 st Y wrath Fluffy_Pillow 36.4/100: 36% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune, best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage
3:54.985 st Y wrath Fluffy_Pillow 54.4/100: 54% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune, best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage
3:55.978 st Y wrath Fluffy_Pillow 72.4/100: 72% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune, best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage
3:56.971 st W cancel_buff Fluffy_Pillow 88.4/100: 88% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune, best_friends_with_urctos, best_friends_with_urctos_static
3:56.971 st Q starsurge Fluffy_Pillow 88.4/100: 88% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), warrior_of_elune, best_friends_with_urctos, best_friends_with_urctos_static
3:58.084 st Q starsurge Fluffy_Pillow 62.4/100: 62% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord, warrior_of_elune, best_friends_with_urctos_static
3:59.155 st P starfire Fluffy_Pillow 34.4/100: 34% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), starlord(2), warrior_of_elune, dreamstate, best_friends_with_urctos_static
3:59.909 st P starfire Fluffy_Pillow 53.2/100: 53% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), starlord(2), best_friends_with_urctos_static
4:00.835 st Q starsurge Fluffy_Pillow 69.2/100: 69% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(2), best_friends_with_urctos_static
4:01.867 st K moonfire Fluffy_Pillow 35.2/100: 35% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), best_friends_with_urctos_static
4:02.861 st Q starsurge Fluffy_Pillow 43.2/100: 43% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), best_friends_with_urctos_static
4:03.855 st Y wrath Fluffy_Pillow 13.2/100: 13% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), best_friends_with_urctos_static
4:04.848 st Y wrath Fluffy_Pillow 31.2/100: 31% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), best_friends_with_urctos_static
4:05.841 st Q starsurge Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(24), solstice, starlord(3), best_friends_with_urctos_static
4:06.935 st R sunfire Fluffy_Pillow 17.2/100: 17% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_urctos_static, wafting_devotion
4:07.946 st Y wrath Fluffy_Pillow 23.2/100: 23% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_urctos_static, wafting_devotion
4:08.958 st Y wrath Fluffy_Pillow 39.2/100: 39% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_urctos_static, wafting_devotion
4:09.970 st Y wrath Fluffy_Pillow 57.2/100: 57% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_urctos_static, wafting_devotion
4:10.983 st Y wrath Fluffy_Pillow 73.2/100: 73% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_urctos_static, wafting_devotion
4:11.996 st Q starsurge Fluffy_Pillow 89.2/100: 89% astral_power eclipse_solar, primordial_arcanic_pulsar(28), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:13.128 st Q starsurge Fluffy_Pillow 55.2/100: 55% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:14.216 st Y wrath Fluffy_Pillow 19.2/100: 19% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), best_friends_with_urctos_static, wafting_devotion
4:15.266 st P starfire Fluffy_Pillow 39.2/100: 39% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), best_friends_with_urctos_static, wafting_devotion
4:16.837 st P starfire Fluffy_Pillow 51.2/100: 51% astral_power natures_grace, primordial_arcanic_pulsar(36), starlord(2), dreamstate, best_friends_with_urctos_static, wafting_devotion
4:17.695 st Q starsurge Fluffy_Pillow 63.2/100: 63% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(2), dreamstate, best_friends_with_urctos_static, wafting_devotion
4:18.648 st S moonfire Fluffy_Pillow 31.2/100: 31% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), dreamstate, best_friends_with_urctos_static, wafting_devotion
4:19.568 st Q starsurge Fluffy_Pillow 41.2/100: 41% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), dreamstate, best_friends_with_urctos_static, wafting_devotion
4:20.485 st Y wrath Fluffy_Pillow 9.2/100: 9% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_urctos_static, wafting_devotion
4:21.239 st Y wrath Fluffy_Pillow 31.2/100: 31% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_urctos_static, wafting_devotion
4:22.157 st Q starsurge Fluffy_Pillow 81.2/100: 81% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_urctos_static
4:23.248 st Y wrath Fluffy_Pillow 45.2/100: 45% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_urctos_static
4:24.340 st Y wrath Fluffy_Pillow 63.2/100: 63% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_urctos_static
4:25.433 st R sunfire Fluffy_Pillow 79.2/100: 79% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_urctos_static
4:26.526 st O warrior_of_elune Fluffy_Pillow 85.2/100: 85% astral_power eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_urctos_static
4:26.526 st W cancel_buff Fluffy_Pillow 85.2/100: 85% astral_power eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static
4:26.526 st Q starsurge Fluffy_Pillow 85.2/100: 85% astral_power eclipse_solar, primordial_arcanic_pulsar(48), warrior_of_elune(3), best_friends_with_urctos_static
4:27.748 st Q starsurge Fluffy_Pillow 53.2/100: 53% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord, warrior_of_elune(3), best_friends_with_urctos_static
4:28.926 st Y wrath Fluffy_Pillow 19.2/100: 19% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(2), warrior_of_elune(3), best_friends_with_urctos_static
4:30.061 st Q starsurge Fluffy_Pillow 39.2/100: 39% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(2), warrior_of_elune(3), best_friends_with_urctos_static
4:31.194 default F natures_vigil 460 T31 2p 7.2/100: 7% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos_static
4:31.194 st V full_moon Fluffy_Pillow 7.2/100: 7% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos_static
4:33.178 st Q starsurge Fluffy_Pillow 61.2/100: 61% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos_static
4:34.171 st Q starsurge Fluffy_Pillow 35.2/100: 35% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos_static
4:35.164 st T new_moon Fluffy_Pillow 7.2/100: 7% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos_static
4:35.918 st Y wrath Fluffy_Pillow 21.2/100: 21% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos_static
4:36.911 st Q starsurge Fluffy_Pillow 39.2/100: 39% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static
4:37.906 st Y wrath Fluffy_Pillow 13.2/100: 13% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static
4:38.899 st Y wrath Fluffy_Pillow 29.2/100: 29% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static
4:39.894 st W cancel_buff Fluffy_Pillow 49.2/100: 49% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static
4:39.894 st Q starsurge Fluffy_Pillow 49.2/100: 49% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), warrior_of_elune(3), best_friends_with_urctos_static
4:41.006 st S moonfire Fluffy_Pillow 21.2/100: 21% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord, warrior_of_elune(3), best_friends_with_urctos_static
4:42.076 st P starfire Fluffy_Pillow 29.2/100: 29% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), starlord, warrior_of_elune(3), dreamstate, best_friends_with_urctos_static
4:42.830 st P starfire Fluffy_Pillow 46.0/100: 46% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), starlord, warrior_of_elune(2), best_friends_with_urctos_static
4:43.583 st Q starsurge Fluffy_Pillow 66.8/100: 67% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord, warrior_of_elune, best_friends_with_urctos_static
4:44.653 st R sunfire Fluffy_Pillow 32.8/100: 33% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(2), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
4:45.684 st Q starsurge Fluffy_Pillow 40.8/100: 41% astral_power natures_vigil, balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(2), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
4:46.714 st Y wrath Fluffy_Pillow 6.8/100: 7% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
4:47.709 default E use_items Fluffy_Pillow 24.8/100: 25% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
4:47.709 st U half_moon Fluffy_Pillow 24.8/100: 25% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage, kindled_soul(100)
4:49.032 st Y wrath Fluffy_Pillow 52.8/100: 53% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage, kindled_soul(95)
4:50.123 st Y wrath Fluffy_Pillow 72.8/100: 73% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage, kindled_soul(90)
4:51.216 st X starsurge Fluffy_Pillow 90.8/100: 91% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(85)
4:52.308 st X starsurge Fluffy_Pillow 54.8/100: 55% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(80)
4:53.400 st W cancel_buff Fluffy_Pillow 18.8/100: 19% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(75)
4:53.400 st Y wrath Fluffy_Pillow 18.8/100: 19% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(75)
4:54.623 st Q starsurge Fluffy_Pillow 38.8/100: 39% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(70)
4:55.846 st Y wrath Fluffy_Pillow 2.8/100: 3% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(36), starlord, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(60)

Stats

Level Bonus (70) Race Bonus (tauren) Raid-Buffed Unbuffed Gear Amount
Strength 898 2 986 900 0
Agility 2089 -2 2173 2087 0
Stamina 3848 2 36056 34339 30422
Intellect 2089 -2 13596 12779 10084 (6209)
Spirit 0 0 0 0 0
Health 721120 721120 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13596 12779 0
Crit 27.03% 20.82% 2847
Haste 23.01% 23.01% 3912
Versatility 6.22% 1.22% 251
Mana Regen 2560 2560 0
Attack Power 14140 13290 0
Mastery 29.14% 29.14% 7552
Armor 4552 4552 4552
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 469.00
Local Head Benevolent Embersage's Casque
ilevel: 470, stats: { 585 Armor, +3163 Sta, +655 Crit, +307 Haste, +786 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }, enchant: incandescent_essence
Local Neck Eye of the Rising Flame
ilevel: 470, stats: { +1779 Sta, +233 Haste, +1397 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Life-Bound Shoulderpads
ilevel: 470, stats: { 536 Armor, +2372 Sta, +360 Mastery, +360 Haste, +590 AgiInt }
item effects: { equip: Toxified }
Local Chest Benevolent Embersage's Robe
ilevel: 460, stats: { 727 Armor, +2804 Sta, +639 Crit, +284 Mastery, +716 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 470, stats: { 439 Armor, +2372 Sta, +497 Haste, +224 Mastery, +590 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 460, stats: { 636 Armor, +2804 Sta, +630 Haste, +293 Mastery, +716 AgiInt }, enchant: { +155 StrAgiInt, +41 Vers (lambent_armor_kit_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 470, stats: { 488 Armor, +2372 Sta, +257 Crit, +412 Haste, +590 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Thermal Bindings
ilevel: 470, stats: { 390 Armor, +1779 Sta, +178 Crit, +363 Mastery, +442 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Benevolent Embersage's Talons
ilevel: 470, stats: { 439 Armor, +2372 Sta, +210 Vers, +511 Mastery, +590 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 470, stats: { +1779 Sta, +466 Haste, +1165 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 470, stats: { +1779 Sta, +1118 Crit, +512 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 470, stats: { +747 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 470, stats: { +687 Mastery }
item effects: { use: Balefire Branch }
Local Back Drape of the Loyal Vassal
ilevel: 470, stats: { 312 Armor, +1779 Sta, +305 Haste, +236 Mastery, +442 StrAgiInt }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 470, weapon: { 508 - 654, 2.6 }, stats: { +393 Int, +1896 Int, +1581 Sta, +145 Haste, +335 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 470, stats: { +1206 Int, +1581 Sta, +162 Haste, +319 Mastery }

Talents

RowDruid Talents [31]
1
2
3
4
5
6
7
8
9
10
RowBalance Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

druid="460 T31 2p"
source=default
spec=balance
level=70
race=tauren
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:hissing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Balance APL can be found at https://balance-simc.github.io/Balance-SimC/balance.txt

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=470,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=470,gem_id=192961/192961/192961
shoulders=lifebound_shoulderpads,id=193406,bonus_id=8836/1576/8797/8960,ilevel=470,crafted_stats=49/36
back=drape_of_the_loyal_vassal,id=158375,bonus_id=4795,ilevel=470
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=460,enchant_id=6625
wrists=thermal_bindings,id=134461,bonus_id=4795,ilevel=470,gem_id=192961
hands=benevolent_embersages_talons,id=207255,bonus_id=4795,ilevel=470
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=460,enchant_id=6830
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=470
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=470
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=470
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=470,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=470

# Gear Summary
# gear_ilvl=468.75
# gear_stamina=30422
# gear_intellect=10084
# gear_crit_rating=2847
# gear_haste_rating=3912
# gear_mastery_rating=7552
# gear_versatility_rating=251
# gear_armor=4552
# set_bonus=tier31_2pc=1

460 T31 4p : 197952 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
197951.7 197951.7 196.5 / 0.099% 28478.4 / 14.4% 15858.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.1 12.1 Astral Power 0.00% 66.4 100.2% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
460 T31 4p 197952
Astral Smolder 14040 7.1% 63.6 4.68s 66282 0 Periodic 116.4 36229 0 36229 0.0% 77.5%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 63.64 0.00 116.44 116.44 47.75 0.0000 2.0000 4218427.42 4218427.42 0.00% 18114.09 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 116.44 72 157 36228.79 7983 115449 36229.74 27822 46430 4218427 4218427 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Denizen of the Dream 0 (6209) 0.0% (3.1%) 8.5 32.24s 220292 0

Stats Details: Denizen Of The Dream

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.48 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Denizen Of The Dream

  • id:394065
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394065
  • name:Denizen of the Dream
  • school:physical
  • tooltip:
  • description:Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.
    Fey Missile 20657  / 6209 3.1% 148.3 1.76s 12605 9676 Direct 147.3 9813 20397 12684 27.1%

Stats Details: Fey Missile

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 148.25 147.32 0.00 0.00 0.00 1.3028 0.0000 1868700.34 1868700.34 0.00% 9675.62 9675.62
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.88% 107.36 22 260 9813.21 6517 16779 9805.00 8720 11414 1053585 1053585 0.00%
crit 27.12% 39.96 6 104 20396.69 13555 34901 20384.98 18231 24261 815116 815116 0.00%

Action Details: Fey Missile

  • id:188046
  • school:astral
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.266
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.236000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:188046
  • name:Fey Missile
  • school:astral
  • tooltip:
  • description:{$@spelldesc187875=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$188083d=30 seconds}.}

Action Priority List

    default
    [ ]:5296.28
Hungering Shadowflame 2924 1.5% 17.2 16.95s 51298 0 Direct 17.2 39936 81439 51301 27.4%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.16 17.16 0.00 0.00 0.00 0.0000 0.0000 880247.31 880247.31 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.60% 12.46 3 27 39935.74 26973 154665 39814.36 26973 88625 497386 497386 0.00%
crit 27.40% 4.70 0 13 81438.60 55024 315517 80346.37 0 315517 382861 382861 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24191.79
  • base_dd_max:24191.79
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 5574 2.8% 33.9 8.66s 49452 0 Direct 33.8 38618 78699 49595 27.4%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.90 33.80 0.00 0.00 0.00 0.0000 0.0000 1676359.66 1676359.66 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.62% 24.55 9 44 38617.50 38181 43787 38615.21 38181 40131 948022 948022 0.00%
crit 27.38% 9.25 1 22 78699.08 77890 89326 78699.04 77890 84752 728338 728338 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:34245.43
  • base_dd_max:34245.43
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 10516 5.3% 14.4 21.61s 219753 225242 Direct 14.4 7749 16174 10607 33.9%
Periodic 308.2 7008 14916 9753 34.7% 99.7%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.37 14.37 308.24 308.24 13.37 0.9757 0.9713 3158793.76 3158793.76 0.00% 10078.82 225242.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.07% 9.50 2 16 7748.81 5063 14155 7741.41 6458 9530 73595 73595 0.00%
crit 33.93% 4.88 0 13 16174.18 11844 27771 16160.15 0 23253 78885 78885 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 65.29% 201.24 141 264 7007.83 217 12805 7011.12 6602 7437 1410215 1410215 0.00%
crit 34.71% 107.00 64 152 14916.01 4126 26123 14925.79 13930 16309 1596099 1596099 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    st
    [K]:1.31
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [S]:13.06
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
New Moon (Talent) 0 (18665) 0.0% (9.4%) 17.0 17.98s 329980 274599

Stats Details: Moons Talent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.00 0.00 0.00 0.00 0.00 1.2017 0.0000 0.00 0.00 0.00% 274599.45 274599.45

Action Details: Moons Talent

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
    Full Moon 6777 3.4% 5.3 63.13s 385530 206821 Direct 5.3 264899 531294 388091 46.2%

Stats Details: Full Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.30 5.26 0.00 0.00 0.00 1.8641 0.0000 2042145.90 2042145.90 0.00% 206820.53 206820.53
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.77% 2.83 0 6 264899.27 164082 433545 259881.68 0 415915 749727 749727 0.00%
crit 46.23% 2.43 0 6 531294.24 340282 925091 510059.27 0 896206 1292419 1292419 0.00%

Action Details: Full Moon

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:50.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Action Priority List

    st
    [V]:5.36
  • if_expr:astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    New Moon 5186 2.6% 6.0 53.66s 258683 342889 Direct 6.0 169836 360594 260250 47.4%

Stats Details: New Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.02 5.98 0.00 0.00 0.00 0.7545 0.0000 1556031.33 1556031.33 0.00% 342889.23 342889.23
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.61% 3.15 0 7 169835.64 81299 255208 167819.96 0 238028 534333 534333 0.00%
crit 47.39% 2.83 0 7 360594.45 165850 521591 356295.97 0 520108 1021698 1021698 0.00%

Action Details: New Moon

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Action Priority List

    st
    [T]:6.03
  • if_expr:astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Half Moon 6701 3.4% 5.7 58.20s 353663 287465 Direct 5.6 231269 466742 355791 52.9%

Stats Details: Half Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.68 5.65 0.00 0.00 0.00 1.2304 0.0000 2010241.87 2010241.87 0.00% 287464.88 287464.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 47.07% 2.66 0 7 231269.36 116868 371665 223985.10 0 361376 614842 614842 0.00%
crit 52.93% 2.99 0 7 466742.21 242366 761377 459099.66 0 720317 1395400 1395400 0.00%

Action Details: Half Moon

  • id:274282
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:24.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.875000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274282
  • name:Half Moon
  • school:astral
  • tooltip:
  • description:Deals {$s1=0} Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates {$=}{{$m3=240}/10} Astral Power.|r

Action Priority List

    st
    [U]:5.71
  • if_expr:astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (17233) 0.0% (8.7%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 6430 3.2% 94.2 3.20s 20523 0 Direct 93.9 13788 29413 20579 43.5%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 94.15 93.89 0.00 0.00 0.00 0.0000 0.0000 1932265.73 1932265.73 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.53% 53.08 28 88 13787.59 8333 27370 13794.09 12284 15671 731838 731838 0.00%
crit 43.47% 40.81 20 67 29412.86 17000 55158 29431.99 25463 34036 1200428 1200428 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 6442 3.3% 94.6 3.15s 20476 0 Direct 94.3 13763 29377 20530 43.3%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 94.57 94.31 0.00 0.00 0.00 0.0000 0.0000 1936354.79 1936354.79 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.66% 53.43 23 89 13763.08 8304 27370 13768.66 12100 15466 735373 735373 0.00%
crit 43.34% 40.88 18 68 29377.48 16941 55834 29391.58 25729 32902 1200982 1200982 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 4361 2.2% 6.3 48.43s 208191 0 Direct 6.3 139357 298041 208838 43.8%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.29 6.27 0.00 0.00 0.00 0.0000 0.0000 1310465.33 1310465.33 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.20% 3.53 0 8 139357.02 83854 268721 138503.35 0 234385 491562 491562 0.00%
crit 43.80% 2.75 0 8 298041.19 171061 556083 290826.52 0 506326 818903 818903 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 4930 2.5% 26.2 11.46s 56765 62969 Direct 27.2 38662 78589 54674 40.1%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.17 27.17 0.00 0.00 0.00 0.9015 0.0000 1485569.68 1485569.68 0.00% 62969.21 62969.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.89% 16.27 6 28 38661.91 17268 70882 38675.62 32210 44343 629133 629133 0.00%
crit 40.11% 10.90 1 21 78588.76 35226 140135 78580.08 60702 97734 856437 856437 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    st
    [L]:1.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
    st
    [P]:25.24
  • if_expr:variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Warrior of Elune2024251-1.000Spell DataNo-stacks
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Starsurge 63248 (85439) 31.9% (43.1%) 115.0 2.60s 223046 223766 Direct 114.7 (152.5) 113654 239389 165446 41.2% (41.8%)

Stats Details: Starsurge

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 114.98 114.74 0.00 0.00 0.00 0.9968 0.0000 18983796.56 18983796.56 0.00% 223766.17 223766.17
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.80% 67.47 37 98 113653.99 76059 217570 113723.40 104412 124423 7668182 7668182 0.00%
crit 41.20% 47.27 26 70 239388.96 155405 443843 239598.56 213917 266431 11315614 11315614 0.00%

Action Details: Starsurge

  • id:78674
  • school:astral
  • range:45.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:36.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.455000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.18

Spelldata

  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$s1=0} Astral damage.

Action Priority List

    st
    [Q]:84.78
  • if_expr:variable.starsurge_condition1
    st
    [X]:30.19
  • if_expr:variable.starsurge_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Flat Cost Incarnation: Chosen of Elune1025603-8.000Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Goldrinn's Fang 22191 11.2% 38.0 7.72s 175475 0 Direct 37.8 119582 249829 176311 43.6%

Stats Details: Goldrinns Fang

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.96 37.79 0.00 0.00 0.00 0.0000 0.0000 6661820.12 6661820.12 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.45% 21.33 5 44 119581.78 79657 227504 119676.93 99231 145669 2550508 2550508 0.00%
crit 43.55% 16.46 4 32 249829.34 162500 464107 250013.16 204885 315656 4111312 4111312 0.00%

Action Details: Goldrinns Fang

  • id:394047
  • school:astral
  • range:60.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.852000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10

Spelldata

  • id:394047
  • name:Goldrinn's Fang
  • school:astral
  • tooltip:Deals {$m1=0} Arcane damage.
  • description:Deals {$m1=0} Arcane damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountPower of Goldrinn3940462PCT1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Friend of the Fae39408310.100Spell Data
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Incarnation: Chosen of Elune10256020.100Spell Data
Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Dot / Debuff on Target Moonfire16481250.283Mastery
Sunfire16481550.283Mastery
Waning Twilight39395710.100
Sunfire 10550 5.3% 17.4 18.04s 181776 185704 Direct 17.4 7761 16012 10904 38.1%
Periodic 309.2 6907 14270 9640 37.1% 100.0%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.44 17.44 309.20 309.20 16.44 0.9789 0.9713 3170900.14 3170900.14 0.00% 9990.27 185704.25
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.91% 10.80 2 18 7761.11 4602 13205 7754.12 6706 9320 83828 83828 0.00%
crit 38.09% 6.64 0 16 16012.16 9389 27248 16006.80 0 21442 106389 106389 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 62.88% 194.43 136 254 6906.89 59 12206 6906.23 6582 7258 1342850 1342850 0.00%
crit 37.12% 114.77 71 161 14270.40 2116 24901 14272.19 13449 15256 1637832 1637832 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    st
    [J]:1.59
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [R]:15.86
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (3100) 0.0% (1.6%) 8.5 31.89s 109716 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 1613 0.8% 8.5 31.89s 57064 0 Direct 8.5 44601 90902 57063 26.9%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.50 8.50 0.00 0.00 0.00 0.0000 0.0000 484974.07 484974.07 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.08% 6.21 1 15 44600.95 44065 50535 44604.95 44065 50535 277027 277027 0.00%
crit 26.92% 2.29 0 10 90902.31 89892 103091 82060.56 0 103091 207947 207947 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:39522.22
  • base_dd_max:39522.22
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 1488 0.8% 16.5 15.43s 27156 0 Direct 16.5 21211 43233 27153 27.0%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.48 16.48 0.00 0.00 0.00 0.0000 0.0000 447479.94 447479.94 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.01% 12.03 1 28 21210.87 20968 24046 21211.67 20968 22849 255168 255168 0.00%
crit 26.99% 4.45 0 18 43232.51 42774 49054 42536.59 0 49054 192312 192312 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18805.57
  • base_dd_max:18805.57
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 18773 9.5% 115.1 2.55s 49008 51390 Direct 114.7 32657 68590 49189 46.0%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 115.09 114.67 0.00 0.00 0.00 0.9536 0.0000 5640409.47 5640409.47 0.00% 51390.44 51390.44
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.00% 61.92 37 91 32656.98 12761 103678 32656.50 28742 36536 2022133 2022133 0.00%
crit 46.00% 52.75 30 80 68590.11 26032 205921 68612.55 57637 77535 3618276 3618276 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    st
    [M]:0.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
    st
    [Y]:113.40

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.400Spell Data
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
460 T31 4p
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31 4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31 4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31 4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 182.79s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    st
    [N]:2.00
  • if_expr:variable.cd_condition_st

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.7 75.79s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.67 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31 4p
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:57075.72
  • base_dd_max:57075.72
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.35s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.75 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31 4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.75
Elemental Potion of Ultimate Power 1.5 307.77s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.48
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
Warrior of Elune 6.1 48.19s

Stats Details: Warrior Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.15 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Warrior Of Elune

  • id:202425
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202425
  • name:Warrior of Elune
  • school:arcane
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.

Action Priority List

    st
    [O]:6.15
  • if_expr:variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 8.7 1.5 36.3s 33.9s 8.6s 24.86% 28.70% 1.5 (6.9) 8.5

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 50.6s
  • trigger_min/max:3.0s / 50.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:22.10% / 27.80%

Stack Uptimes

  • balance_of_all_things_arcane_1:2.86%
  • balance_of_all_things_arcane_2:2.93%
  • balance_of_all_things_arcane_3:2.99%
  • balance_of_all_things_arcane_4:3.01%
  • balance_of_all_things_arcane_5:3.02%
  • balance_of_all_things_arcane_6:3.28%
  • balance_of_all_things_arcane_7:3.38%
  • balance_of_all_things_arcane_8:3.39%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 18.1 3.5 17.0s 14.1s 8.4s 50.41% 54.47% 3.5 (20.3) 17.5

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.1s
  • trigger_min/max:0.0s / 39.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 21.6s
  • uptime_min/max:46.30% / 53.85%

Stack Uptimes

  • balance_of_all_things_nature_1:5.83%
  • balance_of_all_things_nature_2:5.93%
  • balance_of_all_things_nature_3:6.05%
  • balance_of_all_things_nature_4:6.17%
  • balance_of_all_things_nature_5:6.33%
  • balance_of_all_things_nature_6:6.50%
  • balance_of_all_things_nature_7:6.68%
  • balance_of_all_things_nature_8:6.92%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 7.1 61.4 45.0s 4.2s 20.2s 48.05% 0.00% 33.6 (33.6) 0.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.1s
  • trigger_min/max:0.8s / 42.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:42.57% / 54.98%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:4.87%
  • balance_t31_4pc_buff_lunar_2:4.48%
  • balance_t31_4pc_buff_lunar_3:5.17%
  • balance_t31_4pc_buff_lunar_4:5.60%
  • balance_t31_4pc_buff_lunar_5:27.92%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 14.3 100.7 21.6s 2.6s 19.0s 90.21% 0.00% 46.4 (46.4) 0.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 58.1s
  • trigger_min/max:0.8s / 10.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:87.51% / 92.51%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:8.06%
  • balance_t31_4pc_buff_solar_2:12.54%
  • balance_t31_4pc_buff_solar_3:15.96%
  • balance_t31_4pc_buff_solar_4:11.54%
  • balance_t31_4pc_buff_solar_5:42.11%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 69.8s 69.8s 10.8s 10.12% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 316.7s
  • trigger_min/max:12.0s / 316.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 35.12%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.90%
  • best_friends_with_aerwynn_2:0.91%
  • best_friends_with_aerwynn_3:0.91%
  • best_friends_with_aerwynn_4:0.91%
  • best_friends_with_aerwynn_5:0.92%
  • best_friends_with_aerwynn_6:0.92%
  • best_friends_with_aerwynn_7:0.92%
  • best_friends_with_aerwynn_8:0.93%
  • best_friends_with_aerwynn_9:0.93%
  • best_friends_with_aerwynn_10:0.93%
  • best_friends_with_aerwynn_11:0.94%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 1.0 113.6s 69.8s 45.9s 33.69% 0.00% 70.2 (70.2) 0.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:13.0s / 359.2s
  • trigger_min/max:12.0s / 316.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 336.6s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.69%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.6s 70.6s 10.8s 9.94% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 337.4s
  • trigger_min/max:12.0s / 337.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 35.34%

Stack Uptimes

  • best_friends_with_pip_1:0.89%
  • best_friends_with_pip_2:0.89%
  • best_friends_with_pip_3:0.89%
  • best_friends_with_pip_4:0.90%
  • best_friends_with_pip_5:0.90%
  • best_friends_with_pip_6:0.90%
  • best_friends_with_pip_7:0.91%
  • best_friends_with_pip_8:0.91%
  • best_friends_with_pip_9:0.91%
  • best_friends_with_pip_10:0.92%
  • best_friends_with_pip_11:0.92%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 114.5s 70.6s 45.8s 33.25% 0.00% 69.6 (69.6) 0.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 356.7s
  • trigger_min/max:12.0s / 337.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 306.5s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.25%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 70.9s 70.9s 10.8s 9.94% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 323.3s
  • trigger_min/max:12.0s / 323.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 31.46%

Stack Uptimes

  • best_friends_with_urctos_1:0.89%
  • best_friends_with_urctos_2:0.89%
  • best_friends_with_urctos_3:0.89%
  • best_friends_with_urctos_4:0.90%
  • best_friends_with_urctos_5:0.90%
  • best_friends_with_urctos_6:0.90%
  • best_friends_with_urctos_7:0.91%
  • best_friends_with_urctos_8:0.91%
  • best_friends_with_urctos_9:0.91%
  • best_friends_with_urctos_10:0.92%
  • best_friends_with_urctos_11:0.92%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 114.9s 70.9s 45.6s 33.07% 0.00% 69.1 (69.1) 0.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 352.0s
  • trigger_min/max:12.0s / 323.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 343.4s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.07%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.66%

Stack Uptimes

  • bloodlust_1:13.48%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 62.2s 58.5s 50.1s 80.15% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 344.0s
  • trigger_min/max:15.0s / 316.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 338.5s
  • uptime_min/max:51.93% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.15%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Denizen of the Dream 8.5 0.0 45.0s 32.3s 40.7s 56.86% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_denizen_of_the_dream
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 230.4s
  • trigger_min/max:0.0s / 142.4s
  • trigger_pct:99.99%
  • duration_min/max:0.0s / 211.5s
  • uptime_min/max:20.50% / 94.65%

Stack Uptimes

  • denizen_of_the_dream_1:38.50%
  • denizen_of_the_dream_2:14.13%
  • denizen_of_the_dream_3:3.50%
  • denizen_of_the_dream_4:0.66%
  • denizen_of_the_dream_5:0.11%
  • denizen_of_the_dream_6:0.03%
  • denizen_of_the_dream_7:0.01%

Spelldata

  • id:394076
  • name:Denizen of the Dream
  • tooltip:
  • description:{$@spelldesc394065=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Dreamstate 15.5 0.4 20.0s 20.7s 3.1s 16.09% 21.42% 0.4 (0.7) 0.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 56.0s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.8s
  • uptime_min/max:9.22% / 25.48%

Stack Uptimes

  • dreamstate_1:9.69%
  • dreamstate_2:6.41%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 7.1 1.0 45.5s 45.0s 20.6s 49.12% 52.38% 1.0 (1.0) 6.9

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.1s
  • trigger_min/max:12.0s / 90.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:44.09% / 56.12%

Stack Uptimes

  • eclipse_lunar_1:49.12%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 13.8 5.7 22.4s 15.7s 20.1s 92.60% 95.96% 5.7 (5.7) 12.9

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 70.1s
  • trigger_min/max:0.0s / 55.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.0s
  • uptime_min/max:90.71% / 95.09%

Stack Uptimes

  • eclipse_solar_1:92.60%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 307.2s 307.2s 27.4s 13.27% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.8s
  • trigger_min/max:300.0s / 328.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.87% / 18.00%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.27%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Friend of the Fae 5.2 3.3 55.8s 32.3s 24.8s 43.06% 43.03% 3.3 (3.3) 4.8

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_friend_of_the_fae
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 174.5s
  • trigger_min/max:0.0s / 142.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 118.5s
  • uptime_min/max:13.76% / 76.50%

Stack Uptimes

  • friend_of_the_fae_1:43.06%

Spelldata

  • id:394083
  • name:Friend of the Fae
  • tooltip:Arcane and Nature damage increased by {$=}w1%.
  • description:{$@spelldesc394081=When a Faerie Dragon is summoned, your spells deal {$394083m1=10}% increased damage for {$394083d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 7.1 0.0 45.0s 45.0s 20.2s 48.20% 51.11% 0.0 (0.0) 6.9

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.1s
  • trigger_min/max:12.0s / 90.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:43.33% / 54.98%

Stack Uptimes

  • incarnation_chosen_of_elune_1:48.20%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.6 0.0 100.0s 100.0s 19.5s 23.24% 0.00% 0.0 (0.0) 3.2

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:55.09

Trigger Details

  • interval_min/max:90.0s / 126.3s
  • trigger_min/max:90.0s / 126.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.31% / 26.23%

Stack Uptimes

  • kindled_soul_5:1.10%
  • kindled_soul_10:1.14%
  • kindled_soul_15:1.14%
  • kindled_soul_20:1.15%
  • kindled_soul_25:1.15%
  • kindled_soul_30:1.15%
  • kindled_soul_35:1.15%
  • kindled_soul_40:1.16%
  • kindled_soul_45:1.16%
  • kindled_soul_50:1.16%
  • kindled_soul_55:1.17%
  • kindled_soul_60:1.17%
  • kindled_soul_65:1.17%
  • kindled_soul_70:1.17%
  • kindled_soul_75:1.18%
  • kindled_soul_80:1.18%
  • kindled_soul_85:1.18%
  • kindled_soul_90:1.18%
  • kindled_soul_95:1.19%
  • kindled_soul_100:1.19%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Grace 12.9 0.0 20.7s 20.7s 5.9s 25.37% 0.00% 0.0 (0.0) 12.6

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.8s / 70.5s
  • trigger_min/max:12.8s / 70.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:19.82% / 30.33%

Stack Uptimes

  • natures_grace_1:25.37%

Spelldata

  • id:393959
  • name:Nature's Grace
  • tooltip:Haste increased by {$s1=10}%.
  • description:{$@spelldesc393958=After an Eclipse ends, you gain {$393959s1=10}% Haste for {$393959d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Vigil 3.7 0.0 90.3s 90.3s 14.8s 18.40% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 92.0s
  • trigger_min/max:90.0s / 92.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.55% / 21.04%

Stack Uptimes

  • natures_vigil_1:18.40%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.4 0.1 75.4s 69.3s 7.7s 6.13% 6.86% 0.1 (0.1) 1.3

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.6s / 345.5s
  • trigger_min/max:0.1s / 342.4s
  • trigger_pct:14.72%
  • duration_min/max:0.0s / 27.0s
  • uptime_min/max:0.00% / 24.12%

Stack Uptimes

  • owlkin_frenzy_1:6.13%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 8.1 107.8 39.0s 39.0s 34.9s 93.91% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:25.0s / 50.7s
  • trigger_min/max:25.0s / 50.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 48.2s
  • uptime_min/max:90.25% / 96.84%

Stack Uptimes

  • primordial_arcanic_pulsar_4:5.02%
  • primordial_arcanic_pulsar_8:5.54%
  • primordial_arcanic_pulsar_12:6.50%
  • primordial_arcanic_pulsar_16:7.02%
  • primordial_arcanic_pulsar_20:6.34%
  • primordial_arcanic_pulsar_24:6.09%
  • primordial_arcanic_pulsar_28:8.07%
  • primordial_arcanic_pulsar_32:7.90%
  • primordial_arcanic_pulsar_36:6.65%
  • primordial_arcanic_pulsar_40:7.08%
  • primordial_arcanic_pulsar_44:6.92%
  • primordial_arcanic_pulsar_48:7.09%
  • primordial_arcanic_pulsar_52:7.17%
  • primordial_arcanic_pulsar_56:6.51%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 18.5 4.1 16.8s 14.1s 6.4s 39.56% 39.80% 4.1 (4.1) 18.1

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 49.0s
  • trigger_min/max:0.0s / 39.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.5s
  • uptime_min/max:36.51% / 42.05%

Stack Uptimes

  • solstice_1:39.56%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 20.8 94.2 14.7s 2.6s 14.1s 97.25% 0.00% 53.0 (53.0) 7.5

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 20.9s
  • trigger_min/max:0.8s / 10.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:93.63% / 99.13%

Stack Uptimes

  • starlord_1:9.57%
  • starlord_2:15.55%
  • starlord_3:72.13%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Wafting Devotion 4.3 1.2 61.5s 45.9s 16.5s 23.40% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 227.8s
  • trigger_min/max:0.0s / 214.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 68.8s
  • uptime_min/max:5.10% / 56.28%

Stack Uptimes

  • wafting_devotion_1:23.40%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Warrior of Elune 6.1 0.0 48.3s 48.3s 22.0s 44.96% 44.02% 0.0 (0.0) 2.4

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_warrior_of_elune
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:45.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 81.9s
  • trigger_min/max:45.0s / 81.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s
  • uptime_min/max:34.11% / 50.90%

Stack Uptimes

  • warrior_of_elune_1:22.09%
  • warrior_of_elune_2:4.85%
  • warrior_of_elune_3:18.02%

Spelldata

  • id:202425
  • name:Warrior of Elune
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.
  • max_stacks:0
  • duration:25.00
  • cooldown:45.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Denizen of the Dream 8.5 2.0 20.0 32.3s 0.0s 142.4s
Primordial Arcanic Pulsar 7.2 6.0 9.0 40.7s 29.8s 50.5s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.08% 0.00% 1.72% 0.5s 0.0s 2.6s
Astral Smolder 77.63% 59.00% 91.36% 14.7s 0.0s 104.0s
Incarnation (Total) 48.20% 43.33% 54.98% 20.2s 0.0s 54.0s
Incarnation (Pulsar) 27.99% 25.64% 30.31% 11.8s 0.0s 12.0s
Lunar Eclipse Only 0.92% 0.73% 1.14% 2.7s 2.6s 2.7s
Solar Eclipse Only 44.40% 36.26% 50.18% 10.8s 0.0s 15.0s
No Eclipse 6.46% 3.97% 8.44% 1.5s 0.0s 3.3s
Friend of the Fae 43.06% 13.76% 76.50% 24.8s 0.0s 118.5s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Warrior of Elune7.0300.00036.94443.34026.63870.400
Full Moon
New Moon
Half Moon		0.3530.00020.5756.0105.37726.295

Eclipse Utilization

NoneSolarLunarBoth
Wrath5.084.5%56.2849.8%0.000.0%51.7345.7%
Starfire25.1792.6%0.000.0%2.007.4%0.000.0%
Starsurge0.000.0%46.4340.4%0.000.0%68.5559.6%
New Moon0.040.7%0.162.7%0.000.0%5.8196.6%
Half Moon0.000.1%0.325.6%0.000.0%5.3694.3%
Full Moon0.231.9%3.1727.4%0.080.7%8.1270.0%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
460 T31 4p
Nature's BalanceAstral Power99.77199.445.50%2.000.110.05%
Full MoonAstral Power5.30264.507.29%49.950.260.10%
Half MoonAstral Power5.69136.463.76%24.000.000.00%
MoonfireAstral Power14.3786.172.38%6.000.060.07%
New MoonAstral Power6.0272.181.99%12.000.000.00%
Orbit BreakerAstral Power6.29187.765.18%29.831.070.57%
Shooting Stars (Moonfire)Astral Power94.16188.125.19%2.000.190.10%
Shooting Stars (Sunfire)Astral Power94.57188.945.21%2.000.190.10%
StarfireAstral Power27.17398.7211.00%14.672.760.69%
SunfireAstral Power17.44104.642.89%6.000.010.01%
WrathAstral Power115.101799.0649.62%15.630.000.00%
Usage Type Count Total Tot% Avg RPE APR
460 T31 4p
StarsurgeAstral Power 115.673653.64100.00%31.5931.787019.20
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 709820.0 3255.21 3831.74 1516671.7 536376.7 -201408.6 709820.0
Astral Power 70.0 12.05 12.07 4.7 24.2 0.0 100.0

Statistics & Data Analysis

Fight Length
460 T31 4p Fight Length
Count 5327
Mean 300.84
Minimum 240.03
Maximum 359.99
Spread ( max - min ) 119.97
Range [ ( max - min ) / 2 * 100% ] 19.94%
Standard Deviation 34.8306
5th Percentile 246.50
95th Percentile 354.29
( 95th Percentile - 5th Percentile ) 107.80
Mean Distribution
Standard Deviation 0.4772
95.00% Confidence Interval ( 299.90 - 301.78 )
Normalized 95.00% Confidence Interval ( 99.69% - 100.31% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 515
0.1% Error 51493
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1036
DPS
460 T31 4p Damage Per Second
Count 5327
Mean 197951.69
Minimum 173963.60
Maximum 232333.31
Spread ( max - min ) 58369.71
Range [ ( max - min ) / 2 * 100% ] 14.74%
Standard Deviation 7318.4756
5th Percentile 186643.19
95th Percentile 210384.24
( 95th Percentile - 5th Percentile ) 23741.06
Mean Distribution
Standard Deviation 100.2719
95.00% Confidence Interval ( 197755.16 - 198148.22 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5251
0.1 Scale Factor Error with Delta=300 457220
0.05 Scale Factor Error with Delta=300 1828879
0.01 Scale Factor Error with Delta=300 45721969
Priority Target DPS
460 T31 4p Priority Target Damage Per Second
Count 5327
Mean 197951.69
Minimum 173963.60
Maximum 232333.31
Spread ( max - min ) 58369.71
Range [ ( max - min ) / 2 * 100% ] 14.74%
Standard Deviation 7318.4756
5th Percentile 186643.19
95th Percentile 210384.24
( 95th Percentile - 5th Percentile ) 23741.06
Mean Distribution
Standard Deviation 100.2719
95.00% Confidence Interval ( 197755.16 - 198148.22 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5251
0.1 Scale Factor Error with Delta=300 457220
0.05 Scale Factor Error with Delta=300 1828879
0.01 Scale Factor Error with Delta=300 45721969
DPS(e)
460 T31 4p Damage Per Second (Effective)
Count 5327
Mean 197951.69
Minimum 173963.60
Maximum 232333.31
Spread ( max - min ) 58369.71
Range [ ( max - min ) / 2 * 100% ] 14.74%
Damage
460 T31 4p Damage
Count 5327
Mean 57596283.10
Minimum 43334065.94
Maximum 72417807.26
Spread ( max - min ) 29083741.31
Range [ ( max - min ) / 2 * 100% ] 25.25%
DTPS
460 T31 4p Damage Taken Per Second
Count 5327
Mean 3834.36
Minimum 1160.98
Maximum 7394.90
Spread ( max - min ) 6233.92
Range [ ( max - min ) / 2 * 100% ] 81.29%
HPS
460 T31 4p Healing Per Second
Count 5327
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
460 T31 4p Healing Per Second (Effective)
Count 5327
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
460 T31 4p Heal
Count 5327
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
460 T31 4p Healing Taken Per Second
Count 5327
Mean 3249.13
Minimum 718.26
Maximum 6474.45
Spread ( max - min ) 5756.19
Range [ ( max - min ) / 2 * 100% ] 88.58%
TMI
460 T31 4p Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
460 T31 4pTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
460 T31 4p Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.48 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.58 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.75 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.st
# count action,conditions
J 1.59 sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
K 1.31 moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
0.00 starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
0.00 starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
L 1.00 starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
M 0.00 wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
0.00 celestial_alignment,if=variable.cd_condition_st
N 2.00 incarnation,if=variable.cd_condition_st
0.00 variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
0.00 variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
O 6.15 warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
P 25.24 starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
0.00 wrath,if=variable.enter_eclipse
0.00 variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
0.00 convoke_the_spirits,if=variable.convoke_condition
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+55
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 starfall,if=buff.starweavers_warp.up
0.00 variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
Q 84.78 starsurge,if=variable.starsurge_condition1
R 15.86 sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
S 13.06 moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
T 6.03 new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
U 5.71 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
V 5.36 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
W 12.34 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
X 30.19 starsurge,if=variable.starsurge_condition2
Y 113.40 wrath
Z 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFJKLNDEQQQQTUQVXYYXRYXYWQQSYQYYYYXYXYOTXYYWQQQRYQQYQYYYSXYYXWQYPPQQRYQYYYYWQQYPPQSQUQQRVOWQQYQYYPPQQYYSYWQQRYYFQYYPPQYYWQQYYQRYSYXEQTUWQYQQYOYXYYPPQRYWQQSYQYYYXYYPPWQQRYQYYYYXSXVQQQTRYYXOXPPQYYWQQYYQSYYRXYPPFWQQYQYYYYYXYSRPPQEQQUQYQQVOTXXNYRYQQSQYYYYXYYXYXYYQQQRUQYQYSXYXYYWQQYQRVXPOPQYXYYQQSYYQYRYPPXTFYWQQQYQYYXPPQRSYYQQYQYYYXPEOPYXYRQDQSYYQUVXXXWY

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask 460 T31 4p 50.0/100: 50% astral_power
Pre precombat 1 food 460 T31 4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 2 augmentation 460 T31 4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 4 no_cd_talent 460 T31 4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 5 on_use_trinket 460 T31 4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 6 on_use_trinket 460 T31 4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 7 on_use_trinket 460 T31 4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 60.0/100: 60% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil 460 T31 4p 50.0/100: 50% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.000 st J sunfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.944 st K moonfire Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:01.888 st L starfire Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, corrupting_rage
0:02.737 st N incarnation_chosen_of_elune Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, corrupting_rage
0:02.737 default D potion Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), corrupting_rage
0:02.737 default E use_items Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power
0:02.737 st Q starsurge Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:03.594 st Q starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:04.420 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:05.214 st Q starsurge Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:05.980 st T new_moon Fluffy_Pillow 2.0/100: 2% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:06.736 st U half_moon Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:07.756 st Q starsurge Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:08.521 st V full_moon Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:10.049 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:10.814 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:11.568 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(60)
0:12.323 st X starsurge Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(55)
0:13.089 st R sunfire Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(50)
0:13.854 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(45)
0:14.620 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(45)
0:15.384 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(40)
0:16.150 st W cancel_buff Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(35)
0:16.150 st Q starsurge Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(35)
0:17.007 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.831 st S moonfire Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(11), elemental_potion_of_ultimate_power, kindled_soul(25)
0:18.626 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(10), elemental_potion_of_ultimate_power, kindled_soul(25)
0:19.422 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(9), elemental_potion_of_ultimate_power, kindled_soul(20)
0:20.217 st Y wrath Fluffy_Pillow 14.0/100: 14% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(8), elemental_potion_of_ultimate_power, kindled_soul(15)
0:20.983 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(8), elemental_potion_of_ultimate_power, kindled_soul(10)
0:21.748 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(7), elemental_potion_of_ultimate_power, kindled_soul(5)
0:22.514 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(6), elemental_potion_of_ultimate_power, kindled_soul(5)
0:23.278 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(5), elemental_potion_of_ultimate_power
0:24.045 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(4), elemental_potion_of_ultimate_power
0:24.811 st X starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(4), elemental_potion_of_ultimate_power
0:25.577 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(3), elemental_potion_of_ultimate_power
0:26.342 st O warrior_of_elune Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(2), corrupting_rage, elemental_potion_of_ultimate_power
0:26.342 st T new_moon Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(2), corrupting_rage, elemental_potion_of_ultimate_power
0:27.242 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn, corrupting_rage, elemental_potion_of_ultimate_power
0:28.008 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:28.774 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:29.539 st W cancel_buff Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:29.539 st Q starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(56), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:30.400 st Q starsurge Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:31.224 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:32.019 st R sunfire Fluffy_Pillow 14.0/100: 14% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:32.785 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:33.550 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:34.314 st Q starsurge Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:35.080 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:35.847 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:36.613 st Y wrath Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:37.379 st Y wrath Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:38.143 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:38.908 st S moonfire Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:39.673 st X starsurge Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:40.439 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:41.435 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:42.429 st X starsurge Fluffy_Pillow 80.0/100: 80% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:43.422 st W cancel_buff Fluffy_Pillow 52.0/100: 52% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:43.422 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:44.535 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:45.605 st P starfire Fluffy_Pillow 38.0/100: 38% astral_power natures_grace, primordial_arcanic_pulsar(32), starlord, warrior_of_elune(3), dreamstate, corrupting_rage
0:46.359 st P starfire Fluffy_Pillow 58.8/100: 59% astral_power natures_grace, primordial_arcanic_pulsar(32), starlord, warrior_of_elune(2), corrupting_rage
0:47.112 st Q starsurge Fluffy_Pillow 77.6/100: 78% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord, warrior_of_elune, corrupting_rage
0:48.183 st Q starsurge Fluffy_Pillow 45.6/100: 46% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar, corrupting_rage
0:49.215 st R sunfire Fluffy_Pillow 11.6/100: 12% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), corrupting_rage
0:50.210 st Y wrath Fluffy_Pillow 19.6/100: 20% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), corrupting_rage
0:51.206 st Q starsurge Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), corrupting_rage
0:52.299 st Y wrath Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar(3), corrupting_rage
0:53.392 st Y wrath Fluffy_Pillow 29.6/100: 30% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), corrupting_rage
0:54.486 st Y wrath Fluffy_Pillow 51.6/100: 52% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), corrupting_rage
0:55.580 st Y wrath Fluffy_Pillow 69.6/100: 70% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), corrupting_rage
0:56.673 st W cancel_buff Fluffy_Pillow 85.6/100: 86% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), corrupting_rage
0:56.673 st Q starsurge Fluffy_Pillow 85.6/100: 86% astral_power eclipse_solar, primordial_arcanic_pulsar(44), balance_t31_4pc_buff_solar(3), corrupting_rage
0:57.898 st Q starsurge Fluffy_Pillow 51.6/100: 52% astral_power eclipse_solar, primordial_arcanic_pulsar(48), starlord, balance_t31_4pc_buff_solar(4), corrupting_rage
0:59.077 st Y wrath Fluffy_Pillow 15.6/100: 16% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(2), balance_t31_4pc_buff_solar(5), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage
1:00.209 st P starfire Fluffy_Pillow 35.6/100: 36% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(2), balance_t31_4pc_buff_solar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage
1:01.909 st P starfire Fluffy_Pillow 47.6/100: 48% astral_power natures_grace, primordial_arcanic_pulsar(52), starlord(2), dreamstate, best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage
1:02.836 st Q starsurge Fluffy_Pillow 59.6/100: 60% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(2), dreamstate, best_friends_with_urctos(7), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:03.790 st S moonfire Fluffy_Pillow 29.6/100: 30% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), balance_t31_4pc_buff_solar, dreamstate, best_friends_with_urctos(6), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:04.710 st Q starsurge Fluffy_Pillow 39.6/100: 40% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), balance_t31_4pc_buff_solar, dreamstate, best_friends_with_urctos(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:05.629 st U half_moon Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:06.742 st Q starsurge Fluffy_Pillow 35.6/100: 36% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_urctos(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:07.580 st Q starsurge Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:08.500 st R sunfire Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), dreamstate, best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:09.421 st V full_moon Fluffy_Pillow 23.6/100: 24% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:11.256 st O warrior_of_elune Fluffy_Pillow 75.6/100: 76% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:11.342 st W cancel_buff Fluffy_Pillow 75.6/100: 76% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:11.342 st Q starsurge Fluffy_Pillow 75.6/100: 76% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:12.372 st Q starsurge Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:13.363 st Y wrath Fluffy_Pillow 21.6/100: 22% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion
1:14.118 st Q starsurge Fluffy_Pillow 37.6/100: 38% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion
1:15.073 st Y wrath Fluffy_Pillow 13.6/100: 14% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion
1:15.995 st Y wrath Fluffy_Pillow 29.6/100: 30% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion
1:16.917 st P starfire Fluffy_Pillow 43.6/100: 44% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, wafting_devotion
1:17.672 st P starfire Fluffy_Pillow 62.4/100: 62% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_urctos_static
1:18.427 st Q starsurge Fluffy_Pillow 83.2/100: 83% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static
1:19.421 st Q starsurge Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_urctos_static
1:20.415 st Y wrath Fluffy_Pillow 13.2/100: 13% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static
1:21.409 st Y wrath Fluffy_Pillow 31.2/100: 31% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static
1:22.403 st S moonfire Fluffy_Pillow 51.2/100: 51% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static
1:23.397 st Y wrath Fluffy_Pillow 59.2/100: 59% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, wafting_devotion
1:24.408 st W cancel_buff Fluffy_Pillow 81.2/100: 81% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, wafting_devotion
1:24.408 st Q starsurge Fluffy_Pillow 81.2/100: 81% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(28), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, wafting_devotion
1:25.540 st Q starsurge Fluffy_Pillow 47.2/100: 47% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(32), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, wafting_devotion
1:26.628 st R sunfire Fluffy_Pillow 11.2/100: 11% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, wafting_devotion
1:27.676 st Y wrath Fluffy_Pillow 19.2/100: 19% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, wafting_devotion
1:28.724 st Y wrath Fluffy_Pillow 35.2/100: 35% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:29.773 default F natures_vigil 460 T31 4p 55.2/100: 55% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:30.000 st Q starsurge Fluffy_Pillow 57.2/100: 57% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:31.049 st Y wrath Fluffy_Pillow 21.2/100: 21% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:32.062 st Y wrath Fluffy_Pillow 39.2/100: 39% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:33.075 st P starfire Fluffy_Pillow 51.2/100: 51% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:33.828 st P starfire Fluffy_Pillow 68.0/100: 68% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:34.658 st Q starsurge Fluffy_Pillow 80.0/100: 80% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:35.578 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:36.501 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power natures_vigil, balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:37.421 st W cancel_buff Fluffy_Pillow 84.0/100: 84% astral_power natures_vigil, balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:37.421 st Q starsurge Fluffy_Pillow 84.0/100: 84% astral_power natures_vigil, balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, balance_t31_4pc_buff_solar, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:38.453 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, corrupting_rage
1:39.524 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power natures_vigil, balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), solstice, starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage
1:40.657 st Y wrath Fluffy_Pillow 36.0/100: 36% astral_power natures_vigil, balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage
1:41.790 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power natures_vigil, balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage
1:42.923 st R sunfire Fluffy_Pillow 18.0/100: 18% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage
1:44.016 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, corrupting_rage
1:45.109 st S moonfire Fluffy_Pillow 42.0/100: 42% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage
1:46.203 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage
1:47.297 st X starsurge Fluffy_Pillow 64.0/100: 64% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
1:48.310 default E use_items Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
1:48.310 st Q starsurge Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(100)
1:49.229 st T new_moon Fluffy_Pillow 8.0/100: 8% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(100)
1:49.984 st U half_moon Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(95)
1:51.209 st W cancel_buff Fluffy_Pillow 48.0/100: 48% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(90)
1:51.209 st Q starsurge Fluffy_Pillow 48.0/100: 48% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(90)
1:52.240 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(85)
1:53.231 st Q starsurge Fluffy_Pillow 72.0/100: 72% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(80)
1:54.222 st Q starsurge Fluffy_Pillow 46.0/100: 46% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(75)
1:55.177 st Y wrath Fluffy_Pillow 18.0/100: 18% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(70)
1:56.096 st O warrior_of_elune Fluffy_Pillow 34.0/100: 34% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(65)
1:56.342 st Y wrath Fluffy_Pillow 34.0/100: 34% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(60)
1:57.262 st X starsurge Fluffy_Pillow 52.0/100: 52% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(60)
1:58.184 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(55)
1:59.104 st Y wrath Fluffy_Pillow 40.0/100: 40% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(50)
2:00.025 st P starfire Fluffy_Pillow 54.0/100: 54% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(45)
2:00.779 st P starfire Fluffy_Pillow 72.8/100: 73% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(40)
2:01.533 st Q starsurge Fluffy_Pillow 91.6/100: 92% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(35)
2:02.454 st R sunfire Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(30)
2:03.450 st Y wrath Fluffy_Pillow 67.6/100: 68% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(25)
2:04.444 st W cancel_buff Fluffy_Pillow 87.6/100: 88% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(20)
2:04.444 st Q starsurge Fluffy_Pillow 87.6/100: 88% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(20)
2:05.558 st Q starsurge Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(15)
2:06.736 st S moonfire Fluffy_Pillow 23.6/100: 24% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(10)
2:07.871 st Y wrath Fluffy_Pillow 31.6/100: 32% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(5)
2:09.005 st Q starsurge Fluffy_Pillow 49.6/100: 50% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, corrupting_rage
2:10.140 st Y wrath Fluffy_Pillow 13.6/100: 14% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, corrupting_rage
2:11.233 st Y wrath Fluffy_Pillow 29.6/100: 30% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, corrupting_rage
2:12.327 st Y wrath Fluffy_Pillow 49.6/100: 50% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, corrupting_rage
2:13.422 st X starsurge Fluffy_Pillow 65.6/100: 66% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, corrupting_rage
2:14.515 st Y wrath Fluffy_Pillow 29.6/100: 30% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, corrupting_rage
2:15.609 st Y wrath Fluffy_Pillow 47.6/100: 48% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, corrupting_rage
2:16.702 st P starfire Fluffy_Pillow 59.6/100: 60% astral_power natures_grace, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, dreamstate, best_friends_with_aerwynn_static, corrupting_rage
2:17.456 st P starfire Fluffy_Pillow 76.4/100: 76% astral_power natures_grace, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_aerwynn_static
2:18.351 st W cancel_buff Fluffy_Pillow 92.4/100: 92% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_aerwynn_static
2:18.351 st Q starsurge Fluffy_Pillow 92.4/100: 92% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, best_friends_with_aerwynn_static
2:19.465 st Q starsurge Fluffy_Pillow 58.4/100: 58% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static
2:20.535 st R sunfire Fluffy_Pillow 24.4/100: 24% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static
2:21.568 st Y wrath Fluffy_Pillow 34.4/100: 34% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static
2:22.598 st Q starsurge Fluffy_Pillow 54.4/100: 54% astral_power balance_of_all_things_nature(4), eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static
2:23.730 st Y wrath Fluffy_Pillow 20.4/100: 20% astral_power balance_of_all_things_nature(3), eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static
2:24.823 st Y wrath Fluffy_Pillow 40.4/100: 40% astral_power balance_of_all_things_nature(2), eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(11), best_friends_with_urctos_static
2:25.916 st Y wrath Fluffy_Pillow 56.4/100: 56% astral_power balance_of_all_things_nature, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(10), best_friends_with_urctos_static
2:27.008 st Y wrath Fluffy_Pillow 74.4/100: 74% astral_power eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(9), best_friends_with_urctos_static
2:28.103 st X starsurge Fluffy_Pillow 92.4/100: 92% astral_power eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(8), best_friends_with_urctos_static
2:29.197 st S moonfire Fluffy_Pillow 56.4/100: 56% astral_power eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos(7), best_friends_with_urctos_static
2:30.290 st X starsurge Fluffy_Pillow 64.4/100: 64% astral_power eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos(6), best_friends_with_urctos_static
2:31.385 st V full_moon Fluffy_Pillow 32.4/100: 32% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_urctos(5), best_friends_with_urctos_static
2:33.368 st Q starsurge Fluffy_Pillow 86.4/100: 86% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_urctos(3), best_friends_with_urctos_static
2:34.481 st Q starsurge Fluffy_Pillow 60.4/100: 60% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(2), best_friends_with_urctos_static
2:35.552 st Q starsurge Fluffy_Pillow 32.4/100: 32% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos, best_friends_with_urctos_static
2:36.583 st T new_moon Fluffy_Pillow 6.4/100: 6% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static
2:37.339 st R sunfire Fluffy_Pillow 20.4/100: 20% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static
2:38.333 st Y wrath Fluffy_Pillow 26.4/100: 26% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static
2:39.328 st Y wrath Fluffy_Pillow 44.4/100: 44% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static
2:40.322 st X starsurge Fluffy_Pillow 60.4/100: 60% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static
2:41.318 st O warrior_of_elune Fluffy_Pillow 34.4/100: 34% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
2:41.342 st X starsurge Fluffy_Pillow 34.4/100: 34% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
2:42.336 st P starfire Fluffy_Pillow 8.4/100: 8% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static
2:43.091 st P starfire Fluffy_Pillow 25.2/100: 25% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_urctos_static
2:43.846 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static
2:44.840 st Y wrath Fluffy_Pillow 40.0/100: 40% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_urctos_static
2:45.836 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_urctos_static
2:46.830 st W cancel_buff Fluffy_Pillow 76.0/100: 76% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_urctos_static
2:46.830 st Q starsurge Fluffy_Pillow 76.0/100: 76% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_urctos_static
2:47.943 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static
2:49.014 st Y wrath Fluffy_Pillow 14.0/100: 14% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(32), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage
2:50.147 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage
2:51.278 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage
2:52.412 st S moonfire Fluffy_Pillow 16.0/100: 16% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage
2:53.505 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage
2:54.599 st Y wrath Fluffy_Pillow 44.0/100: 44% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage
2:55.692 st R sunfire Fluffy_Pillow 62.0/100: 62% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage
2:56.784 st X starsurge Fluffy_Pillow 70.0/100: 70% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage
2:57.877 st Y wrath Fluffy_Pillow 38.0/100: 38% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, corrupting_rage
2:58.971 st P starfire Fluffy_Pillow 50.0/100: 50% astral_power natures_grace, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, dreamstate, best_friends_with_urctos_static, corrupting_rage
2:59.725 st P starfire Fluffy_Pillow 66.8/100: 67% astral_power natures_grace, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_urctos_static, corrupting_rage
3:00.620 default F natures_vigil 460 T31 4p 80.8/100: 81% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_urctos_static, corrupting_rage
3:00.620 st W cancel_buff Fluffy_Pillow 80.8/100: 81% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_urctos_static, corrupting_rage
3:00.620 st Q starsurge Fluffy_Pillow 80.8/100: 81% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, best_friends_with_urctos_static, corrupting_rage
3:01.733 st Q starsurge Fluffy_Pillow 46.8/100: 47% astral_power natures_vigil, balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_urctos_static, corrupting_rage
3:02.803 st Y wrath Fluffy_Pillow 14.8/100: 15% astral_power natures_vigil, balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, corrupting_rage
3:03.834 st Q starsurge Fluffy_Pillow 36.8/100: 37% astral_power natures_vigil, balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, corrupting_rage
3:04.865 st Y wrath Fluffy_Pillow 0.8/100: 1% astral_power natures_vigil, balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage
3:05.959 st Y wrath Fluffy_Pillow 18.8/100: 19% astral_power natures_vigil, balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage
3:07.052 st Y wrath Fluffy_Pillow 36.8/100: 37% astral_power natures_vigil, balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage
3:08.145 st Y wrath Fluffy_Pillow 54.8/100: 55% astral_power natures_vigil, balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage
3:09.239 st Y wrath Fluffy_Pillow 72.8/100: 73% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage
3:10.331 st X starsurge Fluffy_Pillow 90.8/100: 91% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage
3:11.426 st Y wrath Fluffy_Pillow 56.8/100: 57% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage
3:12.519 st S moonfire Fluffy_Pillow 76.8/100: 77% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage
3:13.613 st R sunfire Fluffy_Pillow 82.8/100: 83% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage
3:14.707 st P starfire Fluffy_Pillow 88.8/100: 89% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage
3:16.346 st P starfire Fluffy_Pillow 100.0/100: 100% astral_power natures_grace, primordial_arcanic_pulsar(56), dreamstate, best_friends_with_urctos_static, corrupting_rage
3:17.346 st Q starsurge Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, dreamstate, best_friends_with_urctos_static, corrupting_rage
3:18.460 default E use_items Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_urctos_static, corrupting_rage
3:18.460 st Q starsurge Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_urctos_static, corrupting_rage, kindled_soul(100)
3:19.434 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_urctos_static, corrupting_rage, kindled_soul(100)
3:20.371 st U half_moon Fluffy_Pillow 16.0/100: 16% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate, best_friends_with_urctos_static, corrupting_rage, kindled_soul(95)
3:21.576 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate, best_friends_with_urctos_static, corrupting_rage, kindled_soul(85)
3:22.479 st Y wrath Fluffy_Pillow 18.0/100: 18% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage, kindled_soul(80)
3:23.234 st Q starsurge Fluffy_Pillow 36.0/100: 36% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage, kindled_soul(80)
3:24.228 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(75)
3:25.222 st V full_moon Fluffy_Pillow 14.0/100: 14% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(70)
3:27.206 st O warrior_of_elune Fluffy_Pillow 68.0/100: 68% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(60)
3:27.206 st T new_moon Fluffy_Pillow 68.0/100: 68% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(60)
3:27.961 st X starsurge Fluffy_Pillow 80.0/100: 80% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(55)
3:28.956 st X starsurge Fluffy_Pillow 52.0/100: 52% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(50)
3:29.950 st N incarnation_chosen_of_elune Fluffy_Pillow 26.0/100: 26% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), dreamstate(2), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage, kindled_soul(45)
3:29.950 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage, kindled_soul(45)
3:30.706 st R sunfire Fluffy_Pillow 46.0/100: 46% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage, kindled_soul(40)
3:31.610 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage, kindled_soul(35)
3:32.367 st Q starsurge Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, warrior_of_elune(3), best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage, kindled_soul(35)
3:33.380 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage, kindled_soul(30)
3:34.353 st S moonfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage, kindled_soul(25)
3:35.291 st Q starsurge Fluffy_Pillow 30.0/100: 30% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(20)
3:36.228 st Y wrath Fluffy_Pillow 6.0/100: 6% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage, kindled_soul(15)
3:37.223 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(3), best_friends_with_urctos_static, kindled_soul(10)
3:38.217 st Y wrath Fluffy_Pillow 40.0/100: 40% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(2), best_friends_with_urctos_static, kindled_soul(5)
3:39.213 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos, best_friends_with_urctos_static
3:40.209 st X starsurge Fluffy_Pillow 76.0/100: 76% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static
3:41.203 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static
3:42.195 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static
3:43.191 st X starsurge Fluffy_Pillow 88.0/100: 88% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static
3:44.186 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:45.180 st X starsurge Fluffy_Pillow 80.0/100: 80% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:46.173 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:47.166 st Y wrath Fluffy_Pillow 72.0/100: 72% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:48.161 st Q starsurge Fluffy_Pillow 92.0/100: 92% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion
3:49.191 st Q starsurge Fluffy_Pillow 66.0/100: 66% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion
3:50.181 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion
3:51.136 st R sunfire Fluffy_Pillow 16.0/100: 16% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion
3:52.055 st U half_moon Fluffy_Pillow 26.0/100: 26% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:53.282 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:54.201 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:55.123 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:56.042 st Y wrath Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:56.962 st S moonfire Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:57.884 st X starsurge Fluffy_Pillow 46.0/100: 46% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:58.805 st Y wrath Fluffy_Pillow 18.0/100: 18% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:59.725 st X starsurge Fluffy_Pillow 34.0/100: 34% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:00.646 st Y wrath Fluffy_Pillow 10.0/100: 10% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:01.567 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:02.487 st W cancel_buff Fluffy_Pillow 74.0/100: 74% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:02.487 st Q starsurge Fluffy_Pillow 74.0/100: 74% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(20), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:03.518 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(24), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
4:04.588 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
4:05.618 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
4:06.651 st R sunfire Fluffy_Pillow 16.0/100: 16% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
4:07.646 st V full_moon Fluffy_Pillow 24.0/100: 24% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage
4:09.630 st X starsurge Fluffy_Pillow 80.0/100: 80% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage
4:10.625 st P starfire Fluffy_Pillow 52.0/100: 52% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(8), best_friends_with_pip_static, corrupting_rage
4:12.115 st O warrior_of_elune Fluffy_Pillow 68.0/100: 68% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), starlord(3), dreamstate(2), best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage
4:12.206 st P starfire Fluffy_Pillow 68.0/100: 68% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage
4:12.962 st Q starsurge Fluffy_Pillow 86.8/100: 87% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(3), warrior_of_elune(2), dreamstate, best_friends_with_pip(5), best_friends_with_pip_static, corrupting_rage
4:13.956 st Y wrath Fluffy_Pillow 54.8/100: 55% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage
4:14.710 st X starsurge Fluffy_Pillow 74.8/100: 75% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_pip(3), best_friends_with_pip_static, corrupting_rage
4:15.702 st Y wrath Fluffy_Pillow 44.8/100: 45% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage
4:16.699 st Y wrath Fluffy_Pillow 62.8/100: 63% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip, best_friends_with_pip_static, corrupting_rage
4:17.693 st Q starsurge Fluffy_Pillow 80.8/100: 81% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, corrupting_rage
4:18.806 st Q starsurge Fluffy_Pillow 46.8/100: 47% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord, warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
4:19.984 st S moonfire Fluffy_Pillow 10.8/100: 11% astral_power balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
4:21.117 st Y wrath Fluffy_Pillow 18.8/100: 19% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
4:22.251 st Y wrath Fluffy_Pillow 34.8/100: 35% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
4:23.384 st Q starsurge Fluffy_Pillow 50.8/100: 51% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
4:24.517 st Y wrath Fluffy_Pillow 16.8/100: 17% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
4:25.610 st R sunfire Fluffy_Pillow 32.8/100: 33% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
4:26.703 st Y wrath Fluffy_Pillow 38.8/100: 39% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
4:27.796 st P starfire Fluffy_Pillow 50.8/100: 51% astral_power denizen_of_the_dream(3), friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(2), dreamstate, best_friends_with_pip_static, corrupting_rage
4:28.552 st P starfire Fluffy_Pillow 67.6/100: 68% astral_power denizen_of_the_dream(3), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(2), best_friends_with_pip_static
4:29.308 st X starsurge Fluffy_Pillow 86.4/100: 86% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static
4:30.303 st T new_moon Fluffy_Pillow 56.4/100: 56% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_pip_static
4:31.057 default F natures_vigil 460 T31 4p 72.4/100: 72% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static
4:31.057 st Y wrath Fluffy_Pillow 72.4/100: 72% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static
4:31.961 st W cancel_buff Fluffy_Pillow 90.4/100: 90% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static
4:31.961 st Q starsurge Fluffy_Pillow 90.4/100: 90% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, warrior_of_elune, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static
4:32.973 st Q starsurge Fluffy_Pillow 64.4/100: 64% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static
4:33.947 st Q starsurge Fluffy_Pillow 42.4/100: 42% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static
4:34.977 st Y wrath Fluffy_Pillow 14.4/100: 14% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static
4:35.972 st Q starsurge Fluffy_Pillow 32.4/100: 32% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static
4:36.967 st Y wrath Fluffy_Pillow 8.4/100: 8% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static
4:37.963 st Y wrath Fluffy_Pillow 26.4/100: 26% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static
4:38.958 st X starsurge Fluffy_Pillow 42.4/100: 42% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static
4:39.953 st P starfire Fluffy_Pillow 16.4/100: 16% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static
4:41.441 st P starfire Fluffy_Pillow 28.4/100: 28% astral_power natures_vigil, denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(20), starlord(3), dreamstate, best_friends_with_aerwynn, best_friends_with_aerwynn_static
4:42.337 st Q starsurge Fluffy_Pillow 42.4/100: 42% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), dreamstate, best_friends_with_aerwynn_static
4:43.331 st R sunfire Fluffy_Pillow 8.4/100: 8% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), balance_t31_4pc_buff_solar, dreamstate, best_friends_with_aerwynn_static, corrupting_rage
4:44.325 st S moonfire Fluffy_Pillow 46.4/100: 46% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), balance_t31_4pc_buff_solar, dreamstate, best_friends_with_aerwynn_static, corrupting_rage
4:45.320 st Y wrath Fluffy_Pillow 56.4/100: 56% astral_power natures_vigil, balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, corrupting_rage
4:46.074 st Y wrath Fluffy_Pillow 72.4/100: 72% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, corrupting_rage
4:47.067 st Q starsurge Fluffy_Pillow 90.4/100: 90% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, corrupting_rage
4:48.180 st Q starsurge Fluffy_Pillow 60.4/100: 60% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, corrupting_rage
4:49.358 st Y wrath Fluffy_Pillow 28.4/100: 28% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, corrupting_rage
4:50.494 st Q starsurge Fluffy_Pillow 44.4/100: 44% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static
4:51.628 st Y wrath Fluffy_Pillow 10.4/100: 10% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static
4:52.722 st Y wrath Fluffy_Pillow 26.4/100: 26% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos(11), best_friends_with_urctos_static
4:53.815 st Y wrath Fluffy_Pillow 42.4/100: 42% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos(10), best_friends_with_urctos_static
4:54.907 st X starsurge Fluffy_Pillow 60.4/100: 60% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos(9), best_friends_with_urctos_static
4:56.000 st P starfire Fluffy_Pillow 24.4/100: 24% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos(8), best_friends_with_urctos_static
4:57.638 default E use_items Fluffy_Pillow 40.4/100: 40% astral_power natures_grace, primordial_arcanic_pulsar(40), starlord(3), dreamstate(2), best_friends_with_urctos(7), best_friends_with_urctos_static
4:57.638 st O warrior_of_elune Fluffy_Pillow 40.4/100: 40% astral_power natures_grace, primordial_arcanic_pulsar(40), starlord(3), dreamstate(2), best_friends_with_urctos(7), best_friends_with_urctos_static, kindled_soul(100)
4:57.638 st P starfire Fluffy_Pillow 40.4/100: 40% astral_power natures_grace, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos(7), best_friends_with_urctos_static, kindled_soul(100)
4:58.393 st Y wrath Fluffy_Pillow 61.2/100: 61% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune(2), best_friends_with_urctos(6), best_friends_with_urctos_static, kindled_soul(100)
4:59.147 st X starsurge Fluffy_Pillow 77.2/100: 77% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune(2), best_friends_with_urctos(5), best_friends_with_urctos_static, kindled_soul(95)
5:00.143 st Y wrath Fluffy_Pillow 45.2/100: 45% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_urctos(4), best_friends_with_urctos_static, kindled_soul(90)
5:01.138 st R sunfire Fluffy_Pillow 65.2/100: 65% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_urctos(3), best_friends_with_urctos_static, kindled_soul(85)
5:02.133 st Q starsurge Fluffy_Pillow 73.2/100: 73% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_urctos(2), best_friends_with_urctos_static, kindled_soul(80)
5:03.245 default D potion Fluffy_Pillow 41.2/100: 41% astral_power balance_of_all_things_nature(3), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord, warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos, best_friends_with_urctos_static, kindled_soul(75)
5:03.245 st Q starsurge Fluffy_Pillow 41.2/100: 41% astral_power balance_of_all_things_nature(3), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord, warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos, best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(75)
5:04.316 st S moonfire Fluffy_Pillow 5.2/100: 5% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(52), starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(70)
5:05.448 st Y wrath Fluffy_Pillow 11.2/100: 11% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(52), starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
5:06.582 st Y wrath Fluffy_Pillow 29.2/100: 29% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
5:07.715 st Q starsurge Fluffy_Pillow 45.2/100: 45% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
5:08.848 st U half_moon Fluffy_Pillow 9.2/100: 9% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
5:10.305 st V full_moon Fluffy_Pillow 37.2/100: 37% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
5:12.488 st X starsurge Fluffy_Pillow 89.2/100: 89% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
5:13.582 st X starsurge Fluffy_Pillow 53.2/100: 53% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
5:14.578 st X starsurge Fluffy_Pillow 29.2/100: 29% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
5:15.573 st W cancel_buff Fluffy_Pillow 7.2/100: 7% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
5:15.573 st Y wrath Fluffy_Pillow 7.2/100: 7% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, warrior_of_elune(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)

Stats

Level Bonus (70) Race Bonus (tauren) Raid-Buffed Unbuffed Gear Amount
Strength 898 2 986 900 0
Agility 2089 -2 2173 2087 0
Stamina 3848 2 35491 33801 29884
Intellect 2089 -2 13479 12668 9978 (6103)
Spirit 0 0 0 0 0
Health 709820 709820 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13479 12668 0
Crit 27.03% 20.82% 2847
Haste 22.93% 22.93% 3898
Versatility 6.19% 1.19% 243
Mana Regen 2560 2560 0
Attack Power 14018 13175 0
Mastery 29.05% 29.05% 7518
Armor 4485 4485 4485
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 468.00
Local Head Benevolent Embersage's Casque
ilevel: 470, stats: { 585 Armor, +3163 Sta, +655 Crit, +307 Haste, +786 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }, enchant: incandescent_essence
Local Neck Eye of the Rising Flame
ilevel: 470, stats: { +1779 Sta, +233 Haste, +1397 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Life-Bound Shoulderpads
ilevel: 460, stats: { 499 Armor, +2103 Sta, +346 Mastery, +346 Haste, +537 AgiInt }
item effects: { equip: Toxified }
Local Chest Benevolent Embersage's Robe
ilevel: 460, stats: { 727 Armor, +2804 Sta, +639 Crit, +284 Mastery, +716 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 470, stats: { 439 Armor, +2372 Sta, +497 Haste, +224 Mastery, +590 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 460, stats: { 636 Armor, +2804 Sta, +630 Haste, +293 Mastery, +716 AgiInt }, enchant: { +155 StrAgiInt, +41 Vers (lambent_armor_kit_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 470, stats: { 488 Armor, +2372 Sta, +257 Crit, +412 Haste, +590 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Thermal Bindings
ilevel: 470, stats: { 390 Armor, +1779 Sta, +178 Crit, +363 Mastery, +442 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Benevolent Embersage's Talons
ilevel: 460, stats: { 409 Armor, +2103 Sta, +202 Vers, +491 Mastery, +537 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 470, stats: { +1779 Sta, +466 Haste, +1165 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 470, stats: { +1779 Sta, +1118 Crit, +512 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 470, stats: { +747 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 470, stats: { +687 Mastery }
item effects: { use: Balefire Branch }
Local Back Drape of the Loyal Vassal
ilevel: 470, stats: { 312 Armor, +1779 Sta, +305 Haste, +236 Mastery, +442 StrAgiInt }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 470, weapon: { 508 - 654, 2.6 }, stats: { +393 Int, +1896 Int, +1581 Sta, +145 Haste, +335 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 470, stats: { +1206 Int, +1581 Sta, +162 Haste, +319 Mastery }

Talents

RowDruid Talents [31]
1
2
3
4
5
6
7
8
9
10
RowBalance Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

druid="460 T31 4p"
source=default
spec=balance
level=70
race=tauren
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:hissing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Balance APL can be found at https://balance-simc.github.io/Balance-SimC/balance.txt

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=470,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=470,gem_id=192961/192961/192961
shoulders=lifebound_shoulderpads,id=193406,bonus_id=8836/1576/8797/8960,ilevel=460,crafted_stats=49/36
back=drape_of_the_loyal_vassal,id=158375,bonus_id=4795,ilevel=470
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=460,enchant_id=6625
wrists=thermal_bindings,id=134461,bonus_id=4795,ilevel=470,gem_id=192961
hands=benevolent_embersages_talons,id=207255,bonus_id=4795,ilevel=460
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=460,enchant_id=6830
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=470
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=470
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=470
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=470,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=470

# Gear Summary
# gear_ilvl=467.50
# gear_stamina=29884
# gear_intellect=9978
# gear_crit_rating=2847
# gear_haste_rating=3898
# gear_mastery_rating=7518
# gear_versatility_rating=243
# gear_armor=4485
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

470 T31 2p : 186445 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
186444.6 186444.6 185.0 / 0.099% 26102.6 / 14.0% 14943.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.1 12.1 Astral Power 0.00% 66.5 99.9% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
470 T31 2p 186445
Astral Smolder 12317 6.6% 63.9 4.67s 57720 0 Periodic 116.4 31679 0 31679 0.0% 77.5%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 63.91 0.00 116.43 116.43 48.14 0.0000 2.0000 3688690.61 3688690.61 0.00% 15841.35 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 116.43 70 159 31678.98 8156 103845 31701.50 23556 42651 3688691 3688691 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Denizen of the Dream 0 (5420) 0.0% (2.9%) 8.5 32.06s 190980 0

Stats Details: Denizen Of The Dream

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.51 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Denizen Of The Dream

  • id:394065
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394065
  • name:Denizen of the Dream
  • school:physical
  • tooltip:
  • description:Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.
    Fey Missile 23708  / 5420 2.9% 149.1 1.74s 10902 8389 Direct 148.2 8476 17617 10970 27.3%

Stats Details: Fey Missile

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 149.15 148.23 0.00 0.00 0.00 1.2996 0.0000 1626044.61 1626044.61 0.00% 8389.11 8389.11
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.73% 107.81 23 286 8476.49 6383 14644 8467.26 7588 9688 913824 913824 0.00%
crit 27.27% 40.43 5 110 17616.54 11497 30459 17602.65 15463 21777 712221 712221 0.00%

Action Details: Fey Missile

  • id:188046
  • school:astral
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.451
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.236000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:188046
  • name:Fey Missile
  • school:astral
  • tooltip:
  • description:{$@spelldesc187875=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$188083d=30 seconds}.}

Action Priority List

    default
    [ ]:4951.03
Hungering Shadowflame 2938 1.6% 17.1 16.32s 51448 0 Direct 17.1 39993 81204 51460 27.8%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.14 17.14 0.00 0.00 0.00 0.0000 0.0000 881802.35 881802.35 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.17% 12.37 2 25 39992.77 26983 154715 39881.94 26983 109249 494624 494624 0.00%
crit 27.83% 4.77 0 15 81203.71 55045 315618 80763.04 0 285310 387179 387179 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24191.79
  • base_dd_max:24191.79
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 5597 3.0% 34.0 8.64s 49427 0 Direct 33.9 38630 78748 49549 27.2%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.96 33.87 0.00 0.00 0.00 0.0000 0.0000 1678337.06 1678337.06 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.78% 24.65 8 45 38630.18 38195 43801 38629.99 38195 39882 952403 952403 0.00%
crit 27.22% 9.22 1 22 78748.20 77919 89355 78747.44 77919 86496 725934 725934 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:34245.43
  • base_dd_max:34245.43
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 10348 5.5% 14.3 21.61s 216200 222023 Direct 14.3 7653 15854 10479 34.5%
Periodic 308.1 6902 14573 9575 34.8% 99.4%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.34 14.34 308.12 308.12 13.34 0.9738 0.9690 3100549.95 3100549.95 0.00% 9920.97 222022.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 65.54% 9.40 3 16 7652.71 5948 13786 7647.73 6674 9105 71939 71939 0.00%
crit 34.46% 4.94 0 12 15854.17 10551 28981 15804.86 0 22490 78340 78340 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 65.16% 200.75 138 274 6902.10 121 12542 6903.97 6525 7303 1385648 1385648 0.00%
crit 34.84% 107.36 66 152 14573.21 1318 25586 14579.29 13613 15611 1564623 1564623 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    st
    [K]:1.29
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [S]:13.05
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
New Moon (Talent) 0 (17180) 0.0% (9.2%) 17.0 17.97s 303369 252932

Stats Details: Moons Talent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.98 0.00 0.00 0.00 0.00 1.1994 0.0000 0.00 0.00 0.00% 252932.35 252932.35

Action Details: Moons Talent

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
    Full Moon 6216 3.3% 5.3 63.07s 353316 189856 Direct 5.3 241808 487041 355582 46.4%

Stats Details: Full Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.29 5.26 0.00 0.00 0.00 1.8611 0.0000 1868754.45 1868754.45 0.00% 189856.19 189856.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.65% 2.82 0 6 241808.44 165173 398502 236906.50 0 373127 682066 682066 0.00%
crit 46.35% 2.44 0 6 487040.96 336953 796696 464179.11 0 745785 1186689 1186689 0.00%

Action Details: Full Moon

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:50.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Action Priority List

    st
    [V]:5.35
  • if_expr:astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    New Moon 4661 2.5% 6.0 53.48s 232271 307882 Direct 6.0 151796 325157 233916 47.4%

Stats Details: New Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.00 5.96 0.00 0.00 0.00 0.7545 0.0000 1394707.14 1394707.14 0.00% 307882.37 307882.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.62% 3.14 0 7 151796.28 83263 234216 149888.71 0 209963 476276 476276 0.00%
crit 47.38% 2.82 0 7 325157.30 186842 471272 319592.40 0 471272 918431 918431 0.00%

Action Details: New Moon

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Action Priority List

    st
    [T]:6.02
  • if_expr:astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Half Moon 6303 3.4% 5.7 57.83s 332011 270426 Direct 5.6 214420 436828 333903 53.8%

Stats Details: Half Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.68 5.65 0.00 0.00 0.00 1.2277 0.0000 1886494.08 1886494.08 0.00% 270426.33 270426.33
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 46.22% 2.61 0 7 214419.68 121675 336686 208165.41 0 321479 559550 559550 0.00%
crit 53.78% 3.04 0 7 436828.25 248216 697145 431355.54 0 635835 1326944 1326944 0.00%

Action Details: Half Moon

  • id:274282
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:24.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.875000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274282
  • name:Half Moon
  • school:astral
  • tooltip:
  • description:Deals {$s1=0} Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates {$=}{{$m3=240}/10} Astral Power.|r

Action Priority List

    st
    [U]:5.71
  • if_expr:astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (16217) 0.0% (8.7%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 6062 3.3% 94.3 3.15s 19267 0 Direct 94.1 12967 27503 19319 43.7%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 94.34 94.09 0.00 0.00 0.00 0.0000 0.0000 1817636.95 1817636.95 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.32% 52.99 26 84 12967.45 8534 24728 12967.85 11451 14432 687120 687120 0.00%
crit 43.68% 41.10 19 67 27503.22 17410 49755 27510.25 24692 31900 1130517 1130517 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 6072 3.3% 94.7 3.15s 19230 0 Direct 94.4 12951 27458 19285 43.7%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 94.66 94.38 0.00 0.00 0.00 0.0000 0.0000 1820264.97 1820264.97 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.34% 53.17 20 87 12950.83 8500 24728 12952.17 11696 14470 688667 688667 0.00%
crit 43.66% 41.21 17 71 27457.99 17339 50444 27459.41 24495 31710 1131598 1131598 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 4082 2.2% 6.3 48.12s 194589 0 Direct 6.3 131013 277853 195190 43.7%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.29 6.27 0.00 0.00 0.00 0.0000 0.0000 1223846.32 1223846.32 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.30% 3.53 0 8 131013.15 85825 234708 129880.50 0 231490 462434 462434 0.00%
crit 43.70% 2.74 0 7 277853.06 175083 495515 270217.94 0 488296 761412 761412 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 5047 2.7% 26.1 11.60s 58143 64566 Direct 27.1 39491 80406 55986 40.3%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.08 27.08 0.00 0.00 0.00 0.9005 0.0000 1516139.15 1516139.15 0.00% 64566.01 64566.01
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.67% 16.16 5 29 39491.33 17653 68571 39499.08 31802 45564 637993 637993 0.00%
crit 40.33% 10.92 2 22 80405.85 36012 138243 80394.49 57271 98615 878146 878146 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    st
    [L]:1.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
    st
    [P]:25.14
  • if_expr:variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Warrior of Elune2024251-1.000Spell DataNo-stacks
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Starsurge 59194 (79958) 31.7% (42.9%) 114.9 2.59s 208340 209513 Direct 114.7 (152.4) 105824 222967 154562 41.6% (42.1%)

Stats Details: Starsurge

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 114.93 114.69 0.00 0.00 0.00 0.9944 0.0000 17726447.00 17726447.00 0.00% 209513.43 209513.43
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.39% 66.97 42 99 105824.03 78019 196566 105844.52 98866 114769 7087084 7087084 0.00%
crit 41.61% 47.72 24 72 222967.10 159159 400995 223074.39 203135 245174 10639363 10639363 0.00%

Action Details: Starsurge

  • id:78674
  • school:astral
  • range:45.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:36.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.455000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.18

Spelldata

  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$s1=0} Astral damage.

Action Priority List

    st
    [Q]:84.56
  • if_expr:variable.starsurge_condition1
    st
    [X]:30.37
  • if_expr:variable.starsurge_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Flat Cost Incarnation: Chosen of Elune1025603-8.000Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Goldrinn's Fang 20764 11.1% 37.9 7.77s 163907 0 Direct 37.8 111334 234092 164691 43.5%

Stats Details: Goldrinns Fang

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.94 37.76 0.00 0.00 0.00 0.0000 0.0000 6218214.67 6218214.67 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.54% 21.35 5 41 111333.77 81581 202732 111341.83 96740 132788 2376591 2376591 0.00%
crit 43.46% 16.41 5 33 234091.99 166425 419303 234209.81 200576 281558 3841624 3841624 0.00%

Action Details: Goldrinns Fang

  • id:394047
  • school:astral
  • range:60.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.852000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10

Spelldata

  • id:394047
  • name:Goldrinn's Fang
  • school:astral
  • tooltip:Deals {$m1=0} Arcane damage.
  • description:Deals {$m1=0} Arcane damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountPower of Goldrinn3940462PCT1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Friend of the Fae39408310.100Spell Data
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Incarnation: Chosen of Elune10256020.100Spell Data
Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Dot / Debuff on Target Moonfire16481250.283Mastery
Sunfire16481550.283Mastery
Waning Twilight39395710.100
Sunfire 10203 5.5% 17.4 18.04s 175885 180041 Direct 17.4 7501 15494 10550 38.1%
Periodic 309.1 6659 13753 9303 37.3% 99.7%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.39 17.39 309.08 309.08 16.39 0.9769 0.9690 3058904.75 3058904.75 0.00% 9664.97 180041.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.86% 10.76 3 19 7501.41 4702 12915 7493.46 6185 8633 80710 80710 0.00%
crit 38.14% 6.63 0 15 15494.25 9592 25596 15488.47 0 20397 102781 102781 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 62.73% 193.88 133 257 6658.65 2385 11402 6657.57 6308 7019 1291005 1291005 0.00%
crit 37.27% 115.20 75 163 13753.25 3984 23260 13752.98 12943 14686 1584408 1584408 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    st
    [J]:1.57
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [R]:15.82
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (3112) 0.0% (1.7%) 8.5 31.36s 110003 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.49 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 1618 0.9% 8.5 31.36s 57207 0 Direct 8.5 44617 90989 57217 27.1%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.49 8.49 0.00 0.00 0.00 0.0000 0.0000 485743.65 485743.65 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.85% 6.19 0 17 44617.46 44081 50551 44600.15 0 50551 276013 276013 0.00%
crit 27.15% 2.30 0 9 90989.32 89925 103124 82403.30 0 103124 209731 209731 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:39522.22
  • base_dd_max:39522.22
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 1494 0.8% 16.4 15.24s 27270 0 Direct 16.4 21217 43271 27271 27.4%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.44 16.44 0.00 0.00 0.00 0.0000 0.0000 448301.59 448301.59 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.55% 11.93 1 30 21216.91 20975 24054 21216.08 20975 22631 253065 253065 0.00%
crit 27.45% 4.51 0 17 43271.29 42790 49070 42764.93 0 49070 195237 195237 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18805.57
  • base_dd_max:18805.57
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 18107 9.7% 115.1 2.54s 47135 49521 Direct 114.7 31381 65852 47307 46.2%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 115.12 114.70 0.00 0.00 0.00 0.9518 0.0000 5426097.20 5426097.20 0.00% 49521.29 49521.29
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.80% 61.71 33 91 31381.16 13038 97878 31380.40 28096 35101 1936484 1936484 0.00%
crit 46.20% 52.99 30 81 65852.49 26597 200900 65864.66 57562 74132 3489614 3489614 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    st
    [M]:0.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
    st
    [Y]:113.43

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.400Spell Data
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
470 T31 2p
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31 2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31 2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31 2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 183.85s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    st
    [N]:2.00
  • if_expr:variable.cd_condition_st

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.7 63.61s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.66 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31 2p
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:57075.72
  • base_dd_max:57075.72
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.36s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31 2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.74
Elemental Potion of Ultimate Power 1.5 308.01s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.47
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
Warrior of Elune 6.1 48.43s

Stats Details: Warrior Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.14 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Warrior Of Elune

  • id:202425
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202425
  • name:Warrior of Elune
  • school:arcane
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.

Action Priority List

    st
    [O]:6.14
  • if_expr:variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 8.7 1.5 36.3s 33.9s 8.6s 24.88% 28.78% 1.5 (7.0) 8.5

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.5s
  • trigger_min/max:3.8s / 50.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:22.01% / 27.80%

Stack Uptimes

  • balance_of_all_things_arcane_1:2.86%
  • balance_of_all_things_arcane_2:2.92%
  • balance_of_all_things_arcane_3:2.99%
  • balance_of_all_things_arcane_4:3.02%
  • balance_of_all_things_arcane_5:3.03%
  • balance_of_all_things_arcane_6:3.28%
  • balance_of_all_things_arcane_7:3.38%
  • balance_of_all_things_arcane_8:3.39%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 18.0 3.5 17.0s 14.1s 8.4s 50.42% 54.54% 3.5 (20.1) 17.4

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 50.9s
  • trigger_min/max:0.0s / 40.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.9s
  • uptime_min/max:46.26% / 54.04%

Stack Uptimes

  • balance_of_all_things_nature_1:5.84%
  • balance_of_all_things_nature_2:5.94%
  • balance_of_all_things_nature_3:6.06%
  • balance_of_all_things_nature_4:6.17%
  • balance_of_all_things_nature_5:6.33%
  • balance_of_all_things_nature_6:6.49%
  • balance_of_all_things_nature_7:6.68%
  • balance_of_all_things_nature_8:6.92%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Best Friends with Aerwynn 2.8 0.0 70.5s 70.5s 10.8s 10.15% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 346.5s
  • trigger_min/max:12.0s / 346.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 36.32%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.91%
  • best_friends_with_aerwynn_2:0.91%
  • best_friends_with_aerwynn_3:0.91%
  • best_friends_with_aerwynn_4:0.92%
  • best_friends_with_aerwynn_5:0.92%
  • best_friends_with_aerwynn_6:0.92%
  • best_friends_with_aerwynn_7:0.93%
  • best_friends_with_aerwynn_8:0.93%
  • best_friends_with_aerwynn_9:0.93%
  • best_friends_with_aerwynn_10:0.94%
  • best_friends_with_aerwynn_11:0.94%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 114.2s 70.5s 45.8s 33.78% 0.00% 70.1 (70.1) 0.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:13.5s / 352.5s
  • trigger_min/max:12.0s / 346.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 289.7s
  • uptime_min/max:0.00% / 96.18%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.78%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.8s 70.8s 10.8s 9.90% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 318.1s
  • trigger_min/max:12.0s / 318.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 34.13%

Stack Uptimes

  • best_friends_with_pip_1:0.89%
  • best_friends_with_pip_2:0.89%
  • best_friends_with_pip_3:0.89%
  • best_friends_with_pip_4:0.89%
  • best_friends_with_pip_5:0.90%
  • best_friends_with_pip_6:0.90%
  • best_friends_with_pip_7:0.90%
  • best_friends_with_pip_8:0.91%
  • best_friends_with_pip_9:0.91%
  • best_friends_with_pip_10:0.91%
  • best_friends_with_pip_11:0.92%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 114.3s 70.8s 45.5s 32.91% 0.00% 68.6 (68.6) 0.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 348.7s
  • trigger_min/max:12.0s / 318.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 271.6s
  • uptime_min/max:0.00% / 95.79%

Stack Uptimes

  • best_friends_with_pip_static_1:32.91%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 70.6s 70.6s 10.8s 10.05% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 339.2s
  • trigger_min/max:12.0s / 339.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 31.04%

Stack Uptimes

  • best_friends_with_urctos_1:0.90%
  • best_friends_with_urctos_2:0.90%
  • best_friends_with_urctos_3:0.90%
  • best_friends_with_urctos_4:0.91%
  • best_friends_with_urctos_5:0.91%
  • best_friends_with_urctos_6:0.91%
  • best_friends_with_urctos_7:0.92%
  • best_friends_with_urctos_8:0.92%
  • best_friends_with_urctos_9:0.92%
  • best_friends_with_urctos_10:0.93%
  • best_friends_with_urctos_11:0.93%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 114.1s 70.6s 45.5s 33.31% 0.00% 69.2 (69.2) 0.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 339.2s
  • trigger_min/max:12.0s / 339.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 303.2s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.31%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.51% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.51%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.8 0.0 62.7s 58.9s 50.6s 80.34% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 343.0s
  • trigger_min/max:15.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 356.9s
  • uptime_min/max:45.03% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.34%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Denizen of the Dream 8.5 0.0 45.1s 32.0s 41.2s 57.15% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_denizen_of_the_dream
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 261.0s
  • trigger_min/max:0.0s / 139.8s
  • trigger_pct:99.98%
  • duration_min/max:0.0s / 206.3s
  • uptime_min/max:22.32% / 93.62%

Stack Uptimes

  • denizen_of_the_dream_1:38.48%
  • denizen_of_the_dream_2:14.41%
  • denizen_of_the_dream_3:3.54%
  • denizen_of_the_dream_4:0.65%
  • denizen_of_the_dream_5:0.10%
  • denizen_of_the_dream_6:0.03%
  • denizen_of_the_dream_7:0.00%

Spelldata

  • id:394076
  • name:Denizen of the Dream
  • tooltip:
  • description:{$@spelldesc394065=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Dreamstate 15.5 0.4 20.0s 20.7s 3.1s 16.04% 21.34% 0.4 (0.7) 0.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 56.2s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.1s
  • uptime_min/max:9.95% / 26.98%

Stack Uptimes

  • dreamstate_1:9.66%
  • dreamstate_2:6.38%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 7.1 1.0 45.4s 45.0s 20.6s 49.21% 52.47% 1.0 (1.0) 6.8

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.5s
  • trigger_min/max:12.0s / 90.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:44.09% / 56.11%

Stack Uptimes

  • eclipse_lunar_1:49.21%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 13.8 5.7 22.5s 15.7s 20.2s 92.64% 95.98% 5.7 (5.7) 12.9

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 62.1s
  • trigger_min/max:0.0s / 55.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 61.2s
  • uptime_min/max:90.59% / 94.95%

Stack Uptimes

  • eclipse_solar_1:92.64%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 307.0s 307.0s 27.3s 13.18% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.1s
  • trigger_min/max:300.0s / 328.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.90% / 17.99%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.18%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Friend of the Fae 5.2 3.3 55.5s 32.0s 24.9s 43.37% 43.31% 3.3 (3.3) 4.8

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_friend_of_the_fae
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 165.8s
  • trigger_min/max:0.0s / 139.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 109.6s
  • uptime_min/max:14.88% / 78.65%

Stack Uptimes

  • friend_of_the_fae_1:43.37%

Spelldata

  • id:394083
  • name:Friend of the Fae
  • tooltip:Arcane and Nature damage increased by {$=}w1%.
  • description:{$@spelldesc394081=When a Faerie Dragon is summoned, your spells deal {$394083m1=10}% increased damage for {$394083d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 7.1 0.0 45.0s 45.0s 20.3s 48.29% 51.20% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.5s
  • trigger_min/max:12.0s / 90.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:43.34% / 54.98%

Stack Uptimes

  • incarnation_chosen_of_elune_1:48.29%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.6 0.0 99.8s 99.8s 19.5s 23.26% 0.00% 0.0 (0.0) 3.2

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:55.09

Trigger Details

  • interval_min/max:90.0s / 126.4s
  • trigger_min/max:90.0s / 126.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.21% / 26.10%

Stack Uptimes

  • kindled_soul_5:1.10%
  • kindled_soul_10:1.14%
  • kindled_soul_15:1.14%
  • kindled_soul_20:1.15%
  • kindled_soul_25:1.15%
  • kindled_soul_30:1.15%
  • kindled_soul_35:1.15%
  • kindled_soul_40:1.16%
  • kindled_soul_45:1.16%
  • kindled_soul_50:1.16%
  • kindled_soul_55:1.17%
  • kindled_soul_60:1.17%
  • kindled_soul_65:1.17%
  • kindled_soul_70:1.17%
  • kindled_soul_75:1.18%
  • kindled_soul_80:1.18%
  • kindled_soul_85:1.18%
  • kindled_soul_90:1.19%
  • kindled_soul_95:1.19%
  • kindled_soul_100:1.19%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Grace 12.9 0.0 20.7s 20.7s 5.9s 25.35% 0.00% 0.0 (0.0) 12.6

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.8s / 62.5s
  • trigger_min/max:12.8s / 62.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:19.30% / 29.63%

Stack Uptimes

  • natures_grace_1:25.35%

Spelldata

  • id:393959
  • name:Nature's Grace
  • tooltip:Haste increased by {$s1=10}%.
  • description:{$@spelldesc393958=After an Eclipse ends, you gain {$393959s1=10}% Haste for {$393959d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Vigil 3.7 0.0 90.3s 90.3s 14.8s 18.41% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.9s
  • trigger_min/max:90.0s / 91.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.54% / 21.01%

Stack Uptimes

  • natures_vigil_1:18.41%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.4 0.1 74.8s 68.9s 7.7s 6.16% 6.82% 0.1 (0.1) 1.3

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 334.1s
  • trigger_min/max:0.0s / 334.1s
  • trigger_pct:14.77%
  • duration_min/max:0.0s / 27.8s
  • uptime_min/max:0.00% / 27.25%

Stack Uptimes

  • owlkin_frenzy_1:6.16%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 8.1 107.8 38.9s 38.9s 34.8s 93.93% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:24.6s / 50.3s
  • trigger_min/max:24.6s / 50.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 48.0s
  • uptime_min/max:90.97% / 96.48%

Stack Uptimes

  • primordial_arcanic_pulsar_4:4.98%
  • primordial_arcanic_pulsar_8:5.54%
  • primordial_arcanic_pulsar_12:6.56%
  • primordial_arcanic_pulsar_16:6.97%
  • primordial_arcanic_pulsar_20:6.39%
  • primordial_arcanic_pulsar_24:6.06%
  • primordial_arcanic_pulsar_28:7.97%
  • primordial_arcanic_pulsar_32:7.99%
  • primordial_arcanic_pulsar_36:6.60%
  • primordial_arcanic_pulsar_40:7.15%
  • primordial_arcanic_pulsar_44:6.94%
  • primordial_arcanic_pulsar_48:7.08%
  • primordial_arcanic_pulsar_52:7.22%
  • primordial_arcanic_pulsar_56:6.47%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 18.5 4.0 16.7s 14.1s 6.4s 39.57% 39.81% 4.0 (4.0) 18.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 49.3s
  • trigger_min/max:0.0s / 40.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.7s
  • uptime_min/max:36.71% / 41.83%

Stack Uptimes

  • solstice_1:39.57%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 20.8 94.2 14.7s 2.6s 14.1s 97.26% 0.00% 53.1 (53.1) 7.5

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 19.9s
  • trigger_min/max:0.8s / 10.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:94.00% / 99.09%

Stack Uptimes

  • starlord_1:9.55%
  • starlord_2:15.47%
  • starlord_3:72.25%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Wafting Devotion 4.3 1.2 60.8s 45.4s 16.5s 23.73% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 219.0s
  • trigger_min/max:0.0s / 210.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 81.8s
  • uptime_min/max:5.24% / 53.26%

Stack Uptimes

  • wafting_devotion_1:23.73%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Warrior of Elune 6.1 0.0 48.3s 48.3s 22.0s 44.84% 43.88% 0.0 (0.0) 2.4

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_warrior_of_elune
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:45.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 81.9s
  • trigger_min/max:45.0s / 81.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s
  • uptime_min/max:33.97% / 51.15%

Stack Uptimes

  • warrior_of_elune_1:21.94%
  • warrior_of_elune_2:4.82%
  • warrior_of_elune_3:18.08%

Spelldata

  • id:202425
  • name:Warrior of Elune
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.
  • max_stacks:0
  • duration:25.00
  • cooldown:45.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Denizen of the Dream 8.5 2.0 21.0 32.0s 0.0s 139.8s
Primordial Arcanic Pulsar 7.1 6.0 9.0 40.6s 29.9s 50.1s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.07% 0.00% 1.50% 0.5s 0.0s 2.6s
Astral Smolder 77.84% 56.66% 92.68% 14.8s 0.0s 102.0s
Incarnation (Total) 48.29% 43.34% 54.98% 20.3s 0.0s 54.0s
Incarnation (Pulsar) 28.03% 26.05% 30.46% 11.8s 0.0s 12.0s
Lunar Eclipse Only 0.92% 0.72% 1.14% 2.7s 2.6s 2.7s
Solar Eclipse Only 44.35% 36.48% 50.30% 10.8s 0.0s 15.0s
No Eclipse 6.42% 3.79% 8.65% 1.5s 0.0s 3.5s
Friend of the Fae 43.37% 14.88% 78.65% 24.9s 0.0s 109.6s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Warrior of Elune7.0590.00036.90343.44926.27971.938
Full Moon
New Moon
Half Moon		0.3490.00020.2725.9345.34425.973

Eclipse Utilization

NoneSolarLunarBoth
Wrath5.104.5%56.1749.7%0.000.0%51.8445.8%
Starfire25.0792.6%0.000.0%2.007.4%0.000.0%
Starsurge0.000.0%46.3540.3%0.000.0%68.5859.7%
New Moon0.040.7%0.183.0%0.000.0%5.7996.4%
Half Moon0.000.1%0.346.0%0.000.0%5.3493.9%
Full Moon0.221.9%3.1727.4%0.070.6%8.1270.1%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
470 T31 2p
Nature's BalanceAstral Power99.51198.915.49%2.000.100.05%
Full MoonAstral Power5.29264.137.29%49.950.240.09%
Half MoonAstral Power5.68136.423.76%24.000.000.00%
MoonfireAstral Power14.3485.982.37%6.000.050.06%
New MoonAstral Power6.0072.061.99%12.000.000.00%
Orbit BreakerAstral Power6.29187.675.18%29.840.980.52%
Shooting Stars (Moonfire)Astral Power94.33188.495.20%2.000.180.09%
Shooting Stars (Sunfire)Astral Power94.65189.115.22%2.000.190.10%
StarfireAstral Power27.07397.5710.97%14.692.600.65%
SunfireAstral Power17.39104.332.88%6.000.010.01%
WrathAstral Power115.131799.3949.65%15.630.000.00%
Usage Type Count Total Tot% Avg RPE APR
470 T31 2p
StarsurgeAstral Power 115.653652.33100.00%31.5831.786556.00
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 736200.0 3296.73 3898.58 1388592.9 555630.7 -229541.5 736200.0
Astral Power 70.0 12.08 12.10 4.4 24.3 0.0 100.0

Statistics & Data Analysis

Fight Length
470 T31 2p Fight Length
Count 5142
Mean 300.02
Minimum 240.02
Maximum 359.98
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.99%
Standard Deviation 34.5948
5th Percentile 246.35
95th Percentile 354.17
( 95th Percentile - 5th Percentile ) 107.82
Mean Distribution
Standard Deviation 0.4824
95.00% Confidence Interval ( 299.08 - 300.97 )
Normalized 95.00% Confidence Interval ( 99.68% - 100.32% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 511
0.1% Error 51075
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1022
DPS
470 T31 2p Damage Per Second
Count 5142
Mean 186444.65
Minimum 162776.01
Maximum 218708.04
Spread ( max - min ) 55932.04
Range [ ( max - min ) / 2 * 100% ] 15.00%
Standard Deviation 6767.1549
5th Percentile 175899.54
95th Percentile 197986.66
( 95th Percentile - 5th Percentile ) 22087.12
Mean Distribution
Standard Deviation 94.3713
95.00% Confidence Interval ( 186259.68 - 186629.61 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5061
0.1 Scale Factor Error with Delta=300 390928
0.05 Scale Factor Error with Delta=300 1563709
0.01 Scale Factor Error with Delta=300 39092722
Priority Target DPS
470 T31 2p Priority Target Damage Per Second
Count 5142
Mean 186444.65
Minimum 162776.01
Maximum 218708.04
Spread ( max - min ) 55932.04
Range [ ( max - min ) / 2 * 100% ] 15.00%
Standard Deviation 6767.1549
5th Percentile 175899.54
95th Percentile 197986.66
( 95th Percentile - 5th Percentile ) 22087.12
Mean Distribution
Standard Deviation 94.3713
95.00% Confidence Interval ( 186259.68 - 186629.61 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5061
0.1 Scale Factor Error with Delta=300 390928
0.05 Scale Factor Error with Delta=300 1563709
0.01 Scale Factor Error with Delta=300 39092722
DPS(e)
470 T31 2p Damage Per Second (Effective)
Count 5142
Mean 186444.65
Minimum 162776.01
Maximum 218708.04
Spread ( max - min ) 55932.04
Range [ ( max - min ) / 2 * 100% ] 15.00%
Damage
470 T31 2p Damage
Count 5142
Mean 54240931.89
Minimum 41045802.25
Maximum 69338876.40
Spread ( max - min ) 28293074.15
Range [ ( max - min ) / 2 * 100% ] 26.08%
DTPS
470 T31 2p Damage Taken Per Second
Count 5142
Mean 3900.40
Minimum 1204.22
Maximum 7671.99
Spread ( max - min ) 6467.77
Range [ ( max - min ) / 2 * 100% ] 82.91%
HPS
470 T31 2p Healing Per Second
Count 5142
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
470 T31 2p Healing Per Second (Effective)
Count 5142
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
470 T31 2p Heal
Count 5142
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
470 T31 2p Healing Taken Per Second
Count 5142
Mean 3288.68
Minimum 830.11
Maximum 6250.17
Spread ( max - min ) 5420.06
Range [ ( max - min ) / 2 * 100% ] 82.40%
TMI
470 T31 2p Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
470 T31 2pTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
470 T31 2p Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.47 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.59 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.74 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.st
# count action,conditions
J 1.57 sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
K 1.29 moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
0.00 starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
0.00 starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
L 1.00 starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
M 0.00 wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
0.00 celestial_alignment,if=variable.cd_condition_st
N 2.00 incarnation,if=variable.cd_condition_st
0.00 variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
0.00 variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
O 6.14 warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
P 25.14 starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
0.00 wrath,if=variable.enter_eclipse
0.00 variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
0.00 convoke_the_spirits,if=variable.convoke_condition
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+55
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 starfall,if=buff.starweavers_warp.up
0.00 variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
Q 84.56 starsurge,if=variable.starsurge_condition1
R 15.82 sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
S 13.05 moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
T 6.02 new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
U 5.71 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
V 5.35 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
W 12.33 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
X 30.37 starsurge,if=variable.starsurge_condition2
Y 113.43 wrath
Z 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFJKLNDEQQQTQUQVYXYYRXYXYSWQQYQYYYYXYTOXYXXYXRYWQQQYYYYXSYXYXYXPPYWQQRYQYYYYXYPPSQQYQUQQRQOVYXWQYPPQQYSYQRYYYFWQQYYPPQQYYQYYRSQYQETUQYQYQYOYYXYPPQQQJYSYYYXYYXXYPPQRYQYYQYYYSYXPPQQRQVQQOTYYXYXPPYWQQSYQRYYYYFXXYNUQYQQVQQQRSYYYWQQEYQYYYYXTXYYXRYQQQSYYOYYXXXYYPPWQQQRUQQYYYSXYPPWQQYYQRYYYYXXYPPQSQVQYROTX

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask 470 T31 2p 50.0/100: 50% astral_power
Pre precombat 1 food 470 T31 2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 2 augmentation 470 T31 2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 4 no_cd_talent 470 T31 2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 5 on_use_trinket 470 T31 2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 6 on_use_trinket 470 T31 2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 7 on_use_trinket 470 T31 2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 60.0/100: 60% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil 470 T31 2p 50.0/100: 50% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.000 st J sunfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.940 st K moonfire Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:01.881 st L starfire Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, corrupting_rage
0:02.729 st N incarnation_chosen_of_elune Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, corrupting_rage
0:02.729 default D potion Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), corrupting_rage
0:02.729 default E use_items Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power
0:02.729 st Q starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:03.585 st Q starsurge Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:04.407 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:05.200 st T new_moon Fluffy_Pillow 12.0/100: 12% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:05.955 st Q starsurge Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:06.721 st U half_moon Fluffy_Pillow 4.0/100: 4% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:07.739 st Q starsurge Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:08.504 st V full_moon Fluffy_Pillow 4.0/100: 4% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), solstice, starlord(3), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:10.031 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), dreamstate, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:10.785 st X starsurge Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), dreamstate, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:11.549 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:12.303 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:13.066 st R sunfire Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:13.831 st X starsurge Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:14.596 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:15.360 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:16.124 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:16.888 st S moonfire Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.652 st W cancel_buff Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.652 st Q starsurge Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:18.507 st Q starsurge Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:19.330 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:20.122 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:20.913 st Y wrath Fluffy_Pillow 14.0/100: 14% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:21.678 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:22.443 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:23.207 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:23.972 st X starsurge Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:24.736 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:25.499 st T new_moon Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:26.460 st O warrior_of_elune Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:26.460 st X starsurge Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:27.224 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:27.989 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:28.753 st X starsurge Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:29.518 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:30.282 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:31.045 st R sunfire Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:31.810 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:32.575 st W cancel_buff Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:32.575 st Q starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, warrior_of_elune(3), best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:33.367 st Q starsurge Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord, warrior_of_elune(3), best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:34.131 st Q starsurge Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(2), warrior_of_elune(3), best_friends_with_urctos(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:34.885 st Y wrath Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:35.641 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:36.395 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:37.147 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:37.901 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:38.655 st S moonfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:39.410 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:40.164 st X starsurge Fluffy_Pillow 74.0/100: 74% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:41.083 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:42.001 st X starsurge Fluffy_Pillow 66.0/100: 66% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:42.919 st Y wrath Fluffy_Pillow 38.0/100: 38% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:43.838 st X starsurge Fluffy_Pillow 56.0/100: 56% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:44.755 st P starfire Fluffy_Pillow 28.0/100: 28% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:45.510 st P starfire Fluffy_Pillow 48.8/100: 49% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:46.264 st Y wrath Fluffy_Pillow 65.6/100: 66% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:47.182 st W cancel_buff Fluffy_Pillow 81.6/100: 82% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:47.182 st Q starsurge Fluffy_Pillow 81.6/100: 82% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, warrior_of_elune, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:48.212 st Q starsurge Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord, warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
0:49.281 st R sunfire Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
0:50.311 st Y wrath Fluffy_Pillow 23.6/100: 24% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
0:51.341 st Q starsurge Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
0:52.474 st Y wrath Fluffy_Pillow 5.6/100: 6% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos_static, corrupting_rage
0:53.567 st Y wrath Fluffy_Pillow 21.6/100: 22% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos_static, corrupting_rage
0:54.659 st Y wrath Fluffy_Pillow 39.6/100: 40% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, corrupting_rage
0:55.751 st Y wrath Fluffy_Pillow 55.6/100: 56% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage
0:56.844 st X starsurge Fluffy_Pillow 75.6/100: 76% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage
0:57.935 st Y wrath Fluffy_Pillow 41.6/100: 42% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, corrupting_rage
0:59.025 st P starfire Fluffy_Pillow 57.6/100: 58% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, corrupting_rage
1:00.661 st P starfire Fluffy_Pillow 71.6/100: 72% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(48), starlord(3), dreamstate, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, corrupting_rage
1:01.554 st S moonfire Fluffy_Pillow 83.6/100: 84% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), dreamstate, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, corrupting_rage
1:02.549 st Q starsurge Fluffy_Pillow 93.6/100: 94% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, dreamstate, best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, corrupting_rage
1:03.661 st Q starsurge Fluffy_Pillow 63.6/100: 64% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord, dreamstate, best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, corrupting_rage
1:04.727 st Y wrath Fluffy_Pillow 31.6/100: 32% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(2), best_friends_with_aerwynn, best_friends_with_aerwynn_static, corrupting_rage
1:05.482 st Q starsurge Fluffy_Pillow 47.6/100: 48% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(2), best_friends_with_aerwynn, best_friends_with_aerwynn_static, corrupting_rage
1:06.511 st U half_moon Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_aerwynn_static, corrupting_rage
1:07.832 st Q starsurge Fluffy_Pillow 77.6/100: 78% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_aerwynn_static, corrupting_rage
1:08.824 st Q starsurge Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_aerwynn_static, corrupting_rage
1:09.816 st R sunfire Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(3), best_friends_with_aerwynn_static, corrupting_rage
1:10.810 st Q starsurge Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(3), best_friends_with_aerwynn_static, corrupting_rage
1:11.803 st O warrior_of_elune Fluffy_Pillow 11.6/100: 12% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
1:11.803 st V full_moon Fluffy_Pillow 11.6/100: 12% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage
1:13.784 st Y wrath Fluffy_Pillow 63.6/100: 64% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage
1:14.777 st X starsurge Fluffy_Pillow 81.6/100: 82% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage
1:15.769 st W cancel_buff Fluffy_Pillow 55.6/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage
1:15.769 st Q starsurge Fluffy_Pillow 55.6/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage
1:16.881 st Y wrath Fluffy_Pillow 27.6/100: 28% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(20), starlord, warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage
1:17.950 st P starfire Fluffy_Pillow 37.6/100: 38% astral_power natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(20), starlord, warrior_of_elune(3), dreamstate, best_friends_with_aerwynn_static, corrupting_rage
1:18.704 st P starfire Fluffy_Pillow 56.4/100: 56% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord, warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage
1:19.458 st Q starsurge Fluffy_Pillow 73.2/100: 73% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord, warrior_of_elune(2), best_friends_with_aerwynn_static, corrupting_rage
1:20.526 st Q starsurge Fluffy_Pillow 41.2/100: 41% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), warrior_of_elune(2), best_friends_with_aerwynn_static, corrupting_rage
1:21.557 st Y wrath Fluffy_Pillow 7.2/100: 7% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune(2), best_friends_with_aerwynn_static, corrupting_rage
1:22.550 st S moonfire Fluffy_Pillow 25.2/100: 25% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune(2), best_friends_with_aerwynn_static, corrupting_rage
1:23.544 st Y wrath Fluffy_Pillow 35.2/100: 35% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune(2), best_friends_with_aerwynn_static, corrupting_rage
1:24.634 st Q starsurge Fluffy_Pillow 55.2/100: 55% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune(2), best_friends_with_aerwynn_static, corrupting_rage
1:25.727 st R sunfire Fluffy_Pillow 19.2/100: 19% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), best_friends_with_aerwynn_static, corrupting_rage
1:26.819 st Y wrath Fluffy_Pillow 25.2/100: 25% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), best_friends_with_aerwynn_static, corrupting_rage
1:27.910 st Y wrath Fluffy_Pillow 43.2/100: 43% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), best_friends_with_aerwynn_static, corrupting_rage
1:29.002 st Y wrath Fluffy_Pillow 59.2/100: 59% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), best_friends_with_aerwynn_static, corrupting_rage
1:30.094 default F natures_vigil 470 T31 2p 77.2/100: 77% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), best_friends_with_aerwynn_static, corrupting_rage
1:30.094 st W cancel_buff Fluffy_Pillow 77.2/100: 77% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), best_friends_with_aerwynn_static, corrupting_rage
1:30.094 st Q starsurge Fluffy_Pillow 77.2/100: 77% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(32), warrior_of_elune(2), best_friends_with_aerwynn_static, corrupting_rage
1:31.317 st Q starsurge Fluffy_Pillow 41.2/100: 41% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(36), starlord, warrior_of_elune(2), best_friends_with_aerwynn_static, corrupting_rage
1:32.491 st Y wrath Fluffy_Pillow 5.2/100: 5% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune(2), best_friends_with_aerwynn_static, corrupting_rage
1:33.625 st Y wrath Fluffy_Pillow 23.2/100: 23% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune(2), best_friends_with_aerwynn_static, corrupting_rage
1:34.756 st P starfire Fluffy_Pillow 35.2/100: 35% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune(2), dreamstate, best_friends_with_aerwynn_static, corrupting_rage
1:35.510 st P starfire Fluffy_Pillow 54.0/100: 54% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, best_friends_with_aerwynn_static, corrupting_rage
1:36.267 st Q starsurge Fluffy_Pillow 72.8/100: 73% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), best_friends_with_aerwynn_static, corrupting_rage
1:37.297 st Q starsurge Fluffy_Pillow 38.8/100: 39% astral_power natures_vigil, balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_aerwynn_static, corrupting_rage
1:38.289 st Y wrath Fluffy_Pillow 4.8/100: 5% astral_power natures_vigil, balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_aerwynn_static, corrupting_rage
1:39.281 st Y wrath Fluffy_Pillow 22.8/100: 23% astral_power natures_vigil, balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_aerwynn_static, corrupting_rage
1:40.272 st Q starsurge Fluffy_Pillow 42.8/100: 43% astral_power natures_vigil, balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_aerwynn_static, corrupting_rage
1:41.361 st Y wrath Fluffy_Pillow 6.8/100: 7% astral_power natures_vigil, balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), best_friends_with_aerwynn_static, corrupting_rage
1:42.454 st Y wrath Fluffy_Pillow 26.8/100: 27% astral_power natures_vigil, balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
1:43.547 st R sunfire Fluffy_Pillow 44.8/100: 45% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
1:44.639 st S moonfire Fluffy_Pillow 52.8/100: 53% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
1:45.732 st Q starsurge Fluffy_Pillow 60.8/100: 61% astral_power eclipse_solar, primordial_arcanic_pulsar(52), best_friends_with_aerwynn_static, corrupting_rage
1:46.952 st Y wrath Fluffy_Pillow 24.8/100: 25% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord, best_friends_with_aerwynn_static, corrupting_rage
1:48.126 st Q starsurge Fluffy_Pillow 42.8/100: 43% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
1:49.215 default E use_items Fluffy_Pillow 6.8/100: 7% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
1:49.215 st T new_moon Fluffy_Pillow 6.8/100: 7% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(100)
1:49.970 st U half_moon Fluffy_Pillow 18.8/100: 19% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(100)
1:51.239 st Q starsurge Fluffy_Pillow 46.8/100: 47% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(2), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(90)
1:52.191 st Y wrath Fluffy_Pillow 20.8/100: 21% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(90)
1:53.109 st Q starsurge Fluffy_Pillow 38.8/100: 39% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(85)
1:54.028 st Y wrath Fluffy_Pillow 12.8/100: 13% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(80)
1:54.945 st Q starsurge Fluffy_Pillow 28.8/100: 29% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(75)
1:55.863 st Y wrath Fluffy_Pillow 0.8/100: 1% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(70)
1:56.782 st O warrior_of_elune Fluffy_Pillow 16.8/100: 17% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(65)
1:56.803 st Y wrath Fluffy_Pillow 16.8/100: 17% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(65)
1:57.720 st Y wrath Fluffy_Pillow 36.8/100: 37% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(60)
1:58.638 st X starsurge Fluffy_Pillow 52.8/100: 53% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(55)
1:59.555 st Y wrath Fluffy_Pillow 26.8/100: 27% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(50)
2:00.473 st P starfire Fluffy_Pillow 38.8/100: 39% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(45)
2:01.227 st P starfire Fluffy_Pillow 55.6/100: 56% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), warrior_of_elune(2), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(40)
2:01.981 st Q starsurge Fluffy_Pillow 76.4/100: 76% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), solstice, warrior_of_elune, best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(40)
2:03.009 st Q starsurge Fluffy_Pillow 44.4/100: 44% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord, warrior_of_elune, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(35)
2:03.999 st Q starsurge Fluffy_Pillow 40.4/100: 40% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), warrior_of_elune, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(30)
2:04.952 st J sunfire Fluffy_Pillow 4.4/100: 4% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(25)
2:05.869 st Y wrath Fluffy_Pillow 10.4/100: 10% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(20)
2:06.787 st S moonfire Fluffy_Pillow 30.4/100: 30% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(15)
2:07.797 st Y wrath Fluffy_Pillow 36.4/100: 36% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(10)
2:08.806 st Y wrath Fluffy_Pillow 52.4/100: 52% astral_power balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(5)
2:09.816 st Y wrath Fluffy_Pillow 72.4/100: 72% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:10.827 st X starsurge Fluffy_Pillow 88.4/100: 88% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:11.837 st Y wrath Fluffy_Pillow 52.4/100: 52% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:12.846 st Y wrath Fluffy_Pillow 70.4/100: 70% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, best_friends_with_aerwynn, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:13.857 st X starsurge Fluffy_Pillow 86.4/100: 86% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:14.868 st X starsurge Fluffy_Pillow 50.4/100: 50% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:15.880 st Y wrath Fluffy_Pillow 18.4/100: 18% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:16.892 st P starfire Fluffy_Pillow 28.4/100: 28% astral_power denizen_of_the_dream(2), natures_grace, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, dreamstate, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:17.647 st P starfire Fluffy_Pillow 45.2/100: 45% astral_power denizen_of_the_dream(2), natures_grace, primordial_arcanic_pulsar(40), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:18.575 st Q starsurge Fluffy_Pillow 59.2/100: 59% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:19.604 st R sunfire Fluffy_Pillow 25.2/100: 25% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, best_friends_with_aerwynn_static, corrupting_rage
2:20.673 st Y wrath Fluffy_Pillow 31.2/100: 31% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, best_friends_with_aerwynn_static, corrupting_rage
2:21.741 st Q starsurge Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, best_friends_with_aerwynn_static, corrupting_rage
2:22.810 st Y wrath Fluffy_Pillow 13.2/100: 13% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord(2), best_friends_with_aerwynn_static, corrupting_rage
2:23.942 st Y wrath Fluffy_Pillow 31.2/100: 31% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord(2), best_friends_with_aerwynn_static, corrupting_rage
2:25.073 st Q starsurge Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(48), starlord(2), best_friends_with_aerwynn_static, corrupting_rage
2:26.205 st Y wrath Fluffy_Pillow 13.2/100: 13% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:27.215 st Y wrath Fluffy_Pillow 31.2/100: 31% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:28.226 st Y wrath Fluffy_Pillow 47.2/100: 47% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:29.236 st S moonfire Fluffy_Pillow 65.2/100: 65% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:30.248 st Y wrath Fluffy_Pillow 73.2/100: 73% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:31.259 st X starsurge Fluffy_Pillow 89.2/100: 89% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:32.270 st P starfire Fluffy_Pillow 53.2/100: 53% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:33.783 st P starfire Fluffy_Pillow 67.2/100: 67% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), dreamstate, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:34.708 st Q starsurge Fluffy_Pillow 79.2/100: 79% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, dreamstate, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:35.737 st Q starsurge Fluffy_Pillow 43.2/100: 43% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord, dreamstate, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:36.637 st R sunfire Fluffy_Pillow 21.2/100: 21% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(2), dreamstate, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:37.503 st Q starsurge Fluffy_Pillow 29.2/100: 29% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(2), dreamstate, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:38.369 st V full_moon Fluffy_Pillow 1.2/100: 1% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(8), solstice, starlord(3), dreamstate, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:40.037 st Q starsurge Fluffy_Pillow 59.2/100: 59% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), dreamstate, best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:40.955 st Q starsurge Fluffy_Pillow 35.2/100: 35% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), dreamstate, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:41.872 st O warrior_of_elune Fluffy_Pillow 7.2/100: 7% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), dreamstate, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:41.872 st T new_moon Fluffy_Pillow 7.2/100: 7% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:42.627 st Y wrath Fluffy_Pillow 21.2/100: 21% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:43.382 st Y wrath Fluffy_Pillow 39.2/100: 39% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:44.301 st X starsurge Fluffy_Pillow 55.2/100: 55% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:45.221 st Y wrath Fluffy_Pillow 31.2/100: 31% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:46.139 st X starsurge Fluffy_Pillow 47.2/100: 47% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:47.057 st P starfire Fluffy_Pillow 21.2/100: 21% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:47.814 st P starfire Fluffy_Pillow 38.0/100: 38% astral_power denizen_of_the_dream(3), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:48.566 st Y wrath Fluffy_Pillow 58.8/100: 59% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:49.486 st W cancel_buff Fluffy_Pillow 76.8/100: 77% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:49.486 st Q starsurge Fluffy_Pillow 76.8/100: 77% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, warrior_of_elune, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:50.516 st Q starsurge Fluffy_Pillow 44.8/100: 45% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord, warrior_of_elune, best_friends_with_aerwynn_static, corrupting_rage
2:51.587 st S moonfire Fluffy_Pillow 12.8/100: 13% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(2), warrior_of_elune, best_friends_with_aerwynn_static, corrupting_rage
2:52.617 st Y wrath Fluffy_Pillow 20.8/100: 21% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(2), warrior_of_elune, best_friends_with_aerwynn_static, corrupting_rage
2:53.645 st Q starsurge Fluffy_Pillow 38.8/100: 39% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), solstice, starlord(2), warrior_of_elune, best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage
2:54.778 st R sunfire Fluffy_Pillow 4.8/100: 5% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage
2:55.869 st Y wrath Fluffy_Pillow 12.8/100: 13% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage
2:56.961 st Y wrath Fluffy_Pillow 30.8/100: 31% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_pip(8), best_friends_with_pip_static, corrupting_rage
2:58.052 st Y wrath Fluffy_Pillow 48.8/100: 49% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage
2:59.144 st Y wrath Fluffy_Pillow 64.8/100: 65% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_pip(5), best_friends_with_pip_static, corrupting_rage
3:00.235 default F natures_vigil 470 T31 2p 84.8/100: 85% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage
3:00.235 st X starsurge Fluffy_Pillow 84.8/100: 85% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage
3:01.327 st X starsurge Fluffy_Pillow 48.8/100: 49% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, best_friends_with_pip(3), best_friends_with_pip_static, corrupting_rage
3:02.419 st Y wrath Fluffy_Pillow 14.8/100: 15% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune, best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage
3:03.510 st N incarnation_chosen_of_elune Fluffy_Pillow 26.8/100: 27% astral_power natures_vigil, denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune, dreamstate(2), best_friends_with_pip, best_friends_with_pip_static, corrupting_rage
3:03.510 st U half_moon Fluffy_Pillow 26.8/100: 27% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), warrior_of_elune, dreamstate(2), best_friends_with_pip, best_friends_with_pip_static, corrupting_rage
3:04.711 st Q starsurge Fluffy_Pillow 50.8/100: 51% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, warrior_of_elune, dreamstate(2), best_friends_with_pip_static, corrupting_rage
3:05.722 st Y wrath Fluffy_Pillow 22.8/100: 23% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord, warrior_of_elune, dreamstate, best_friends_with_pip_static, corrupting_rage
3:06.477 st Q starsurge Fluffy_Pillow 74.8/100: 75% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord, warrior_of_elune, dreamstate, best_friends_with_pip_static, corrupting_rage
3:07.447 st Q starsurge Fluffy_Pillow 50.8/100: 51% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(2), dreamstate, best_friends_with_pip_static, corrupting_rage
3:08.384 st V full_moon Fluffy_Pillow 24.8/100: 25% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage
3:10.186 st Q starsurge Fluffy_Pillow 80.8/100: 81% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), dreamstate, best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage
3:11.177 st Q starsurge Fluffy_Pillow 56.8/100: 57% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), dreamstate, best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage
3:12.169 st Q starsurge Fluffy_Pillow 32.8/100: 33% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), dreamstate, best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage
3:13.162 st R sunfire Fluffy_Pillow 6.8/100: 7% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), dreamstate, best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage
3:14.156 st S moonfire Fluffy_Pillow 12.8/100: 13% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), dreamstate, best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage
3:15.149 st Y wrath Fluffy_Pillow 24.8/100: 25% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage
3:15.903 st Y wrath Fluffy_Pillow 42.8/100: 43% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage
3:16.897 st Y wrath Fluffy_Pillow 58.8/100: 59% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage
3:17.889 st W cancel_buff Fluffy_Pillow 76.8/100: 77% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage
3:17.889 st Q starsurge Fluffy_Pillow 76.8/100: 77% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage
3:19.001 st Q starsurge Fluffy_Pillow 52.8/100: 53% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord, best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage
3:20.069 default E use_items Fluffy_Pillow 24.8/100: 25% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(2), best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage
3:20.069 st Y wrath Fluffy_Pillow 24.8/100: 25% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(2), best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage, kindled_soul(100)
3:21.099 st Q starsurge Fluffy_Pillow 42.8/100: 43% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(2), best_friends_with_urctos_static, corrupting_rage, kindled_soul(95)
3:22.128 st Y wrath Fluffy_Pillow 14.8/100: 15% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(90)
3:23.121 st Y wrath Fluffy_Pillow 32.8/100: 33% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(85)
3:24.116 st Y wrath Fluffy_Pillow 54.8/100: 55% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(80)
3:25.107 st Y wrath Fluffy_Pillow 70.8/100: 71% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(75)
3:26.100 st X starsurge Fluffy_Pillow 88.8/100: 89% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(70)
3:27.093 st T new_moon Fluffy_Pillow 62.8/100: 63% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(65)
3:27.847 st X starsurge Fluffy_Pillow 74.8/100: 75% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(65)
3:28.838 st Y wrath Fluffy_Pillow 48.8/100: 49% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage, kindled_soul(60)
3:29.832 st Y wrath Fluffy_Pillow 66.8/100: 67% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage, kindled_soul(55)
3:30.825 st X starsurge Fluffy_Pillow 86.8/100: 87% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_urctos(10), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(50)
3:31.742 st R sunfire Fluffy_Pillow 58.8/100: 59% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_urctos(9), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(45)
3:32.659 st Y wrath Fluffy_Pillow 66.8/100: 67% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_urctos(8), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(40)
3:33.577 st Q starsurge Fluffy_Pillow 88.8/100: 89% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), best_friends_with_urctos(7), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(35)
3:34.607 st Q starsurge Fluffy_Pillow 60.8/100: 61% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, best_friends_with_urctos(6), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(30)
3:35.595 st Q starsurge Fluffy_Pillow 32.8/100: 33% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), best_friends_with_urctos(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(25)
3:36.548 st S moonfire Fluffy_Pillow 8.8/100: 9% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(20)
3:37.466 st Y wrath Fluffy_Pillow 14.8/100: 15% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(15)
3:38.383 st Y wrath Fluffy_Pillow 32.8/100: 33% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(10)
3:39.302 st O warrior_of_elune Fluffy_Pillow 52.8/100: 53% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(5)
3:39.302 st Y wrath Fluffy_Pillow 52.8/100: 53% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(5)
3:40.220 st Y wrath Fluffy_Pillow 68.8/100: 69% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:41.138 st X starsurge Fluffy_Pillow 84.8/100: 85% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), best_friends_with_urctos(11), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:42.056 st X starsurge Fluffy_Pillow 60.8/100: 61% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), best_friends_with_urctos(11), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:42.975 st X starsurge Fluffy_Pillow 34.8/100: 35% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_urctos(10), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:43.896 st Y wrath Fluffy_Pillow 6.8/100: 7% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_urctos(9), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:44.814 st Y wrath Fluffy_Pillow 22.8/100: 23% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_urctos(8), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:45.732 st P starfire Fluffy_Pillow 34.8/100: 35% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos(7), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:46.487 st P starfire Fluffy_Pillow 51.6/100: 52% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(2), best_friends_with_urctos(6), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:47.241 st W cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:47.241 st Q starsurge Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, warrior_of_elune, best_friends_with_urctos(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:48.267 st Q starsurge Fluffy_Pillow 68.0/100: 68% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord, warrior_of_elune, best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:49.165 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(2), warrior_of_elune, best_friends_with_urctos(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:50.030 st R sunfire Fluffy_Pillow 16.0/100: 16% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:50.868 st U half_moon Fluffy_Pillow 26.0/100: 26% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:51.980 st Q starsurge Fluffy_Pillow 56.0/100: 56% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:52.899 st Q starsurge Fluffy_Pillow 30.0/100: 30% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:53.816 st Y wrath Fluffy_Pillow 2.0/100: 2% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:54.734 st Y wrath Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:55.652 st Y wrath Fluffy_Pillow 36.0/100: 36% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
3:56.644 st S moonfire Fluffy_Pillow 54.0/100: 54% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, corrupting_rage
3:57.635 st X starsurge Fluffy_Pillow 62.0/100: 62% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage
3:58.628 st Y wrath Fluffy_Pillow 34.0/100: 34% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune, best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage
3:59.621 st P starfire Fluffy_Pillow 44.0/100: 44% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune, dreamstate, best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, corrupting_rage
4:00.375 st P starfire Fluffy_Pillow 62.8/100: 63% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, corrupting_rage
4:01.270 st W cancel_buff Fluffy_Pillow 74.8/100: 75% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, corrupting_rage
4:01.270 st Q starsurge Fluffy_Pillow 74.8/100: 75% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, corrupting_rage
4:02.381 st Q starsurge Fluffy_Pillow 40.8/100: 41% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, corrupting_rage
4:03.448 st Y wrath Fluffy_Pillow 10.8/100: 11% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, corrupting_rage
4:04.479 st Y wrath Fluffy_Pillow 28.8/100: 29% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, corrupting_rage
4:05.507 st Q starsurge Fluffy_Pillow 44.8/100: 45% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(2), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, corrupting_rage
4:06.640 st R sunfire Fluffy_Pillow 14.8/100: 15% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(32), solstice, starlord(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static, corrupting_rage
4:07.732 st Y wrath Fluffy_Pillow 20.8/100: 21% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
4:08.824 st Y wrath Fluffy_Pillow 36.8/100: 37% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
4:09.916 st Y wrath Fluffy_Pillow 54.8/100: 55% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
4:11.009 st Y wrath Fluffy_Pillow 70.8/100: 71% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
4:12.101 st X starsurge Fluffy_Pillow 90.8/100: 91% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
4:13.191 st X starsurge Fluffy_Pillow 54.8/100: 55% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
4:14.280 st Y wrath Fluffy_Pillow 18.8/100: 19% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
4:15.371 st P starfire Fluffy_Pillow 38.8/100: 39% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
4:17.007 st P starfire Fluffy_Pillow 50.8/100: 51% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), dreamstate, best_friends_with_aerwynn_static, corrupting_rage
4:18.007 st Q starsurge Fluffy_Pillow 64.8/100: 65% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, dreamstate, best_friends_with_aerwynn_static, corrupting_rage
4:19.118 st S moonfire Fluffy_Pillow 30.8/100: 31% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, dreamstate, best_friends_with_aerwynn_static, corrupting_rage
4:20.188 st Q starsurge Fluffy_Pillow 38.8/100: 39% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, dreamstate, best_friends_with_aerwynn_static, corrupting_rage
4:21.256 st V full_moon Fluffy_Pillow 6.8/100: 7% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), dreamstate, best_friends_with_aerwynn_static, corrupting_rage
4:23.311 st Q starsurge Fluffy_Pillow 62.8/100: 63% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(2), dreamstate, best_friends_with_aerwynn_static, corrupting_rage
4:24.442 st Y wrath Fluffy_Pillow 32.8/100: 33% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
4:25.197 st R sunfire Fluffy_Pillow 52.8/100: 53% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
4:26.289 st O warrior_of_elune Fluffy_Pillow 58.8/100: 59% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
4:26.289 st T new_moon Fluffy_Pillow 58.8/100: 59% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage
4:27.043 st X starsurge Fluffy_Pillow 72.8/100: 73% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage

Stats

Level Bonus (70) Race Bonus (tauren) Raid-Buffed Unbuffed Gear Amount
Strength 898 2 986 900 0
Agility 2089 -2 2173 2087 0
Stamina 3848 2 36810 35057 31140
Intellect 2089 -2 13750 12926 10224 (6349)
Spirit 0 0 0 0 0
Health 736200 736200 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13750 12926 0
Crit 27.17% 20.96% 2873
Haste 23.17% 23.17% 3938
Versatility 6.22% 1.22% 251
Mana Regen 2560 2560 0
Attack Power 14300 13443 0
Mastery 29.20% 29.20% 7576
Armor 4652 4652 4652
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 470.00
Local Head Benevolent Embersage's Casque
ilevel: 470, stats: { 585 Armor, +3163 Sta, +655 Crit, +307 Haste, +786 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }, enchant: incandescent_essence
Local Neck Eye of the Rising Flame
ilevel: 470, stats: { +1779 Sta, +233 Haste, +1397 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Life-Bound Shoulderpads
ilevel: 470, stats: { 536 Armor, +2372 Sta, +360 Mastery, +360 Haste, +590 AgiInt }
item effects: { equip: Toxified }
Local Chest Benevolent Embersage's Robe
ilevel: 470, stats: { 780 Armor, +3163 Sta, +665 Crit, +296 Mastery, +786 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 470, stats: { 439 Armor, +2372 Sta, +497 Haste, +224 Mastery, +590 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 470, stats: { 683 Armor, +3163 Sta, +656 Haste, +305 Mastery, +786 AgiInt }, enchant: { +155 StrAgiInt, +41 Vers (lambent_armor_kit_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 470, stats: { 488 Armor, +2372 Sta, +257 Crit, +412 Haste, +590 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Thermal Bindings
ilevel: 470, stats: { 390 Armor, +1779 Sta, +178 Crit, +363 Mastery, +442 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Benevolent Embersage's Talons
ilevel: 470, stats: { 439 Armor, +2372 Sta, +210 Vers, +511 Mastery, +590 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 470, stats: { +1779 Sta, +466 Haste, +1165 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 470, stats: { +1779 Sta, +1118 Crit, +512 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 470, stats: { +747 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 470, stats: { +687 Mastery }
item effects: { use: Balefire Branch }
Local Back Drape of the Loyal Vassal
ilevel: 470, stats: { 312 Armor, +1779 Sta, +305 Haste, +236 Mastery, +442 StrAgiInt }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 470, weapon: { 508 - 654, 2.6 }, stats: { +393 Int, +1896 Int, +1581 Sta, +145 Haste, +335 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 470, stats: { +1206 Int, +1581 Sta, +162 Haste, +319 Mastery }

Talents

RowDruid Talents [31]
1
2
3
4
5
6
7
8
9
10
RowBalance Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

druid="470 T31 2p"
source=default
spec=balance
level=70
race=tauren
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:hissing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Balance APL can be found at https://balance-simc.github.io/Balance-SimC/balance.txt

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=470,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=470,gem_id=192961/192961/192961
shoulders=lifebound_shoulderpads,id=193406,bonus_id=8836/1576/8797/8960,ilevel=470,crafted_stats=49/36
back=drape_of_the_loyal_vassal,id=158375,bonus_id=4795,ilevel=470
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=470,enchant_id=6625
wrists=thermal_bindings,id=134461,bonus_id=4795,ilevel=470,gem_id=192961
hands=benevolent_embersages_talons,id=207255,bonus_id=4795,ilevel=470
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=470,enchant_id=6830
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=470
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=470
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=470
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=470,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=470

# Gear Summary
# gear_ilvl=470.00
# gear_stamina=31140
# gear_intellect=10224
# gear_crit_rating=2873
# gear_haste_rating=3938
# gear_mastery_rating=7576
# gear_versatility_rating=251
# gear_armor=4652
# set_bonus=tier31_2pc=1

470 T31 4p : 202922 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
202921.5 202921.5 202.2 / 0.100% 30163.3 / 14.9% 16217.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.1 12.1 Astral Power 0.00% 66.5 100.0% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
470 T31 4p 202922
Astral Smolder 14418 7.1% 63.9 4.67s 67699 0 Periodic 116.5 37108 0 37108 0.0% 77.6%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 63.86 0.00 116.51 116.51 48.12 0.0000 2.0000 4323516.43 4323516.43 0.00% 18554.51 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 116.51 75 158 37107.99 8156 122790 37123.32 28669 47004 4323516 4323516 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Denizen of the Dream 0 (6428) 0.0% (3.2%) 8.5 31.56s 226228 0

Stats Details: Denizen Of The Dream

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.53 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Denizen Of The Dream

  • id:394065
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394065
  • name:Denizen of the Dream
  • school:physical
  • tooltip:
  • description:Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.
    Fey Missile 21712  / 6428 3.2% 149.4 1.72s 12915 9939 Direct 148.5 10031 20834 12995 27.4%

Stats Details: Fey Missile

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 149.40 148.48 0.00 0.00 0.00 1.2994 0.0000 1929571.36 1929571.36 0.00% 9939.17 9939.17
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.57% 107.75 25 256 10031.48 7341 17117 10022.33 8954 11772 1080902 1080902 0.00%
crit 27.43% 40.73 7 125 20833.96 17559 35242 20815.95 18535 24636 848669 848669 0.00%

Action Details: Fey Missile

  • id:188046
  • school:astral
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.175
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.236000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:188046
  • name:Fey Missile
  • school:astral
  • tooltip:
  • description:{$@spelldesc187875=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$188083d=30 seconds}.}

Action Priority List

    default
    [ ]:5096.34
Hungering Shadowflame 2928 1.4% 17.1 17.10s 51273 0 Direct 17.1 40044 81116 51266 27.3%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.15 17.15 0.00 0.00 0.00 0.0000 0.0000 879236.02 879236.02 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.69% 12.46 2 25 40044.23 26983 154715 39912.72 26983 83917 499238 499238 0.00%
crit 27.31% 4.68 0 15 81115.98 55045 315618 79856.39 0 292046 379998 379998 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24191.79
  • base_dd_max:24191.79
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 5593 2.8% 34.0 8.54s 49412 0 Direct 33.9 38629 78731 49557 27.2%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.98 33.88 0.00 0.00 0.00 0.0000 0.0000 1678888.94 1678888.94 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.77% 24.65 9 44 38629.28 38195 43801 38627.75 38195 40030 952387 952387 0.00%
crit 27.23% 9.23 1 24 78731.08 77919 89355 78747.64 77919 89355 726502 726502 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:34245.43
  • base_dd_max:34245.43
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 10782 5.3% 14.4 21.61s 225224 231262 Direct 14.4 7919 16527 10842 34.0%
Periodic 308.4 7157 15235 9978 34.9% 99.5%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.35 14.35 308.40 308.40 13.35 0.9739 0.9690 3232812.35 3232812.35 0.00% 10334.38 231262.06
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.04% 9.48 3 16 7919.18 5172 14382 7912.85 6714 9771 75069 75069 0.00%
crit 33.96% 4.87 0 12 16527.06 11748 30000 16473.02 0 24866 80562 80562 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 65.08% 200.72 136 268 7157.43 558 13004 7161.34 6796 7711 1436613 1436613 0.00%
crit 34.92% 107.68 68 152 15234.78 10600 26529 15244.79 14144 16529 1640568 1640568 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    st
    [K]:1.27
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [S]:13.08
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
New Moon (Talent) 0 (19153) 0.0% (9.4%) 17.0 18.02s 338411 282263

Stats Details: Moons Talent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.98 0.00 0.00 0.00 0.00 1.1989 0.0000 0.00 0.00 0.00% 282263.28 282263.28

Action Details: Moons Talent

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
    Full Moon 6967 3.4% 5.3 63.17s 396121 212966 Direct 5.3 271424 543401 398452 46.7%

Stats Details: Full Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.29 5.26 0.00 0.00 0.00 1.8601 0.0000 2095800.70 2095800.70 0.00% 212966.23 212966.23
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.33% 2.81 0 6 271423.92 170831 441435 266590.18 0 441435 761545 761545 0.00%
crit 46.67% 2.45 0 6 543400.99 342813 915187 520484.99 0 915187 1334256 1334256 0.00%

Action Details: Full Moon

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:50.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Action Priority List

    st
    [V]:5.35
  • if_expr:astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    New Moon 5286 2.6% 6.0 53.93s 263424 349205 Direct 6.0 173045 367144 265142 47.4%

Stats Details: New Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.01 5.97 0.00 0.00 0.00 0.7545 0.0000 1582596.34 1582596.34 0.00% 349204.84 349204.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.57% 3.14 0 7 173045.22 84280 267925 170498.93 0 252632 542936 542936 0.00%
crit 47.43% 2.83 0 7 367143.74 169857 537197 362986.47 0 521731 1039661 1039661 0.00%

Action Details: New Moon

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Action Priority List

    st
    [T]:6.03
  • if_expr:astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Half Moon 6901 3.4% 5.7 57.98s 363980 296614 Direct 5.6 235874 477814 366378 54.0%

Stats Details: Half Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.68 5.64 0.00 0.00 0.00 1.2272 0.0000 2066507.59 2066507.59 0.00% 296613.69 296613.69
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 46.05% 2.60 0 7 235874.48 121675 374630 228302.47 0 352820 612719 612719 0.00%
crit 53.95% 3.04 0 7 477814.38 247151 764245 471092.73 0 764245 1453788 1453788 0.00%

Action Details: Half Moon

  • id:274282
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:24.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.875000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274282
  • name:Half Moon
  • school:astral
  • tooltip:
  • description:Deals {$s1=0} Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates {$=}{{$m3=240}/10} Astral Power.|r

Action Priority List

    st
    [U]:5.71
  • if_expr:astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (17726) 0.0% (8.7%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 6607 3.3% 94.2 3.16s 21034 0 Direct 94.0 14107 30106 21092 43.7%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 94.23 93.97 0.00 0.00 0.00 0.0000 0.0000 1982145.91 1982145.91 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.34% 52.94 27 83 14107.39 8534 27843 14112.74 12346 15927 746886 746886 0.00%
crit 43.66% 41.03 20 69 30105.73 17410 56799 30119.54 26762 36223 1235260 1235260 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 6647 3.3% 94.9 3.15s 21005 0 Direct 94.7 14090 30073 21060 43.6%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 94.93 94.69 0.00 0.00 0.00 0.0000 0.0000 1993966.07 1993966.07 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.40% 53.41 28 91 14089.87 8500 27843 14094.03 12641 16168 752514 752514 0.00%
crit 43.60% 41.28 20 69 30073.10 17339 56799 30087.53 26705 34205 1241452 1241452 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 4472 2.2% 6.3 48.12s 212786 0 Direct 6.3 142302 305065 213415 43.7%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.31 6.29 0.00 0.00 0.00 0.0000 0.0000 1341833.12 1341833.12 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.29% 3.54 0 8 142302.06 85825 273063 141364.26 0 236682 503608 503608 0.00%
crit 43.71% 2.75 0 7 305065.33 175083 556855 295976.41 0 512216 838225 838225 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 5044 2.5% 26.1 11.46s 58090 64526 Direct 27.1 39472 80375 55948 40.3%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.11 27.11 0.00 0.00 0.00 0.9003 0.0000 1516610.74 1516610.74 0.00% 64525.64 64525.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.73% 16.19 5 29 39472.27 17653 68878 39492.98 33421 46025 639077 639077 0.00%
crit 40.27% 10.92 2 22 80375.10 36012 146770 80396.23 56597 98410 877533 877533 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    st
    [L]:1.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
    st
    [P]:25.17
  • if_expr:variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Warrior of Elune2024251-1.000Spell DataNo-stacks
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Starsurge 65007 (87676) 32.0% (43.2%) 115.0 2.60s 228367 229637 Direct 114.8 (152.5) 116329 244706 169675 41.6% (42.0%)

Stats Details: Starsurge

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 115.03 114.78 0.00 0.00 0.00 0.9945 0.0000 19476363.10 19476363.10 0.00% 229637.24 229637.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.44% 67.08 40 95 116329.00 78019 221329 116397.41 107191 129348 7803542 7803542 0.00%
crit 41.56% 47.70 25 73 244706.45 146796 451511 244908.76 222459 276499 11672821 11672821 0.00%

Action Details: Starsurge

  • id:78674
  • school:astral
  • range:45.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:36.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.455000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.18

Spelldata

  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$s1=0} Astral damage.

Action Priority List

    st
    [Q]:84.75
  • if_expr:variable.starsurge_condition1
    st
    [X]:30.27
  • if_expr:variable.starsurge_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Flat Cost Incarnation: Chosen of Elune1025603-8.000Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Goldrinn's Fang 22669 11.2% 37.9 7.85s 179397 0 Direct 37.7 122354 255577 180253 43.5%

Stats Details: Goldrinns Fang

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.86 37.68 0.00 0.00 0.00 0.0000 0.0000 6791841.19 6791841.19 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.54% 21.30 7 44 122353.59 81581 231434 122411.49 100803 147064 2606574 2606574 0.00%
crit 43.46% 16.37 3 34 255577.26 166425 472125 255729.15 208587 312470 4185268 4185268 0.00%

Action Details: Goldrinns Fang

  • id:394047
  • school:astral
  • range:60.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.852000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10

Spelldata

  • id:394047
  • name:Goldrinn's Fang
  • school:astral
  • tooltip:Deals {$m1=0} Arcane damage.
  • description:Deals {$m1=0} Arcane damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountPower of Goldrinn3940462PCT1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Friend of the Fae39408310.100Spell Data
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Incarnation: Chosen of Elune10256020.100Spell Data
Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Dot / Debuff on Target Moonfire16481250.283Mastery
Sunfire16481550.283Mastery
Waning Twilight39395710.100
Sunfire 10813 5.3% 17.4 18.04s 186352 190751 Direct 17.4 7922 16370 11164 38.4%
Periodic 309.4 7055 14576 9859 37.3% 99.8%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.41 17.41 309.36 309.36 16.41 0.9770 0.9690 3244298.50 3244298.50 0.00% 10241.20 190751.32
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.61% 10.73 4 18 7921.90 4702 13289 7912.98 6737 9225 84979 84979 0.00%
crit 38.39% 6.68 0 17 16369.52 9592 29061 16364.10 0 21368 109401 109401 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 62.73% 194.05 134 258 7055.49 1562 12394 7055.21 6738 7415 1369156 1369156 0.00%
crit 37.27% 115.31 72 162 14576.12 2107 24915 14577.59 13752 15667 1680762 1680762 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    st
    [J]:1.55
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [R]:15.85
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (3113) 0.0% (1.5%) 8.5 31.70s 110150 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.48 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 1619 0.8% 8.5 31.70s 57303 0 Direct 8.5 44624 90950 57294 27.4%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.48 8.48 0.00 0.00 0.00 0.0000 0.0000 486041.90 486041.90 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.63% 6.16 0 16 44624.05 44081 50551 44572.62 0 50551 274909 274909 0.00%
crit 27.37% 2.32 0 9 90949.88 89925 103124 82471.86 0 103124 211133 211133 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:39522.22
  • base_dd_max:39522.22
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 1494 0.7% 16.4 15.32s 27250 0 Direct 16.4 21219 43270 27249 27.3%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.45 16.45 0.00 0.00 0.00 0.0000 0.0000 448242.93 448242.93 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.65% 11.95 1 30 21219.14 20975 24054 21219.05 20975 22808 253587 253587 0.00%
crit 27.35% 4.50 0 16 43270.36 42790 49070 42665.28 0 49070 194656 194656 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18805.57
  • base_dd_max:18805.57
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 19247 9.5% 115.2 2.54s 50096 52628 Direct 114.8 33342 70054 50271 46.1%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 115.23 114.83 0.00 0.00 0.00 0.9519 0.0000 5772453.82 5772453.82 0.00% 52627.56 52627.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.89% 61.88 34 89 33342.06 13038 104854 33344.58 29269 37734 2063173 2063173 0.00%
crit 46.11% 52.95 30 85 70054.35 26597 216501 70073.74 61663 79836 3709281 3709281 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    st
    [M]:0.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
    st
    [Y]:113.53

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.400Spell Data
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
470 T31 4p
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31 4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31 4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31 4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 183.64s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    st
    [N]:2.00
  • if_expr:variable.cd_condition_st

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.7 91.08s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.66 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31 4p
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:57075.72
  • base_dd_max:57075.72
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.33s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.75 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31 4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.75
Elemental Potion of Ultimate Power 1.5 306.34s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.47
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
Warrior of Elune 6.1 48.33s

Stats Details: Warrior Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.14 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Warrior Of Elune

  • id:202425
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202425
  • name:Warrior of Elune
  • school:arcane
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.

Action Priority List

    st
    [O]:6.14
  • if_expr:variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 8.7 1.5 36.4s 33.9s 8.6s 24.88% 28.77% 1.5 (7.0) 8.5

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 50.7s
  • trigger_min/max:3.8s / 50.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:22.30% / 27.79%

Stack Uptimes

  • balance_of_all_things_arcane_1:2.85%
  • balance_of_all_things_arcane_2:2.92%
  • balance_of_all_things_arcane_3:2.99%
  • balance_of_all_things_arcane_4:3.02%
  • balance_of_all_things_arcane_5:3.03%
  • balance_of_all_things_arcane_6:3.28%
  • balance_of_all_things_arcane_7:3.38%
  • balance_of_all_things_arcane_8:3.39%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 18.0 3.5 17.1s 14.1s 8.4s 50.39% 54.51% 3.5 (20.3) 17.4

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 50.5s
  • trigger_min/max:0.0s / 39.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.3s
  • uptime_min/max:46.17% / 53.94%

Stack Uptimes

  • balance_of_all_things_nature_1:5.83%
  • balance_of_all_things_nature_2:5.93%
  • balance_of_all_things_nature_3:6.05%
  • balance_of_all_things_nature_4:6.17%
  • balance_of_all_things_nature_5:6.32%
  • balance_of_all_things_nature_6:6.49%
  • balance_of_all_things_nature_7:6.68%
  • balance_of_all_things_nature_8:6.92%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 7.1 61.5 45.0s 4.2s 20.2s 48.13% 0.00% 33.8 (33.8) 0.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.9s
  • trigger_min/max:0.8s / 42.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:42.88% / 54.97%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:4.83%
  • balance_t31_4pc_buff_lunar_2:4.46%
  • balance_t31_4pc_buff_lunar_3:5.17%
  • balance_t31_4pc_buff_lunar_4:5.55%
  • balance_t31_4pc_buff_lunar_5:28.11%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 14.3 100.8 21.7s 2.6s 19.0s 90.22% 0.00% 46.7 (46.7) 0.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 57.7s
  • trigger_min/max:0.8s / 10.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:87.00% / 92.78%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:7.95%
  • balance_t31_4pc_buff_solar_2:12.43%
  • balance_t31_4pc_buff_solar_3:15.95%
  • balance_t31_4pc_buff_solar_4:11.50%
  • balance_t31_4pc_buff_solar_5:42.40%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 70.6s 70.6s 10.8s 10.09% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 345.9s
  • trigger_min/max:12.0s / 345.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 34.43%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.90%
  • best_friends_with_aerwynn_2:0.91%
  • best_friends_with_aerwynn_3:0.91%
  • best_friends_with_aerwynn_4:0.91%
  • best_friends_with_aerwynn_5:0.91%
  • best_friends_with_aerwynn_6:0.92%
  • best_friends_with_aerwynn_7:0.92%
  • best_friends_with_aerwynn_8:0.92%
  • best_friends_with_aerwynn_9:0.93%
  • best_friends_with_aerwynn_10:0.93%
  • best_friends_with_aerwynn_11:0.93%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 112.6s 70.6s 45.8s 33.81% 0.00% 71.0 (71.0) 0.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.6s / 347.0s
  • trigger_min/max:12.0s / 345.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 276.3s
  • uptime_min/max:0.00% / 95.10%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.81%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.8s 70.8s 10.8s 9.89% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 312.7s
  • trigger_min/max:12.0s / 312.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 33.34%

Stack Uptimes

  • best_friends_with_pip_1:0.88%
  • best_friends_with_pip_2:0.89%
  • best_friends_with_pip_3:0.89%
  • best_friends_with_pip_4:0.89%
  • best_friends_with_pip_5:0.90%
  • best_friends_with_pip_6:0.90%
  • best_friends_with_pip_7:0.90%
  • best_friends_with_pip_8:0.91%
  • best_friends_with_pip_9:0.91%
  • best_friends_with_pip_10:0.91%
  • best_friends_with_pip_11:0.92%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 113.5s 70.8s 45.1s 33.03% 0.00% 69.7 (69.7) 0.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 325.5s
  • trigger_min/max:12.0s / 312.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 288.1s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.03%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 71.2s 71.2s 10.8s 9.99% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 328.7s
  • trigger_min/max:12.0s / 328.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 31.20%

Stack Uptimes

  • best_friends_with_urctos_1:0.89%
  • best_friends_with_urctos_2:0.90%
  • best_friends_with_urctos_3:0.90%
  • best_friends_with_urctos_4:0.90%
  • best_friends_with_urctos_5:0.91%
  • best_friends_with_urctos_6:0.91%
  • best_friends_with_urctos_7:0.91%
  • best_friends_with_urctos_8:0.91%
  • best_friends_with_urctos_9:0.92%
  • best_friends_with_urctos_10:0.92%
  • best_friends_with_urctos_11:0.92%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 114.2s 71.2s 45.6s 33.16% 0.00% 69.4 (69.4) 0.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:13.0s / 343.2s
  • trigger_min/max:12.0s / 328.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 295.9s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.16%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.50% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.66%

Stack Uptimes

  • bloodlust_1:13.50%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 61.8s 58.2s 49.9s 80.10% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 336.0s
  • trigger_min/max:15.0s / 333.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 358.7s
  • uptime_min/max:49.82% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.10%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Denizen of the Dream 8.5 0.0 45.2s 32.1s 41.2s 57.23% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_denizen_of_the_dream
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 232.4s
  • trigger_min/max:0.0s / 143.0s
  • trigger_pct:99.98%
  • duration_min/max:0.0s / 218.8s
  • uptime_min/max:21.15% / 93.34%

Stack Uptimes

  • denizen_of_the_dream_1:38.65%
  • denizen_of_the_dream_2:14.29%
  • denizen_of_the_dream_3:3.57%
  • denizen_of_the_dream_4:0.65%
  • denizen_of_the_dream_5:0.11%
  • denizen_of_the_dream_6:0.02%
  • denizen_of_the_dream_7:0.01%

Spelldata

  • id:394076
  • name:Denizen of the Dream
  • tooltip:
  • description:{$@spelldesc394065=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Dreamstate 15.5 0.4 20.0s 20.7s 3.1s 16.03% 21.35% 0.4 (0.7) 0.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 57.7s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.4s
  • uptime_min/max:9.44% / 28.21%

Stack Uptimes

  • dreamstate_1:9.62%
  • dreamstate_2:6.41%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 7.1 1.0 45.4s 45.0s 20.6s 49.20% 52.44% 1.0 (1.0) 6.8

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.9s
  • trigger_min/max:12.0s / 89.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:44.10% / 56.11%

Stack Uptimes

  • eclipse_lunar_1:49.20%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 13.8 5.7 22.5s 15.7s 20.2s 92.64% 95.97% 5.7 (5.7) 12.9

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 69.7s
  • trigger_min/max:0.0s / 55.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 68.6s
  • uptime_min/max:90.63% / 94.95%

Stack Uptimes

  • eclipse_solar_1:92.64%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 307.2s 307.2s 27.4s 13.23% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.2s
  • trigger_min/max:300.0s / 328.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.87% / 18.01%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.23%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Friend of the Fae 5.2 3.3 55.5s 32.1s 24.8s 43.40% 43.37% 3.3 (3.3) 4.8

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_friend_of_the_fae
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 211.0s
  • trigger_min/max:0.0s / 143.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 191.3s
  • uptime_min/max:14.54% / 81.50%

Stack Uptimes

  • friend_of_the_fae_1:43.40%

Spelldata

  • id:394083
  • name:Friend of the Fae
  • tooltip:Arcane and Nature damage increased by {$=}w1%.
  • description:{$@spelldesc394081=When a Faerie Dragon is summoned, your spells deal {$394083m1=10}% increased damage for {$394083d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 7.1 0.0 45.0s 45.0s 20.2s 48.28% 51.19% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.9s
  • trigger_min/max:12.0s / 89.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:43.35% / 54.97%

Stack Uptimes

  • incarnation_chosen_of_elune_1:48.28%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.6 0.0 99.9s 99.9s 19.5s 23.23% 0.00% 0.0 (0.0) 3.2

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:55.09

Trigger Details

  • interval_min/max:90.0s / 125.5s
  • trigger_min/max:90.0s / 125.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.30% / 26.21%

Stack Uptimes

  • kindled_soul_5:1.10%
  • kindled_soul_10:1.14%
  • kindled_soul_15:1.14%
  • kindled_soul_20:1.15%
  • kindled_soul_25:1.15%
  • kindled_soul_30:1.15%
  • kindled_soul_35:1.15%
  • kindled_soul_40:1.16%
  • kindled_soul_45:1.16%
  • kindled_soul_50:1.16%
  • kindled_soul_55:1.17%
  • kindled_soul_60:1.17%
  • kindled_soul_65:1.17%
  • kindled_soul_70:1.17%
  • kindled_soul_75:1.18%
  • kindled_soul_80:1.18%
  • kindled_soul_85:1.18%
  • kindled_soul_90:1.18%
  • kindled_soul_95:1.19%
  • kindled_soul_100:1.19%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Grace 12.9 0.0 20.7s 20.7s 5.9s 25.34% 0.00% 0.0 (0.0) 12.6

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.8s / 69.8s
  • trigger_min/max:12.8s / 69.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:19.39% / 29.47%

Stack Uptimes

  • natures_grace_1:25.34%

Spelldata

  • id:393959
  • name:Nature's Grace
  • tooltip:Haste increased by {$s1=10}%.
  • description:{$@spelldesc393958=After an Eclipse ends, you gain {$393959s1=10}% Haste for {$393959d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Vigil 3.7 0.0 90.3s 90.3s 14.7s 18.41% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.9s
  • trigger_min/max:90.0s / 91.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.54% / 21.03%

Stack Uptimes

  • natures_vigil_1:18.41%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.4 0.1 74.8s 69.0s 7.7s 6.21% 6.89% 0.1 (0.1) 1.3

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 313.3s
  • trigger_min/max:0.2s / 313.3s
  • trigger_pct:14.95%
  • duration_min/max:0.0s / 24.8s
  • uptime_min/max:0.00% / 24.48%

Stack Uptimes

  • owlkin_frenzy_1:6.21%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 8.1 107.9 38.9s 38.9s 34.8s 93.94% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:24.5s / 50.7s
  • trigger_min/max:24.5s / 50.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 48.0s
  • uptime_min/max:90.18% / 96.68%

Stack Uptimes

  • primordial_arcanic_pulsar_4:5.02%
  • primordial_arcanic_pulsar_8:5.56%
  • primordial_arcanic_pulsar_12:6.51%
  • primordial_arcanic_pulsar_16:6.99%
  • primordial_arcanic_pulsar_20:6.38%
  • primordial_arcanic_pulsar_24:6.05%
  • primordial_arcanic_pulsar_28:7.96%
  • primordial_arcanic_pulsar_32:7.98%
  • primordial_arcanic_pulsar_36:6.60%
  • primordial_arcanic_pulsar_40:7.17%
  • primordial_arcanic_pulsar_44:6.94%
  • primordial_arcanic_pulsar_48:7.08%
  • primordial_arcanic_pulsar_52:7.23%
  • primordial_arcanic_pulsar_56:6.47%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 18.5 4.0 16.7s 14.1s 6.4s 39.55% 39.80% 4.0 (4.0) 18.1

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 49.6s
  • trigger_min/max:0.0s / 39.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.5s
  • uptime_min/max:36.52% / 42.08%

Stack Uptimes

  • solstice_1:39.55%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 20.8 94.2 14.7s 2.6s 14.0s 97.28% 0.00% 53.1 (53.1) 7.5

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 19.8s
  • trigger_min/max:0.8s / 10.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:93.26% / 99.17%

Stack Uptimes

  • starlord_1:9.57%
  • starlord_2:15.50%
  • starlord_3:72.21%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Wafting Devotion 4.3 1.2 60.5s 45.3s 16.5s 23.77% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 196.2s
  • trigger_min/max:0.0s / 196.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 79.8s
  • uptime_min/max:4.83% / 69.92%

Stack Uptimes

  • wafting_devotion_1:23.77%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Warrior of Elune 6.1 0.0 48.3s 48.3s 21.9s 44.82% 43.86% 0.0 (0.0) 2.4

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_warrior_of_elune
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:45.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 81.9s
  • trigger_min/max:45.0s / 81.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s
  • uptime_min/max:34.33% / 50.58%

Stack Uptimes

  • warrior_of_elune_1:21.87%
  • warrior_of_elune_2:4.88%
  • warrior_of_elune_3:18.06%

Spelldata

  • id:202425
  • name:Warrior of Elune
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.
  • max_stacks:0
  • duration:25.00
  • cooldown:45.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Denizen of the Dream 8.5 2.0 20.0 32.1s 0.0s 143.0s
Primordial Arcanic Pulsar 7.2 6.0 9.0 40.6s 29.7s 50.0s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.08% 0.00% 1.24% 0.5s 0.0s 2.6s
Astral Smolder 77.81% 61.48% 91.93% 14.8s 0.0s 90.0s
Incarnation (Total) 48.28% 43.35% 54.97% 20.2s 0.0s 54.0s
Incarnation (Pulsar) 28.04% 26.02% 30.16% 11.8s 0.0s 12.0s
Lunar Eclipse Only 0.92% 0.72% 1.14% 2.7s 2.6s 2.7s
Solar Eclipse Only 44.36% 36.71% 50.12% 10.8s 0.0s 15.0s
No Eclipse 6.42% 4.06% 8.55% 1.5s 0.0s 4.2s
Friend of the Fae 43.40% 14.54% 81.50% 24.8s 0.0s 191.3s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Warrior of Elune7.0540.00036.90743.48326.78970.445
Full Moon
New Moon
Half Moon		0.3490.00020.4495.9315.34826.157

Eclipse Utilization

NoneSolarLunarBoth
Wrath5.124.5%56.2249.7%0.000.0%51.8845.8%
Starfire25.1092.6%0.000.0%2.007.4%0.000.0%
Starsurge0.000.0%46.3940.3%0.000.0%68.6459.7%
New Moon0.040.7%0.183.0%0.000.0%5.7996.4%
Half Moon0.000.1%0.335.7%0.000.0%5.3594.2%
Full Moon0.221.9%3.1827.4%0.080.7%8.1270.0%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
470 T31 4p
Nature's BalanceAstral Power99.60199.105.49%2.000.100.05%
Full MoonAstral Power5.29264.167.28%49.940.300.11%
Half MoonAstral Power5.68136.303.76%24.000.000.00%
MoonfireAstral Power14.3586.052.37%6.000.060.07%
New MoonAstral Power6.0172.091.99%12.000.000.00%
Orbit BreakerAstral Power6.31188.245.19%29.850.940.50%
Shooting Stars (Moonfire)Astral Power94.23188.265.19%2.000.190.10%
Shooting Stars (Sunfire)Astral Power94.93189.655.23%2.000.200.10%
StarfireAstral Power27.11397.9510.97%14.682.710.68%
SunfireAstral Power17.41104.432.88%6.000.010.01%
WrathAstral Power115.231800.9349.65%15.630.000.00%
Usage Type Count Total Tot% Avg RPE APR
470 T31 4p
StarsurgeAstral Power 115.693653.80100.00%31.5831.767189.28
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 736200.0 3339.98 3926.66 1548630.5 560022.3 -133443.2 736200.0
Astral Power 70.0 12.08 12.10 4.5 24.4 0.0 100.0

Statistics & Data Analysis

Fight Length
470 T31 4p Fight Length
Count 5526
Mean 300.30
Minimum 240.09
Maximum 359.98
Spread ( max - min ) 119.89
Range [ ( max - min ) / 2 * 100% ] 19.96%
Standard Deviation 34.8222
5th Percentile 245.67
95th Percentile 354.34
( 95th Percentile - 5th Percentile ) 108.67
Mean Distribution
Standard Deviation 0.4684
95.00% Confidence Interval ( 299.38 - 301.21 )
Normalized 95.00% Confidence Interval ( 99.69% - 100.31% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 517
0.1% Error 51655
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1036
DPS
470 T31 4p Damage Per Second
Count 5526
Mean 202921.51
Minimum 178209.34
Maximum 232561.20
Spread ( max - min ) 54351.85
Range [ ( max - min ) / 2 * 100% ] 13.39%
Standard Deviation 7669.8399
5th Percentile 190940.74
95th Percentile 216113.88
( 95th Percentile - 5th Percentile ) 25173.14
Mean Distribution
Standard Deviation 103.1765
95.00% Confidence Interval ( 202719.28 - 203123.73 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 55
0.1% Error 5488
0.1 Scale Factor Error with Delta=300 502177
0.05 Scale Factor Error with Delta=300 2008706
0.01 Scale Factor Error with Delta=300 50217636
Priority Target DPS
470 T31 4p Priority Target Damage Per Second
Count 5526
Mean 202921.51
Minimum 178209.34
Maximum 232561.20
Spread ( max - min ) 54351.85
Range [ ( max - min ) / 2 * 100% ] 13.39%
Standard Deviation 7669.8399
5th Percentile 190940.74
95th Percentile 216113.88
( 95th Percentile - 5th Percentile ) 25173.14
Mean Distribution
Standard Deviation 103.1765
95.00% Confidence Interval ( 202719.28 - 203123.73 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 55
0.1% Error 5488
0.1 Scale Factor Error with Delta=300 502177
0.05 Scale Factor Error with Delta=300 2008706
0.01 Scale Factor Error with Delta=300 50217636
DPS(e)
470 T31 4p Damage Per Second (Effective)
Count 5526
Mean 202921.51
Minimum 178209.34
Maximum 232561.20
Spread ( max - min ) 54351.85
Range [ ( max - min ) / 2 * 100% ] 13.39%
Damage
470 T31 4p Damage
Count 5526
Mean 58913155.65
Minimum 45169015.09
Maximum 77095443.24
Spread ( max - min ) 31926428.15
Range [ ( max - min ) / 2 * 100% ] 27.10%
DTPS
470 T31 4p Damage Taken Per Second
Count 5526
Mean 3925.82
Minimum 943.25
Maximum 7472.93
Spread ( max - min ) 6529.68
Range [ ( max - min ) / 2 * 100% ] 83.16%
HPS
470 T31 4p Healing Per Second
Count 5526
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
470 T31 4p Healing Per Second (Effective)
Count 5526
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
470 T31 4p Heal
Count 5526
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
470 T31 4p Healing Taken Per Second
Count 5526
Mean 3330.42
Minimum 534.70
Maximum 6509.03
Spread ( max - min ) 5974.33
Range [ ( max - min ) / 2 * 100% ] 89.69%
TMI
470 T31 4p Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
470 T31 4pTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
470 T31 4p Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.47 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.58 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.75 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.st
# count action,conditions
J 1.55 sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
K 1.27 moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
0.00 starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
0.00 starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
L 1.00 starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
M 0.00 wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
0.00 celestial_alignment,if=variable.cd_condition_st
N 2.00 incarnation,if=variable.cd_condition_st
0.00 variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
0.00 variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
O 6.14 warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
P 25.17 starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
0.00 wrath,if=variable.enter_eclipse
0.00 variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
0.00 convoke_the_spirits,if=variable.convoke_condition
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+55
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 starfall,if=buff.starweavers_warp.up
0.00 variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
Q 84.75 starsurge,if=variable.starsurge_condition1
R 15.85 sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
S 13.08 moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
T 6.03 new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
U 5.71 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
V 5.35 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
W 12.37 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
X 30.27 starsurge,if=variable.starsurge_condition2
Y 113.53 wrath
Z 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFJKLNDEQQQTQUQVYXYYRXYXYSWQQYQYYYYXYTOXYXYYXWQQQRYQYQYYSYYXYXXYPPQQRYYQYYYYXXYSPPQYQRUQQQOVYXXYPPQQYSYQRYYYFXYWQPPQYQYYQYRYSYWQQETQUQYQQYYOYXYPPQQJYQSYYYYXXYYPPQQRYYQYYYSXYXVQQQRTYXYXOYPPQYXYYQQSYQRYYYPFPXYNWQQUQQVQQYQRSYYWQQEQYYYYXYTXYYXRYQQQSYOYYYXYXXYUYQQQRYYXYSPPQYXYYQQYRYQYPPQYXYSQQYYOQRYYYXFVWQQQTYYXYSPPQRYWQQYQYYYYXYPPXWQRYQSQYYYOYXXDEUVQQQRYYXYPPQQSYYYQQTYQRPPQY

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask 470 T31 4p 50.0/100: 50% astral_power
Pre precombat 1 food 470 T31 4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 2 augmentation 470 T31 4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 4 no_cd_talent 470 T31 4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 5 on_use_trinket 470 T31 4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 6 on_use_trinket 470 T31 4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 7 on_use_trinket 470 T31 4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 60.0/100: 60% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil 470 T31 4p 50.0/100: 50% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.000 st J sunfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.940 st K moonfire Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:01.879 st L starfire Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, corrupting_rage
0:02.727 st N incarnation_chosen_of_elune Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, corrupting_rage
0:02.727 default D potion Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), corrupting_rage
0:02.727 default E use_items Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power
0:02.727 st Q starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:03.581 st Q starsurge Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:04.403 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:05.194 st T new_moon Fluffy_Pillow 16.0/100: 16% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:05.949 st Q starsurge Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:06.713 st U half_moon Fluffy_Pillow 2.0/100: 2% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:07.731 st Q starsurge Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:08.495 st V full_moon Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:10.020 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:10.777 st X starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:11.541 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:12.295 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:13.058 st R sunfire Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:13.824 st X starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:14.590 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:15.355 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:16.121 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:16.887 st S moonfire Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.651 st W cancel_buff Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.651 st Q starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:18.506 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:19.329 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:20.122 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn, best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:20.914 st Y wrath Fluffy_Pillow 12.0/100: 12% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:21.679 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:22.444 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:23.206 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
0:23.970 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
0:24.735 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power
0:25.500 st T new_moon Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:26.456 st O warrior_of_elune Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:26.456 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:27.209 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:27.964 st X starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:28.720 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:29.473 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:30.227 st X starsurge Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:30.981 st W cancel_buff Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(11), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:30.981 st Q starsurge Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(11), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:31.773 st Q starsurge Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(11), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:32.533 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(10), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:33.288 st R sunfire Fluffy_Pillow 12.0/100: 12% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:34.042 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:34.795 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:35.548 st Y wrath Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:36.302 st Q starsurge Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(6), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:37.056 st Y wrath Fluffy_Pillow 8.0/100: 8% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:37.808 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:38.563 st S moonfire Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:39.316 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:40.071 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:40.990 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:41.909 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:42.830 st X starsurge Fluffy_Pillow 76.0/100: 76% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:43.749 st X starsurge Fluffy_Pillow 50.0/100: 50% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion
0:44.669 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion
0:45.587 st P starfire Fluffy_Pillow 36.0/100: 36% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, wafting_devotion
0:46.341 st P starfire Fluffy_Pillow 52.8/100: 53% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), warrior_of_elune(2), best_friends_with_urctos_static, wafting_devotion
0:47.095 st Q starsurge Fluffy_Pillow 71.6/100: 72% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, warrior_of_elune, best_friends_with_urctos_static, wafting_devotion
0:48.122 st Q starsurge Fluffy_Pillow 39.6/100: 40% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_urctos_static, wafting_devotion
0:49.112 st R sunfire Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, wafting_devotion
0:50.064 st Y wrath Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, wafting_devotion
0:51.018 st Y wrath Fluffy_Pillow 35.6/100: 36% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, wafting_devotion
0:52.065 st Q starsurge Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, wafting_devotion
0:53.111 st Y wrath Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, wafting_devotion
0:54.119 st Y wrath Fluffy_Pillow 35.6/100: 36% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, wafting_devotion
0:55.126 st Y wrath Fluffy_Pillow 53.6/100: 54% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static
0:56.218 st Y wrath Fluffy_Pillow 69.6/100: 70% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static
0:57.307 st X starsurge Fluffy_Pillow 89.6/100: 90% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static
0:58.399 st X starsurge Fluffy_Pillow 53.6/100: 54% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage
0:59.490 st Y wrath Fluffy_Pillow 17.6/100: 18% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static
1:00.584 st S moonfire Fluffy_Pillow 35.6/100: 36% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static
1:01.675 st P starfire Fluffy_Pillow 41.6/100: 42% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), dreamstate, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static
1:02.429 st P starfire Fluffy_Pillow 53.6/100: 54% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static
1:03.430 st Q starsurge Fluffy_Pillow 67.6/100: 68% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, best_friends_with_aerwynn(9), best_friends_with_aerwynn_static
1:04.541 st Y wrath Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_aerwynn(8), best_friends_with_aerwynn_static
1:05.610 st Q starsurge Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static
1:06.681 st R sunfire Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static
1:07.617 st U half_moon Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(4), best_friends_with_aerwynn_static
1:08.988 st Q starsurge Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(3), best_friends_with_aerwynn_static
1:10.017 st Q starsurge Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static
1:11.009 st Q starsurge Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static
1:12.002 st O warrior_of_elune Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static
1:12.002 st V full_moon Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static
1:13.984 st Y wrath Fluffy_Pillow 63.6/100: 64% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(11), best_friends_with_pip_static
1:14.975 st X starsurge Fluffy_Pillow 81.6/100: 82% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage
1:15.967 st X starsurge Fluffy_Pillow 55.6/100: 56% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage
1:16.961 st Y wrath Fluffy_Pillow 27.6/100: 28% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage
1:17.953 st P starfire Fluffy_Pillow 37.6/100: 38% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip(8), best_friends_with_pip_static, corrupting_rage
1:18.707 st P starfire Fluffy_Pillow 58.4/100: 58% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), warrior_of_elune(2), best_friends_with_pip(7), best_friends_with_pip_static, corrupting_rage
1:19.462 st Q starsurge Fluffy_Pillow 77.2/100: 77% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, warrior_of_elune, best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage
1:20.573 st Q starsurge Fluffy_Pillow 41.2/100: 41% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip(5), best_friends_with_pip_static, corrupting_rage
1:21.641 st Y wrath Fluffy_Pillow 7.2/100: 7% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage
1:22.671 st S moonfire Fluffy_Pillow 25.2/100: 25% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(3), best_friends_with_pip_static, corrupting_rage
1:23.700 st Y wrath Fluffy_Pillow 33.2/100: 33% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage
1:24.831 st Q starsurge Fluffy_Pillow 55.2/100: 55% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip, best_friends_with_pip_static, corrupting_rage
1:25.962 st R sunfire Fluffy_Pillow 21.2/100: 21% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
1:27.054 st Y wrath Fluffy_Pillow 29.2/100: 29% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
1:28.145 st Y wrath Fluffy_Pillow 47.2/100: 47% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, corrupting_rage
1:29.238 st Y wrath Fluffy_Pillow 63.2/100: 63% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage
1:30.328 default F natures_vigil 470 T31 4p 81.2/100: 81% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage
1:30.328 st X starsurge Fluffy_Pillow 81.2/100: 81% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage
1:31.420 st Y wrath Fluffy_Pillow 45.2/100: 45% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, corrupting_rage
1:32.513 st W cancel_buff Fluffy_Pillow 63.2/100: 63% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, corrupting_rage
1:32.513 st Q starsurge Fluffy_Pillow 63.2/100: 63% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, corrupting_rage
1:33.734 st P starfire Fluffy_Pillow 31.2/100: 31% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord, warrior_of_elune, dreamstate, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, corrupting_rage
1:34.489 st P starfire Fluffy_Pillow 48.0/100: 48% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord, best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, corrupting_rage
1:35.452 st Q starsurge Fluffy_Pillow 62.0/100: 62% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord, best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, corrupting_rage
1:36.520 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), balance_t31_4pc_buff_solar, best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, corrupting_rage
1:37.549 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power natures_vigil, balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), balance_t31_4pc_buff_solar, best_friends_with_aerwynn, best_friends_with_aerwynn_static, corrupting_rage
1:38.577 st Y wrath Fluffy_Pillow 18.0/100: 18% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, corrupting_rage
1:39.570 st Y wrath Fluffy_Pillow 36.0/100: 36% astral_power natures_vigil, balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, corrupting_rage
1:40.562 st Q starsurge Fluffy_Pillow 56.0/100: 56% astral_power natures_vigil, balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, corrupting_rage
1:41.653 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power natures_vigil, balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, corrupting_rage
1:42.745 st R sunfire Fluffy_Pillow 40.0/100: 40% astral_power natures_vigil, balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
1:43.756 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
1:44.766 st S moonfire Fluffy_Pillow 64.0/100: 64% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, wafting_devotion
1:45.774 st Y wrath Fluffy_Pillow 72.0/100: 72% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, wafting_devotion
1:46.784 st W cancel_buff Fluffy_Pillow 88.0/100: 88% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, wafting_devotion
1:46.784 st Q starsurge Fluffy_Pillow 88.0/100: 88% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, wafting_devotion
1:47.915 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, wafting_devotion
1:49.002 default E use_items Fluffy_Pillow 22.0/100: 22% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, wafting_devotion
1:49.002 st T new_moon Fluffy_Pillow 22.0/100: 22% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(100)
1:49.757 st Q starsurge Fluffy_Pillow 36.0/100: 36% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(100)
1:50.708 st U half_moon Fluffy_Pillow 10.0/100: 10% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(95)
1:51.933 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(90)
1:52.851 st Y wrath Fluffy_Pillow 14.0/100: 14% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(85)
1:53.769 st Q starsurge Fluffy_Pillow 30.0/100: 30% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(80)
1:54.688 st Q starsurge Fluffy_Pillow 36.0/100: 36% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(75)
1:55.606 st Y wrath Fluffy_Pillow 8.0/100: 8% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(70)
1:56.525 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(11), best_friends_with_pip_static, wafting_devotion, kindled_soul(65)
1:57.446 st O warrior_of_elune Fluffy_Pillow 42.0/100: 42% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(11), best_friends_with_pip_static, wafting_devotion, kindled_soul(60)
1:57.446 st Y wrath Fluffy_Pillow 42.0/100: 42% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(11), best_friends_with_pip_static, wafting_devotion, kindled_soul(60)
1:58.363 st X starsurge Fluffy_Pillow 60.0/100: 60% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(10), best_friends_with_pip_static, kindled_soul(55)
1:59.355 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage, kindled_soul(50)
2:00.347 st P starfire Fluffy_Pillow 46.0/100: 46% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip(8), best_friends_with_pip_static, corrupting_rage, kindled_soul(45)
2:01.103 st P starfire Fluffy_Pillow 62.8/100: 63% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_pip(7), best_friends_with_pip_static, corrupting_rage, kindled_soul(40)
2:01.858 st Q starsurge Fluffy_Pillow 81.6/100: 82% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, warrior_of_elune, best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage, kindled_soul(40)
2:02.969 st Q starsurge Fluffy_Pillow 45.6/100: 46% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(35)
2:04.038 st J sunfire Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage, kindled_soul(25)
2:05.067 st Y wrath Fluffy_Pillow 21.6/100: 22% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(20)
2:06.097 st Q starsurge Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(15)
2:07.228 st S moonfire Fluffy_Pillow 7.6/100: 8% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip, best_friends_with_pip_static, corrupting_rage, kindled_soul(10)
2:08.320 st Y wrath Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(5)
2:09.412 st Y wrath Fluffy_Pillow 31.6/100: 32% astral_power denizen_of_the_dream, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
2:10.504 st Y wrath Fluffy_Pillow 49.6/100: 50% astral_power eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
2:11.596 st Y wrath Fluffy_Pillow 65.6/100: 66% astral_power eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
2:12.687 st X starsurge Fluffy_Pillow 83.6/100: 84% astral_power eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
2:13.778 st X starsurge Fluffy_Pillow 49.6/100: 50% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
2:14.869 st Y wrath Fluffy_Pillow 13.6/100: 14% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
2:15.961 st Y wrath Fluffy_Pillow 31.6/100: 32% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
2:17.054 st P starfire Fluffy_Pillow 41.6/100: 42% astral_power natures_grace, primordial_arcanic_pulsar(40), warrior_of_elune, dreamstate, best_friends_with_pip_static, corrupting_rage
2:17.807 st P starfire Fluffy_Pillow 58.4/100: 58% astral_power natures_grace, primordial_arcanic_pulsar(40), best_friends_with_pip_static, corrupting_rage
2:18.808 st Q starsurge Fluffy_Pillow 74.4/100: 74% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, best_friends_with_pip_static, corrupting_rage
2:19.920 st Q starsurge Fluffy_Pillow 42.4/100: 42% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_pip_static, corrupting_rage
2:20.990 st R sunfire Fluffy_Pillow 6.4/100: 6% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, corrupting_rage
2:22.019 st Y wrath Fluffy_Pillow 14.4/100: 14% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, corrupting_rage
2:23.049 st Y wrath Fluffy_Pillow 32.4/100: 32% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, corrupting_rage
2:24.179 st Q starsurge Fluffy_Pillow 54.4/100: 54% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, corrupting_rage
2:25.311 st Y wrath Fluffy_Pillow 18.4/100: 18% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
2:26.401 st Y wrath Fluffy_Pillow 36.4/100: 36% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
2:27.493 st Y wrath Fluffy_Pillow 54.4/100: 54% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, corrupting_rage
2:28.586 st S moonfire Fluffy_Pillow 72.4/100: 72% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:29.595 st X starsurge Fluffy_Pillow 80.4/100: 80% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:30.605 st Y wrath Fluffy_Pillow 46.4/100: 46% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:31.617 st X starsurge Fluffy_Pillow 62.4/100: 62% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:32.626 st V full_moon Fluffy_Pillow 28.4/100: 28% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:34.458 st Q starsurge Fluffy_Pillow 84.4/100: 84% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:35.486 st Q starsurge Fluffy_Pillow 60.4/100: 60% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:36.476 st Q starsurge Fluffy_Pillow 38.4/100: 38% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:37.427 st R sunfire Fluffy_Pillow 14.4/100: 14% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:38.346 st T new_moon Fluffy_Pillow 20.4/100: 20% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:39.099 st Y wrath Fluffy_Pillow 34.4/100: 34% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:40.018 st X starsurge Fluffy_Pillow 52.4/100: 52% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:40.937 st Y wrath Fluffy_Pillow 24.4/100: 24% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:41.857 st X starsurge Fluffy_Pillow 42.4/100: 42% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:42.774 st O warrior_of_elune Fluffy_Pillow 16.4/100: 16% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:42.774 st Y wrath Fluffy_Pillow 16.4/100: 16% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:43.692 st P starfire Fluffy_Pillow 26.4/100: 26% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:44.446 st P starfire Fluffy_Pillow 75.2/100: 75% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:45.202 st Q starsurge Fluffy_Pillow 94.0/100: 94% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:46.120 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:47.039 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:47.957 st Y wrath Fluffy_Pillow 44.0/100: 44% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:48.877 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:49.794 st Q starsurge Fluffy_Pillow 84.0/100: 84% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), solstice, warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, corrupting_rage
2:51.018 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, corrupting_rage
2:52.193 st S moonfire Fluffy_Pillow 16.0/100: 16% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, corrupting_rage
2:53.325 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, corrupting_rage
2:54.456 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn, best_friends_with_aerwynn_static, corrupting_rage
2:55.587 st R sunfire Fluffy_Pillow 4.0/100: 4% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, corrupting_rage
2:56.678 st Y wrath Fluffy_Pillow 10.0/100: 10% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage
2:57.770 st Y wrath Fluffy_Pillow 28.0/100: 28% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos(10), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:58.781 st Y wrath Fluffy_Pillow 44.0/100: 44% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:59.791 st P starfire Fluffy_Pillow 54.0/100: 54% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, dreamstate, best_friends_with_urctos(8), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:00.544 default F natures_vigil 470 T31 4p 74.8/100: 75% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(3), dreamstate, best_friends_with_urctos(8), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:00.544 st P starfire Fluffy_Pillow 74.8/100: 75% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_urctos(8), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:01.371 st X starsurge Fluffy_Pillow 88.8/100: 89% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_urctos(7), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:02.290 st Y wrath Fluffy_Pillow 52.8/100: 53% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos(6), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:03.208 st N incarnation_chosen_of_elune Fluffy_Pillow 72.8/100: 73% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:03.208 st W cancel_buff Fluffy_Pillow 72.8/100: 73% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), dreamstate(2), best_friends_with_urctos(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:03.208 st Q starsurge Fluffy_Pillow 72.8/100: 73% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, dreamstate(2), best_friends_with_urctos(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:04.144 st Q starsurge Fluffy_Pillow 46.8/100: 47% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:05.043 st U half_moon Fluffy_Pillow 22.8/100: 23% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate(2), best_friends_with_urctos(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:06.197 st Q starsurge Fluffy_Pillow 54.8/100: 55% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate(2), best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:07.149 st Q starsurge Fluffy_Pillow 30.8/100: 31% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:08.067 st V full_moon Fluffy_Pillow 6.8/100: 7% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:09.899 st Q starsurge Fluffy_Pillow 64.8/100: 65% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:10.819 st Q starsurge Fluffy_Pillow 38.8/100: 39% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:11.737 st Y wrath Fluffy_Pillow 12.8/100: 13% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:12.491 st Q starsurge Fluffy_Pillow 34.8/100: 35% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:13.410 st R sunfire Fluffy_Pillow 10.8/100: 11% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, best_friends_with_urctos_static, corrupting_rage
3:14.403 st S moonfire Fluffy_Pillow 48.8/100: 49% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, best_friends_with_urctos_static, corrupting_rage
3:15.396 st Y wrath Fluffy_Pillow 56.8/100: 57% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:16.151 st Y wrath Fluffy_Pillow 72.8/100: 73% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:17.143 st W cancel_buff Fluffy_Pillow 88.8/100: 89% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:17.143 st Q starsurge Fluffy_Pillow 88.8/100: 89% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:18.256 st Q starsurge Fluffy_Pillow 62.8/100: 63% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:19.324 default E use_items Fluffy_Pillow 34.8/100: 35% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:19.324 st Q starsurge Fluffy_Pillow 34.8/100: 35% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(100)
3:20.353 st Y wrath Fluffy_Pillow 6.8/100: 7% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(95)
3:21.347 st Y wrath Fluffy_Pillow 26.8/100: 27% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(90)
3:22.339 st Y wrath Fluffy_Pillow 42.8/100: 43% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(85)
3:23.330 st Y wrath Fluffy_Pillow 60.8/100: 61% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(80)
3:24.320 st X starsurge Fluffy_Pillow 78.8/100: 79% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(80)
3:25.312 st Y wrath Fluffy_Pillow 50.8/100: 51% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(75)
3:26.305 st T new_moon Fluffy_Pillow 66.8/100: 67% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(70)
3:27.059 st X starsurge Fluffy_Pillow 82.8/100: 83% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(65)
3:28.052 st Y wrath Fluffy_Pillow 54.8/100: 55% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(60)
3:29.044 st Y wrath Fluffy_Pillow 70.8/100: 71% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(55)
3:30.036 st X starsurge Fluffy_Pillow 90.8/100: 91% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(50)
3:31.029 st R sunfire Fluffy_Pillow 62.8/100: 63% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(45)
3:32.021 st Y wrath Fluffy_Pillow 68.8/100: 69% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(40)
3:33.013 st Q starsurge Fluffy_Pillow 90.8/100: 91% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(35)
3:34.124 st Q starsurge Fluffy_Pillow 62.8/100: 63% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(30)
3:35.193 st Q starsurge Fluffy_Pillow 36.8/100: 37% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(25)
3:36.223 st S moonfire Fluffy_Pillow 10.8/100: 11% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(20)
3:37.216 st Y wrath Fluffy_Pillow 16.8/100: 17% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(15)
3:38.211 st O warrior_of_elune Fluffy_Pillow 32.8/100: 33% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(10)
3:38.211 st Y wrath Fluffy_Pillow 32.8/100: 33% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(10)
3:39.204 st Y wrath Fluffy_Pillow 50.8/100: 51% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(5)
3:40.197 st Y wrath Fluffy_Pillow 68.8/100: 69% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage
3:41.190 st X starsurge Fluffy_Pillow 84.8/100: 85% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage
3:42.183 st Y wrath Fluffy_Pillow 58.8/100: 59% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage
3:43.176 st X starsurge Fluffy_Pillow 76.8/100: 77% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage
3:44.169 st X starsurge Fluffy_Pillow 50.8/100: 51% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(8), best_friends_with_pip_static, corrupting_rage
3:45.162 st Y wrath Fluffy_Pillow 26.8/100: 27% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(7), best_friends_with_pip_static, corrupting_rage
3:46.154 st U half_moon Fluffy_Pillow 44.8/100: 45% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage
3:47.475 st Y wrath Fluffy_Pillow 72.8/100: 73% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage
3:48.467 st Q starsurge Fluffy_Pillow 92.8/100: 93% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(3), best_friends_with_pip_static, corrupting_rage
3:49.578 st Q starsurge Fluffy_Pillow 64.8/100: 65% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage
3:50.646 st Q starsurge Fluffy_Pillow 36.8/100: 37% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip, best_friends_with_pip_static, corrupting_rage
3:51.675 st R sunfire Fluffy_Pillow 12.8/100: 13% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:52.669 st Y wrath Fluffy_Pillow 20.8/100: 21% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:53.663 st Y wrath Fluffy_Pillow 36.8/100: 37% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:54.656 st X starsurge Fluffy_Pillow 54.8/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:55.647 st Y wrath Fluffy_Pillow 26.8/100: 27% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:56.639 st S moonfire Fluffy_Pillow 46.8/100: 47% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:57.633 st P starfire Fluffy_Pillow 54.8/100: 55% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip_static, corrupting_rage
3:58.390 st P starfire Fluffy_Pillow 71.6/100: 72% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(2), best_friends_with_pip_static, corrupting_rage
3:59.145 st Q starsurge Fluffy_Pillow 90.4/100: 90% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, corrupting_rage
4:00.137 st Y wrath Fluffy_Pillow 56.4/100: 56% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip_static, corrupting_rage
4:01.132 st X starsurge Fluffy_Pillow 74.4/100: 74% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip_static, corrupting_rage
4:02.125 st Y wrath Fluffy_Pillow 40.4/100: 40% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, corrupting_rage
4:03.117 st Y wrath Fluffy_Pillow 60.4/100: 60% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, corrupting_rage
4:04.111 st Q starsurge Fluffy_Pillow 78.4/100: 78% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(24), solstice, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, corrupting_rage
4:05.334 st Q starsurge Fluffy_Pillow 42.4/100: 42% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(28), starlord, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
4:06.509 st Y wrath Fluffy_Pillow 8.4/100: 8% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
4:07.640 st R sunfire Fluffy_Pillow 24.4/100: 24% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
4:08.770 st Y wrath Fluffy_Pillow 30.4/100: 30% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
4:09.902 st Q starsurge Fluffy_Pillow 48.4/100: 48% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
4:11.034 st Y wrath Fluffy_Pillow 12.4/100: 12% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
4:12.126 st P starfire Fluffy_Pillow 32.4/100: 32% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
4:13.762 st P starfire Fluffy_Pillow 44.4/100: 44% astral_power natures_grace, primordial_arcanic_pulsar(36), starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage
4:14.656 st Q starsurge Fluffy_Pillow 56.4/100: 56% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage
4:15.649 st Y wrath Fluffy_Pillow 22.4/100: 22% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_pip_static, corrupting_rage
4:16.405 st X starsurge Fluffy_Pillow 40.4/100: 40% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_pip_static, corrupting_rage
4:17.397 st Y wrath Fluffy_Pillow 8.4/100: 8% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, corrupting_rage
4:18.388 st S moonfire Fluffy_Pillow 60.4/100: 60% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, corrupting_rage
4:19.382 st Q starsurge Fluffy_Pillow 68.4/100: 68% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, corrupting_rage
4:20.491 st Q starsurge Fluffy_Pillow 36.4/100: 36% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
4:21.666 st Y wrath Fluffy_Pillow 2.4/100: 2% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(2), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
4:22.796 st Y wrath Fluffy_Pillow 20.4/100: 20% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(2), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
4:23.928 st O warrior_of_elune Fluffy_Pillow 36.4/100: 36% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(2), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
4:23.928 st Q starsurge Fluffy_Pillow 36.4/100: 36% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
4:25.058 st R sunfire Fluffy_Pillow 2.4/100: 2% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
4:26.150 st Y wrath Fluffy_Pillow 10.4/100: 10% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
4:27.241 st Y wrath Fluffy_Pillow 30.4/100: 30% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
4:28.332 st Y wrath Fluffy_Pillow 46.4/100: 46% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
4:29.424 st X starsurge Fluffy_Pillow 62.4/100: 62% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
4:30.515 default F natures_vigil 470 T31 4p 30.4/100: 30% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
4:30.544 st V full_moon Fluffy_Pillow 30.4/100: 30% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
4:32.525 st W cancel_buff Fluffy_Pillow 86.4/100: 86% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
4:32.525 st Q starsurge Fluffy_Pillow 86.4/100: 86% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
4:33.636 st Q starsurge Fluffy_Pillow 60.4/100: 60% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
4:34.705 st Q starsurge Fluffy_Pillow 34.4/100: 34% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
4:35.734 st T new_moon Fluffy_Pillow 8.4/100: 8% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
4:36.489 st Y wrath Fluffy_Pillow 22.4/100: 22% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
4:37.479 st Y wrath Fluffy_Pillow 38.4/100: 38% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
4:38.473 st X starsurge Fluffy_Pillow 56.4/100: 56% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
4:39.466 st Y wrath Fluffy_Pillow 30.4/100: 30% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
4:40.457 st S moonfire Fluffy_Pillow 48.4/100: 48% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
4:41.450 st P starfire Fluffy_Pillow 54.4/100: 54% astral_power natures_vigil, denizen_of_the_dream(2), friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip_static, corrupting_rage
4:42.204 st P starfire Fluffy_Pillow 73.2/100: 73% astral_power natures_vigil, denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, corrupting_rage
4:42.959 st Q starsurge Fluffy_Pillow 94.0/100: 94% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), warrior_of_elune(2), best_friends_with_pip_static, corrupting_rage
4:43.953 st R sunfire Fluffy_Pillow 60.0/100: 60% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_pip_static, corrupting_rage
4:44.945 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power natures_vigil, balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_pip_static, corrupting_rage
4:45.937 st W cancel_buff Fluffy_Pillow 88.0/100: 88% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_urctos(11), best_friends_with_urctos_static
4:45.937 st Q starsurge Fluffy_Pillow 88.0/100: 88% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_urctos(11), best_friends_with_urctos_static
4:47.047 st Q starsurge Fluffy_Pillow 54.0/100: 54% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos(10), best_friends_with_urctos_static
4:48.116 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(9), best_friends_with_urctos_static
4:49.247 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(8), best_friends_with_urctos_static
4:50.378 st Y wrath Fluffy_Pillow 6.0/100: 6% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos(6), best_friends_with_urctos_static, wafting_devotion
4:51.388 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos(5), best_friends_with_urctos_static, wafting_devotion
4:52.399 st Y wrath Fluffy_Pillow 40.0/100: 40% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion
4:53.409 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos(3), best_friends_with_urctos_static, wafting_devotion
4:54.420 st X starsurge Fluffy_Pillow 74.0/100: 74% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion
4:55.433 st Y wrath Fluffy_Pillow 40.0/100: 40% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion
4:56.446 st P starfire Fluffy_Pillow 56.0/100: 56% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, wafting_devotion
4:57.958 st P starfire Fluffy_Pillow 70.0/100: 70% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(36), starlord(3), dreamstate, best_friends_with_urctos_static, wafting_devotion
4:58.787 st X starsurge Fluffy_Pillow 84.0/100: 84% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(3), dreamstate, best_friends_with_urctos_static, wafting_devotion
4:59.705 st W cancel_buff Fluffy_Pillow 52.0/100: 52% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), balance_t31_4pc_buff_solar, dreamstate, best_friends_with_urctos_static, wafting_devotion
4:59.705 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, balance_t31_4pc_buff_solar, dreamstate, best_friends_with_urctos_static, wafting_devotion
5:00.734 st R sunfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, balance_t31_4pc_buff_solar(2), dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
5:01.723 st Y wrath Fluffy_Pillow 28.0/100: 28% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
5:02.477 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(44), solstice, starlord, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
5:03.467 st S moonfire Fluffy_Pillow 10.0/100: 10% astral_power balance_of_all_things_nature(4), eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
5:04.516 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
5:05.564 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage
5:06.656 st Y wrath Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage
5:07.747 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage
5:08.840 st O warrior_of_elune Fluffy_Pillow 66.0/100: 66% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage
5:08.928 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage
5:10.022 st X starsurge Fluffy_Pillow 84.0/100: 84% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage
5:11.113 st X starsurge Fluffy_Pillow 50.0/100: 50% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, corrupting_rage
5:12.205 default D potion Fluffy_Pillow 18.0/100: 18% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, corrupting_rage
5:12.205 default E use_items Fluffy_Pillow 18.0/100: 18% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:12.205 st U half_moon Fluffy_Pillow 18.0/100: 18% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
5:13.527 st V full_moon Fluffy_Pillow 46.0/100: 46% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
5:15.509 st Q starsurge Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
5:16.621 st Q starsurge Fluffy_Pillow 76.0/100: 76% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
5:17.690 st Q starsurge Fluffy_Pillow 48.0/100: 48% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
5:18.718 st R sunfire Fluffy_Pillow 24.0/100: 24% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
5:19.710 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
5:20.702 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
5:21.694 st X starsurge Fluffy_Pillow 64.0/100: 64% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
5:22.686 st Y wrath Fluffy_Pillow 38.0/100: 38% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
5:23.679 st P starfire Fluffy_Pillow 48.0/100: 48% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
5:24.434 st P starfire Fluffy_Pillow 68.8/100: 69% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(2), best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
5:25.188 st Q starsurge Fluffy_Pillow 87.6/100: 88% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
5:26.180 st Q starsurge Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
5:27.175 st S moonfire Fluffy_Pillow 21.6/100: 22% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
5:28.169 st Y wrath Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
5:29.163 st Y wrath Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
5:30.256 st Y wrath Fluffy_Pillow 65.6/100: 66% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
5:31.347 st Q starsurge Fluffy_Pillow 81.6/100: 82% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
5:32.570 st Q starsurge Fluffy_Pillow 47.6/100: 48% astral_power denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(28), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:33.745 st T new_moon Fluffy_Pillow 13.6/100: 14% astral_power denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:34.499 st Y wrath Fluffy_Pillow 25.6/100: 26% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:35.632 st Q starsurge Fluffy_Pillow 41.6/100: 42% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:36.764 st R sunfire Fluffy_Pillow 9.6/100: 10% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:37.857 st P starfire Fluffy_Pillow 15.6/100: 16% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:39.492 st P starfire Fluffy_Pillow 31.6/100: 32% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(36), starlord(3), dreamstate, best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:40.385 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(3), dreamstate, best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:41.375 st Y wrath Fluffy_Pillow 11.6/100: 12% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(40), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (tauren) Raid-Buffed Unbuffed Gear Amount
Strength 898 2 986 900 0
Agility 2089 -2 2173 2087 0
Stamina 3848 2 36810 35057 31140
Intellect 2089 -2 13750 12926 10224 (6349)
Spirit 0 0 0 0 0
Health 736200 701140 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13750 12926 0
Crit 27.17% 20.96% 2873
Haste 23.17% 23.17% 3938
Versatility 6.22% 1.22% 251
Mana Regen 2560 2560 0
Attack Power 14300 13443 0
Mastery 29.20% 29.20% 7576
Armor 4652 4652 4652
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 470.00
Local Head Benevolent Embersage's Casque
ilevel: 470, stats: { 585 Armor, +3163 Sta, +655 Crit, +307 Haste, +786 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }, enchant: incandescent_essence
Local Neck Eye of the Rising Flame
ilevel: 470, stats: { +1779 Sta, +233 Haste, +1397 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Life-Bound Shoulderpads
ilevel: 470, stats: { 536 Armor, +2372 Sta, +360 Mastery, +360 Haste, +590 AgiInt }
item effects: { equip: Toxified }
Local Chest Benevolent Embersage's Robe
ilevel: 470, stats: { 780 Armor, +3163 Sta, +665 Crit, +296 Mastery, +786 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 470, stats: { 439 Armor, +2372 Sta, +497 Haste, +224 Mastery, +590 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 470, stats: { 683 Armor, +3163 Sta, +656 Haste, +305 Mastery, +786 AgiInt }, enchant: { +155 StrAgiInt, +41 Vers (lambent_armor_kit_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 470, stats: { 488 Armor, +2372 Sta, +257 Crit, +412 Haste, +590 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Thermal Bindings
ilevel: 470, stats: { 390 Armor, +1779 Sta, +178 Crit, +363 Mastery, +442 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Benevolent Embersage's Talons
ilevel: 470, stats: { 439 Armor, +2372 Sta, +210 Vers, +511 Mastery, +590 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 470, stats: { +1779 Sta, +466 Haste, +1165 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 470, stats: { +1779 Sta, +1118 Crit, +512 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 470, stats: { +747 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 470, stats: { +687 Mastery }
item effects: { use: Balefire Branch }
Local Back Drape of the Loyal Vassal
ilevel: 470, stats: { 312 Armor, +1779 Sta, +305 Haste, +236 Mastery, +442 StrAgiInt }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 470, weapon: { 508 - 654, 2.6 }, stats: { +393 Int, +1896 Int, +1581 Sta, +145 Haste, +335 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 470, stats: { +1206 Int, +1581 Sta, +162 Haste, +319 Mastery }

Talents

RowDruid Talents [31]
1
2
3
4
5
6
7
8
9
10
RowBalance Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

druid="470 T31 4p"
source=default
spec=balance
level=70
race=tauren
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:hissing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Balance APL can be found at https://balance-simc.github.io/Balance-SimC/balance.txt

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=470,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=470,gem_id=192961/192961/192961
shoulders=lifebound_shoulderpads,id=193406,bonus_id=8836/1576/8797/8960,ilevel=470,crafted_stats=49/36
back=drape_of_the_loyal_vassal,id=158375,bonus_id=4795,ilevel=470
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=470,enchant_id=6625
wrists=thermal_bindings,id=134461,bonus_id=4795,ilevel=470,gem_id=192961
hands=benevolent_embersages_talons,id=207255,bonus_id=4795,ilevel=470
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=470,enchant_id=6830
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=470
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=470
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=470
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=470,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=470

# Gear Summary
# gear_ilvl=470.00
# gear_stamina=31140
# gear_intellect=10224
# gear_crit_rating=2873
# gear_haste_rating=3938
# gear_mastery_rating=7576
# gear_versatility_rating=251
# gear_armor=4652
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

Simulation & Raid Information

Iterations: 5558
Threads: 32
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.4 )

Performance:
Total Events Processed: 228632228
Max Event Queue: 79
Sim Seconds: 1669407
CPU Seconds: 208.2321
Physical Seconds: 12.5465
Speed Up: 8017

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
447 T30 4p 447 T30 4p astral_smolder ticks -394061 2816082 9387 22.46 25082 0 59.6 112.3 0.0% 0.0% 0.0% 0.0% 5.00sec 2816082 300.79sec
447 T30 4p 447 T30 4p augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
447 T30 4p 447 T30 4p denizen_of_the_dream 394065 0 0 0.00 0 0 8.5 0.0 0.0% 0.0% 0.0% 0.0% 32.19sec 0 300.79sec
447 T30 4p 447 T30 4p_Denizen of the Dream fey_missile 188046 1524196 36204 208.98 8061 16739 147.5 146.6 26.9% 0.0% 0.0% 0.0% 1.76sec 1524196 42.10sec
447 T30 4p 447 T30 4p flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
447 T30 4p 447 T30 4p food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
447 T30 4p 447 T30 4p hungering_shadowflame 424324 881017 2929 3.42 40020 82237 17.1 17.1 26.9% 0.0% 0.0% 0.0% 17.04sec 881017 300.79sec
447 T30 4p 447 T30 4p hungering_shadowflame_self 424324 516563 1717 3.42 23512 47952 17.1 17.1 27.1% 0.0% 0.0% 0.0% 17.04sec 570957 300.79sec
447 T30 4p 447 T30 4p incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.65sec 0 300.79sec
447 T30 4p 447 T30 4p launched_thorns 379403 1661282 5523 6.70 38594 78679 33.7 33.6 27.1% 0.0% 0.0% 0.0% 8.70sec 1661282 300.79sec
447 T30 4p 447 T30 4p launched_thorns_heal 379407 0 0 0.00 0 0 0.7 0.0 0.0% 0.0% 0.0% 0.0% 74.51sec 0 300.79sec
447 T30 4p 447 T30 4p moonfire 8921 173625 577 2.87 8806 18234 14.4 14.4 34.7% 0.0% 0.0% 0.0% 21.62sec 3518714 300.79sec
447 T30 4p 447 T30 4p moonfire ticks -8921 3345090 11150 61.38 7889 16641 14.4 306.9 34.4% 0.0% 0.0% 0.0% 21.62sec 3518714 300.79sec
447 T30 4p 447 T30 4p moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
447 T30 4p 447 T30 4p moons_talent 274281 0 0 0.00 0 0 17.0 0.0 0.0% 0.0% 0.0% 0.0% 18.07sec 0 300.79sec
447 T30 4p 447 T30 4p full_moon 274283 1739690 5784 1.05 226066 461352 5.3 5.2 45.0% 0.0% 0.0% 0.0% 63.40sec 1739690 300.79sec
447 T30 4p 447 T30 4p new_moon 274281 1329907 4421 1.19 145792 312513 6.0 5.9 46.7% 0.0% 0.0% 0.0% 54.02sec 1329907 300.79sec
447 T30 4p 447 T30 4p half_moon 274282 1762735 5860 1.13 200387 411299 5.7 5.7 52.6% 0.0% 0.0% 0.0% 57.52sec 1762735 300.79sec
447 T30 4p 447 T30 4p natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.33sec 0 300.79sec
447 T30 4p 447 T30 4p overwhelming_rage ticks -374037 614369 2048 3.99 30774 0 4.1 20.0 0.0% 0.0% 0.0% 0.0% 59.04sec 678536 300.79sec
447 T30 4p 447 T30 4p potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.71sec 0 300.79sec
447 T30 4p 447 T30 4p shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
447 T30 4p 447 T30 4p shooting_stars_moonfire 202497 1621815 5392 14.77 14767 31313 74.2 74.0 43.1% 0.0% 0.0% 0.0% 4.02sec 1621815 300.79sec
447 T30 4p 447 T30 4p shooting_stars_sunfire 202497 1624301 5400 14.80 14741 31289 74.4 74.2 43.3% 0.0% 0.0% 0.0% 4.02sec 1624301 300.79sec
447 T30 4p 447 T30 4p orbit_breaker 274283 1143194 3801 1.23 124720 264968 6.2 6.2 43.0% 0.0% 0.0% 0.0% 49.09sec 1143194 300.79sec
447 T30 4p 447 T30 4p crashing_star 408310 3048996 10137 7.42 55096 116876 37.3 37.2 43.5% 0.0% 0.0% 0.0% 7.96sec 3048996 300.79sec
447 T30 4p 447 T30 4p starfire 194153 674300 2242 4.75 20108 40791 22.8 23.8 39.6% 0.0% 0.0% 0.0% 11.31sec 674300 300.79sec
447 T30 4p 447 T30 4p starsurge 78674 16546280 55009 22.61 100474 211712 113.6 113.4 40.9% 0.0% 0.0% 0.0% 2.64sec 16546280 300.79sec
447 T30 4p 447 T30 4p goldrinns_fang 394047 5821207 19353 7.44 105746 222022 37.5 37.3 43.3% 0.0% 0.0% 0.0% 7.92sec 5821207 300.79sec
447 T30 4p 447 T30 4p sunfire 93402 208697 694 3.48 8581 17661 17.4 17.4 37.3% 0.0% 0.0% 0.0% 18.05sec 3458667 300.79sec
447 T30 4p 447 T30 4p sunfire ticks -93402 3249970 10833 61.57 7594 15687 17.4 307.9 36.6% 0.0% 0.0% 0.0% 18.05sec 3458667 300.79sec
447 T30 4p 447 T30 4p tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.5 0.0 0.0% 0.0% 0.0% 0.0% 31.78sec 0 300.79sec
447 T30 4p 447 T30 4p denizen_of_the_flame 426486 484222 1610 1.69 44597 90856 8.5 8.5 27.1% 0.0% 0.0% 0.0% 31.78sec 484222 300.79sec
447 T30 4p 447 T30 4p denizen_of_the_flame_secondary 426431 446169 1483 3.28 21204 43237 16.4 16.4 27.0% 0.0% 0.0% 0.0% 15.39sec 446169 300.79sec
447 T30 4p 447 T30 4p warrior_of_elune 202425 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 53.04sec 0 300.79sec
447 T30 4p 447 T30 4p wrath 190984 4608747 15322 21.95 28121 58278 110.4 110.1 45.6% 0.0% 0.0% 0.0% 2.66sec 4608747 300.79sec
447+460 2p+2p 447+460 2p+2p astral_smolder ticks -394061 3534307 11781 23.14 30542 0 63.2 115.7 0.0% 0.0% 0.0% 0.0% 4.70sec 3534307 299.81sec
447+460 2p+2p 447+460 2p+2p augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.81sec
447+460 2p+2p 447+460 2p+2p denizen_of_the_dream 394065 0 0 0.00 0 0 8.5 0.0 0.0% 0.0% 0.0% 0.0% 32.39sec 0 299.81sec
447+460 2p+2p 447+460 2p+2p_Denizen of the Dream fey_missile 188046 1560266 37477 211.98 8205 17046 148.0 147.1 27.2% 0.0% 0.0% 0.0% 1.77sec 1560266 41.63sec
447+460 2p+2p 447+460 2p+2p flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.81sec
447+460 2p+2p 447+460 2p+2p food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.81sec
447+460 2p+2p 447+460 2p+2p hungering_shadowflame 424324 879603 2934 3.44 39797 81807 17.2 17.2 27.2% 0.0% 0.0% 0.0% 16.42sec 879603 299.81sec
447+460 2p+2p 447+460 2p+2p hungering_shadowflame_self 424324 517259 1725 3.44 23512 47952 17.2 17.2 27.0% 0.0% 0.0% 0.0% 16.42sec 571710 299.81sec
447+460 2p+2p 447+460 2p+2p incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.90sec 0 299.81sec
447+460 2p+2p 447+460 2p+2p launched_thorns 379403 1666012 5557 6.74 38601 78673 33.8 33.7 27.1% 0.0% 0.0% 0.0% 8.74sec 1666012 299.81sec
447+460 2p+2p 447+460 2p+2p launched_thorns_heal 379407 0 0 0.00 0 0 0.7 0.0 0.0% 0.0% 0.0% 0.0% 70.28sec 0 299.81sec
447+460 2p+2p 447+460 2p+2p moonfire 8921 173528 579 2.87 8884 18432 14.3 14.3 33.9% 0.0% 0.0% 0.0% 21.61sec 3585773 299.81sec
447+460 2p+2p 447+460 2p+2p moonfire ticks -8921 3412245 11374 61.40 8020 16935 14.3 307.0 34.7% 0.0% 0.0% 0.0% 21.61sec 3585773 299.81sec
447+460 2p+2p 447+460 2p+2p moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.81sec
447+460 2p+2p 447+460 2p+2p moons_talent 274281 0 0 0.00 0 0 16.9 0.0 0.0% 0.0% 0.0% 0.0% 18.01sec 0 299.81sec
447+460 2p+2p 447+460 2p+2p full_moon 274283 1796793 5993 1.05 232727 470127 5.3 5.2 46.2% 0.0% 0.0% 0.0% 63.20sec 1796793 299.81sec
447+460 2p+2p 447+460 2p+2p new_moon 274281 1354668 4518 1.19 146824 317004 6.0 6.0 47.2% 0.0% 0.0% 0.0% 53.83sec 1354668 299.81sec
447+460 2p+2p 447+460 2p+2p half_moon 274282 1813170 6048 1.13 207078 421425 5.7 5.6 53.3% 0.0% 0.0% 0.0% 57.84sec 1813170 299.81sec
447+460 2p+2p 447+460 2p+2p natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.32sec 0 299.81sec
447+460 2p+2p 447+460 2p+2p overwhelming_rage ticks -374037 627987 2093 3.98 31546 0 4.1 19.9 0.0% 0.0% 0.0% 0.0% 57.86sec 693675 299.81sec
447+460 2p+2p 447+460 2p+2p potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.37sec 0 299.81sec
447+460 2p+2p 447+460 2p+2p shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.81sec
447+460 2p+2p 447+460 2p+2p shooting_stars_moonfire 202497 2090233 6972 18.73 15014 31819 93.8 93.6 43.6% 0.0% 0.0% 0.0% 3.14sec 2090233 299.81sec
447+460 2p+2p 447+460 2p+2p shooting_stars_sunfire 202497 2091525 6976 18.79 14997 31796 94.1 93.9 43.4% 0.0% 0.0% 0.0% 3.14sec 2091525 299.81sec
447+460 2p+2p 447+460 2p+2p orbit_breaker 274283 1178990 3932 1.25 126297 268328 6.3 6.2 44.0% 0.0% 0.0% 0.0% 47.95sec 1178990 299.81sec
447+460 2p+2p 447+460 2p+2p starfire 194153 1461229 4874 5.41 38198 77825 26.1 27.1 39.9% 0.0% 0.0% 0.0% 11.44sec 1461229 299.81sec
447+460 2p+2p 447+460 2p+2p starsurge 78674 17029813 56802 22.87 102157 215380 114.5 114.3 41.4% 0.0% 0.0% 0.0% 2.60sec 17029813 299.81sec
447+460 2p+2p 447+460 2p+2p goldrinns_fang 394047 5991504 19984 7.54 107546 226136 37.8 37.7 43.5% 0.0% 0.0% 0.0% 7.86sec 5991504 299.81sec
447+460 2p+2p 447+460 2p+2p sunfire 93402 213234 711 3.48 8722 17986 17.4 17.4 38.2% 0.0% 0.0% 0.0% 18.04sec 3535104 299.81sec
447+460 2p+2p 447+460 2p+2p sunfire ticks -93402 3321871 11073 61.59 7734 15984 17.4 308.0 37.0% 0.0% 0.0% 0.0% 18.04sec 3535104 299.81sec
447+460 2p+2p 447+460 2p+2p tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.5 0.0 0.0% 0.0% 0.0% 0.0% 30.88sec 0 299.81sec
447+460 2p+2p 447+460 2p+2p denizen_of_the_flame 426486 483720 1613 1.69 44589 90902 8.5 8.5 27.3% 0.0% 0.0% 0.0% 30.88sec 483720 299.81sec
447+460 2p+2p 447+460 2p+2p denizen_of_the_flame_secondary 426431 445252 1485 3.28 21206 43223 16.4 16.4 27.1% 0.0% 0.0% 0.0% 15.04sec 445252 299.81sec
447+460 2p+2p 447+460 2p+2p warrior_of_elune 202425 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 48.33sec 0 299.81sec
447+460 2p+2p 447+460 2p+2p wrath 190984 5221728 17417 22.86 30402 63779 114.6 114.2 45.9% 0.0% 0.0% 0.0% 2.56sec 5221728 299.81sec
447+470 2p+2p 447+470 2p+2p astral_smolder ticks -394061 3609495 12032 23.30 30983 0 63.9 116.5 0.0% 0.0% 0.0% 0.0% 4.68sec 3609495 300.69sec
447+470 2p+2p 447+470 2p+2p augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.69sec
447+470 2p+2p 447+470 2p+2p denizen_of_the_dream 394065 0 0 0.00 0 0 8.5 0.0 0.0% 0.0% 0.0% 0.0% 32.33sec 0 300.69sec
447+470 2p+2p 447+470 2p+2p_Denizen of the Dream fey_missile 188046 1582474 35684 199.28 8301 17251 148.2 147.3 27.3% 0.0% 0.0% 0.0% 1.77sec 1582474 44.35sec
447+470 2p+2p 447+470 2p+2p flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.69sec
447+470 2p+2p 447+470 2p+2p food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.69sec
447+470 2p+2p 447+470 2p+2p hungering_shadowflame 424324 879684 2926 3.43 39734 81388 17.2 17.2 27.6% 0.0% 0.0% 0.0% 16.42sec 879684 300.69sec
447+470 2p+2p 447+470 2p+2p hungering_shadowflame_self 424324 518865 1726 3.43 23511 47945 17.2 17.2 27.4% 0.0% 0.0% 0.0% 16.42sec 573420 300.69sec
447+470 2p+2p 447+470 2p+2p incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.86sec 0 300.69sec
447+470 2p+2p 447+470 2p+2p launched_thorns 379403 1680384 5589 6.77 38595 78684 34.0 33.9 27.3% 0.0% 0.0% 0.0% 8.83sec 1680384 300.69sec
447+470 2p+2p 447+470 2p+2p launched_thorns_heal 379407 0 0 0.00 0 0 0.7 0.0 0.0% 0.0% 0.0% 0.0% 60.02sec 0 300.69sec
447+470 2p+2p 447+470 2p+2p moonfire 8921 176855 588 2.87 8990 18648 14.4 14.4 34.4% 0.0% 0.0% 0.0% 21.60sec 3645811 300.69sec
447+470 2p+2p 447+470 2p+2p moonfire ticks -8921 3468956 11563 61.64 8109 17129 14.4 308.2 34.9% 0.0% 0.0% 0.0% 21.60sec 3645811 300.69sec
447+470 2p+2p 447+470 2p+2p moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.69sec
447+470 2p+2p 447+470 2p+2p moons_talent 274281 0 0 0.00 0 0 17.0 0.0 0.0% 0.0% 0.0% 0.0% 17.89sec 0 300.69sec
447+470 2p+2p 447+470 2p+2p full_moon 274283 1824827 6069 1.05 235854 476363 5.3 5.3 46.1% 0.0% 0.0% 0.0% 62.85sec 1824827 300.69sec
447+470 2p+2p 447+470 2p+2p new_moon 274281 1370841 4559 1.19 148777 318975 6.0 6.0 47.5% 0.0% 0.0% 0.0% 53.29sec 1370841 300.69sec
447+470 2p+2p 447+470 2p+2p half_moon 274282 1840648 6121 1.13 209930 426717 5.7 5.6 53.6% 0.0% 0.0% 0.0% 57.60sec 1840648 300.69sec
447+470 2p+2p 447+470 2p+2p natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.32sec 0 300.69sec
447+470 2p+2p 447+470 2p+2p overwhelming_rage ticks -374037 631296 2104 3.92 32233 0 4.0 19.6 0.0% 0.0% 0.0% 0.0% 59.10sec 697237 300.69sec
447+470 2p+2p 447+470 2p+2p potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.64sec 0 300.69sec
447+470 2p+2p 447+470 2p+2p shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.69sec
447+470 2p+2p 447+470 2p+2p shooting_stars_moonfire 202497 2125839 7070 18.76 15200 32221 94.3 94.0 43.5% 0.0% 0.0% 0.0% 3.16sec 2125839 300.69sec
447+470 2p+2p 447+470 2p+2p shooting_stars_sunfire 202497 2131077 7087 18.82 15182 32171 94.6 94.3 43.6% 0.0% 0.0% 0.0% 3.15sec 2131077 300.69sec
447+470 2p+2p 447+470 2p+2p orbit_breaker 274283 1198794 3987 1.25 127952 271340 6.3 6.3 43.9% 0.0% 0.0% 0.0% 48.13sec 1198794 300.69sec
447+470 2p+2p 447+470 2p+2p starfire 194153 1488555 4951 5.42 38645 78750 26.2 27.2 40.2% 0.0% 0.0% 0.0% 11.48sec 1488555 300.69sec
447+470 2p+2p 447+470 2p+2p starsurge 78674 17325198 57619 22.89 103377 217961 115.0 114.7 41.6% 0.0% 0.0% 0.0% 2.59sec 17325198 300.69sec
447+470 2p+2p 447+470 2p+2p goldrinns_fang 394047 6085647 20239 7.54 108755 228622 38.0 37.8 43.7% 0.0% 0.0% 0.0% 7.69sec 6085647 300.69sec
447+470 2p+2p 447+470 2p+2p sunfire 93402 215771 718 3.48 8822 18201 17.4 17.4 37.9% 0.0% 0.0% 0.0% 18.04sec 3593986 300.69sec
447+470 2p+2p 447+470 2p+2p sunfire ticks -93402 3378214 11261 61.83 7825 16163 17.4 309.2 37.2% 0.0% 0.0% 0.0% 18.04sec 3593986 300.69sec
447+470 2p+2p 447+470 2p+2p tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.5 0.0 0.0% 0.0% 0.0% 0.0% 31.82sec 0 300.69sec
447+470 2p+2p 447+470 2p+2p denizen_of_the_flame 426486 484464 1611 1.69 44596 90899 8.5 8.5 27.4% 0.0% 0.0% 0.0% 31.82sec 484464 300.69sec
447+470 2p+2p 447+470 2p+2p denizen_of_the_flame_secondary 426431 446501 1485 3.27 21208 43239 16.4 16.4 27.4% 0.0% 0.0% 0.0% 15.35sec 446501 300.69sec
447+470 2p+2p 447+470 2p+2p warrior_of_elune 202425 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 48.30sec 0 300.69sec
447+470 2p+2p 447+470 2p+2p wrath 190984 5312871 17669 22.89 30760 64451 115.1 114.7 46.2% 0.0% 0.0% 0.0% 2.55sec 5312871 300.69sec
460 T31 2p 460 T31 2p astral_smolder ticks -394061 3629130 12097 23.22 31259 0 63.6 116.1 0.0% 0.0% 0.0% 0.0% 4.62sec 3629130 300.05sec
460 T31 2p 460 T31 2p augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.05sec
460 T31 2p 460 T31 2p denizen_of_the_dream 394065 0 0 0.00 0 0 8.5 0.0 0.0% 0.0% 0.0% 0.0% 31.50sec 0 300.05sec
460 T31 2p 460 T31 2p_Denizen of the Dream fey_missile 188046 1603831 34810 192.99 8376 17404 149.1 148.2 27.1% 0.0% 0.0% 0.0% 1.72sec 1603831 46.07sec
460 T31 2p 460 T31 2p flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.05sec
460 T31 2p 460 T31 2p food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.05sec
460 T31 2p 460 T31 2p hungering_shadowflame 424324 878673 2928 3.43 40071 81223 17.1 17.1 27.1% 0.0% 0.0% 0.0% 16.82sec 878673 300.05sec
460 T31 2p 460 T31 2p hungering_shadowflame_self 424324 516902 1723 3.43 23520 47972 17.1 17.1 27.1% 0.0% 0.0% 0.0% 16.82sec 571608 300.05sec
460 T31 2p 460 T31 2p incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.78sec 0 300.05sec
460 T31 2p 460 T31 2p launched_thorns 379403 1673694 5578 6.75 38634 78747 33.8 33.7 27.3% 0.0% 0.0% 0.0% 8.67sec 1673694 300.05sec
460 T31 2p 460 T31 2p launched_thorns_heal 379407 0 0 0.00 0 0 0.6 0.0 0.0% 0.0% 0.0% 0.0% 66.03sec 0 300.05sec
460 T31 2p 460 T31 2p moonfire 8921 148148 494 2.87 7569 15673 14.3 14.3 34.1% 0.0% 0.0% 0.0% 21.62sec 3060989 300.05sec
460 T31 2p 460 T31 2p moonfire ticks -8921 2912841 9709 61.56 6824 14409 14.3 307.8 34.8% 0.0% 0.0% 0.0% 21.62sec 3060989 300.05sec
460 T31 2p 460 T31 2p moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.05sec
460 T31 2p 460 T31 2p moons_talent 274281 0 0 0.00 0 0 17.0 0.0 0.0% 0.0% 0.0% 0.0% 17.98sec 0 300.05sec
460 T31 2p 460 T31 2p full_moon 274283 1847108 6156 1.05 238377 481640 5.3 5.3 46.4% 0.0% 0.0% 0.0% 63.04sec 1847108 300.05sec
460 T31 2p 460 T31 2p new_moon 274281 1384448 4614 1.19 149959 323374 6.0 6.0 47.3% 0.0% 0.0% 0.0% 53.61sec 1384448 300.05sec
460 T31 2p 460 T31 2p half_moon 274282 1858832 6195 1.13 212157 431372 5.7 5.6 53.6% 0.0% 0.0% 0.0% 58.08sec 1858832 300.05sec
460 T31 2p 460 T31 2p natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.33sec 0 300.05sec
460 T31 2p 460 T31 2p overwhelming_rage ticks -374037 643246 2144 3.94 32632 0 4.1 19.7 0.0% 0.0% 0.0% 0.0% 56.60sec 710755 300.05sec
460 T31 2p 460 T31 2p potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 305.76sec 0 300.05sec
460 T31 2p 460 T31 2p shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.05sec
460 T31 2p 460 T31 2p shooting_stars_moonfire 202497 1786990 5956 18.76 12811 27178 94.1 93.8 43.4% 0.0% 0.0% 0.0% 3.18sec 1786990 300.05sec
460 T31 2p 460 T31 2p shooting_stars_sunfire 202497 1792299 5973 18.84 12787 27143 94.5 94.2 43.4% 0.0% 0.0% 0.0% 3.20sec 1792299 300.05sec
460 T31 2p 460 T31 2p orbit_breaker 274283 1206350 4020 1.25 129172 274238 6.3 6.3 43.8% 0.0% 0.0% 0.0% 48.50sec 1206350 300.05sec
460 T31 2p 460 T31 2p starfire 194153 1496345 4987 5.42 39023 79475 26.1 27.1 40.1% 0.0% 0.0% 0.0% 11.49sec 1496345 300.05sec
460 T31 2p 460 T31 2p starsurge 78674 17461494 58195 22.91 104556 220381 114.8 114.6 41.3% 0.0% 0.0% 0.0% 2.60sec 17461494 300.05sec
460 T31 2p 460 T31 2p goldrinns_fang 394047 6124142 20410 7.51 110027 231358 37.7 37.6 43.7% 0.0% 0.0% 0.0% 7.92sec 6124142 300.05sec
460 T31 2p 460 T31 2p sunfire 93402 181489 605 3.48 7426 15299 17.4 17.4 38.2% 0.0% 0.0% 0.0% 18.05sec 3017836 300.05sec
460 T31 2p 460 T31 2p sunfire ticks -93402 2836347 9454 61.75 6583 13597 17.4 308.8 37.1% 0.0% 0.0% 0.0% 18.05sec 3017836 300.05sec
460 T31 2p 460 T31 2p tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.5 0.0 0.0% 0.0% 0.0% 0.0% 32.31sec 0 300.05sec
460 T31 2p 460 T31 2p denizen_of_the_flame 426486 485637 1618 1.70 44622 90973 8.5 8.5 27.2% 0.0% 0.0% 0.0% 32.31sec 485637 300.05sec
460 T31 2p 460 T31 2p denizen_of_the_flame_secondary 426431 447574 1492 3.29 21223 43259 16.4 16.4 27.2% 0.0% 0.0% 0.0% 15.59sec 447574 300.05sec
460 T31 2p 460 T31 2p warrior_of_elune 202425 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 48.18sec 0 300.05sec
460 T31 2p 460 T31 2p wrath 190984 5352102 17837 22.91 31051 65099 115.0 114.6 46.0% 0.0% 0.0% 0.0% 2.55sec 5352102 300.05sec
460 T31 4p 460 T31 4p astral_smolder ticks -394061 4218427 14061 23.29 36229 0 63.6 116.4 0.0% 0.0% 0.0% 0.0% 4.68sec 4218427 300.84sec
460 T31 4p 460 T31 4p augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.84sec
460 T31 4p 460 T31 4p denizen_of_the_dream 394065 0 0 0.00 0 0 8.5 0.0 0.0% 0.0% 0.0% 0.0% 32.24sec 0 300.84sec
460 T31 4p 460 T31 4p_Denizen of the Dream fey_missile 188046 1868700 38217 180.77 9813 20397 148.3 147.3 27.1% 0.0% 0.0% 0.0% 1.76sec 1868700 48.90sec
460 T31 4p 460 T31 4p flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.84sec
460 T31 4p 460 T31 4p food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.84sec
460 T31 4p 460 T31 4p hungering_shadowflame 424324 880247 2926 3.42 39936 81439 17.2 17.2 27.4% 0.0% 0.0% 0.0% 16.95sec 880247 300.84sec
460 T31 4p 460 T31 4p hungering_shadowflame_self 424324 517044 1719 3.42 23515 47957 17.2 17.2 27.1% 0.0% 0.0% 0.0% 16.95sec 571546 300.84sec
460 T31 4p 460 T31 4p incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.79sec 0 300.84sec
460 T31 4p 460 T31 4p launched_thorns 379403 1676360 5572 6.74 38618 78699 33.9 33.8 27.4% 0.0% 0.0% 0.0% 8.66sec 1676360 300.84sec
460 T31 4p 460 T31 4p launched_thorns_heal 379407 0 0 0.00 0 0 0.7 0.0 0.0% 0.0% 0.0% 0.0% 75.79sec 0 300.84sec
460 T31 4p 460 T31 4p moonfire 8921 152480 507 2.87 7749 16174 14.4 14.4 33.9% 0.0% 0.0% 0.0% 21.61sec 3158794 300.84sec
460 T31 4p 460 T31 4p moonfire ticks -8921 3006314 10021 61.65 7008 14916 14.4 308.2 34.7% 0.0% 0.0% 0.0% 21.61sec 3158794 300.84sec
460 T31 4p 460 T31 4p moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.84sec
460 T31 4p 460 T31 4p moons_talent 274281 0 0 0.00 0 0 17.0 0.0 0.0% 0.0% 0.0% 0.0% 17.98sec 0 300.84sec
460 T31 4p 460 T31 4p full_moon 274283 2042146 6788 1.05 264899 531294 5.3 5.3 46.2% 0.0% 0.0% 0.0% 63.13sec 2042146 300.84sec
460 T31 4p 460 T31 4p new_moon 274281 1556031 5172 1.19 169836 360594 6.0 6.0 47.4% 0.0% 0.0% 0.0% 53.66sec 1556031 300.84sec
460 T31 4p 460 T31 4p half_moon 274282 2010242 6682 1.13 231269 466742 5.7 5.6 52.9% 0.0% 0.0% 0.0% 58.20sec 2010242 300.84sec
460 T31 4p 460 T31 4p natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.35sec 0 300.84sec
460 T31 4p 460 T31 4p overwhelming_rage ticks -374037 635696 2119 3.96 32129 0 4.1 19.8 0.0% 0.0% 0.0% 0.0% 58.48sec 702211 300.84sec
460 T31 4p 460 T31 4p potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.77sec 0 300.84sec
460 T31 4p 460 T31 4p shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.84sec
460 T31 4p 460 T31 4p shooting_stars_moonfire 202497 1932266 6423 18.73 13788 29413 94.2 93.9 43.5% 0.0% 0.0% 0.0% 3.20sec 1932266 300.84sec
460 T31 4p 460 T31 4p shooting_stars_sunfire 202497 1936355 6436 18.81 13763 29377 94.6 94.3 43.3% 0.0% 0.0% 0.0% 3.15sec 1936355 300.84sec
460 T31 4p 460 T31 4p orbit_breaker 274283 1310465 4356 1.25 139357 298041 6.3 6.3 43.8% 0.0% 0.0% 0.0% 48.43sec 1310465 300.84sec
460 T31 4p 460 T31 4p starfire 194153 1485570 4938 5.42 38662 78589 26.2 27.2 40.1% 0.0% 0.0% 0.0% 11.46sec 1485570 300.84sec
460 T31 4p 460 T31 4p starsurge 78674 18983797 63103 22.88 113654 239389 115.0 114.7 41.2% 0.0% 0.0% 0.0% 2.60sec 18983797 300.84sec
460 T31 4p 460 T31 4p goldrinns_fang 394047 6661820 22144 7.54 119582 249829 38.0 37.8 43.6% 0.0% 0.0% 0.0% 7.72sec 6661820 300.84sec
460 T31 4p 460 T31 4p sunfire 93402 190217 632 3.48 7761 16012 17.4 17.4 38.1% 0.0% 0.0% 0.0% 18.04sec 3170900 300.84sec
460 T31 4p 460 T31 4p sunfire ticks -93402 2980683 9936 61.84 6907 14270 17.4 309.2 37.1% 0.0% 0.0% 0.0% 18.04sec 3170900 300.84sec
460 T31 4p 460 T31 4p tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.5 0.0 0.0% 0.0% 0.0% 0.0% 31.89sec 0 300.84sec
460 T31 4p 460 T31 4p denizen_of_the_flame 426486 484974 1612 1.70 44601 90902 8.5 8.5 26.9% 0.0% 0.0% 0.0% 31.89sec 484974 300.84sec
460 T31 4p 460 T31 4p denizen_of_the_flame_secondary 426431 447480 1487 3.29 21211 43233 16.5 16.5 27.0% 0.0% 0.0% 0.0% 15.43sec 447480 300.84sec
460 T31 4p 460 T31 4p warrior_of_elune 202425 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 48.19sec 0 300.84sec
460 T31 4p 460 T31 4p wrath 190984 5640409 18749 22.87 32657 68590 115.1 114.7 46.0% 0.0% 0.0% 0.0% 2.55sec 5640409 300.84sec
470 T31 2p 470 T31 2p astral_smolder ticks -394061 3688691 12296 23.29 31679 0 63.9 116.4 0.0% 0.0% 0.0% 0.0% 4.67sec 3688691 300.02sec
470 T31 2p 470 T31 2p augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
470 T31 2p 470 T31 2p denizen_of_the_dream 394065 0 0 0.00 0 0 8.5 0.0 0.0% 0.0% 0.0% 0.0% 32.06sec 0 300.02sec
470 T31 2p 470 T31 2p_Denizen of the Dream fey_missile 188046 1626045 34495 188.68 8476 17617 149.1 148.2 27.3% 0.0% 0.0% 0.0% 1.74sec 1626045 47.14sec
470 T31 2p 470 T31 2p flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
470 T31 2p 470 T31 2p food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
470 T31 2p 470 T31 2p hungering_shadowflame 424324 881802 2939 3.43 39993 81204 17.1 17.1 27.8% 0.0% 0.0% 0.0% 16.32sec 881802 300.02sec
470 T31 2p 470 T31 2p hungering_shadowflame_self 424324 518385 1728 3.43 23521 47966 17.1 17.1 27.5% 0.0% 0.0% 0.0% 16.32sec 573209 300.02sec
470 T31 2p 470 T31 2p incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.85sec 0 300.02sec
470 T31 2p 470 T31 2p launched_thorns 379403 1678337 5594 6.77 38630 78748 34.0 33.9 27.2% 0.0% 0.0% 0.0% 8.64sec 1678337 300.02sec
470 T31 2p 470 T31 2p launched_thorns_heal 379407 0 0 0.00 0 0 0.7 0.0 0.0% 0.0% 0.0% 0.0% 63.61sec 0 300.02sec
470 T31 2p 470 T31 2p moonfire 8921 150278 501 2.87 7653 15854 14.3 14.3 34.5% 0.0% 0.0% 0.0% 21.61sec 3100550 300.02sec
470 T31 2p 470 T31 2p moonfire ticks -8921 2950271 9834 61.62 6902 14573 14.3 308.1 34.8% 0.0% 0.0% 0.0% 21.61sec 3100550 300.02sec
470 T31 2p 470 T31 2p moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
470 T31 2p 470 T31 2p moons_talent 274281 0 0 0.00 0 0 17.0 0.0 0.0% 0.0% 0.0% 0.0% 17.97sec 0 300.02sec
470 T31 2p 470 T31 2p full_moon 274283 1868754 6229 1.05 241808 487041 5.3 5.3 46.4% 0.0% 0.0% 0.0% 63.07sec 1868754 300.02sec
470 T31 2p 470 T31 2p new_moon 274281 1394707 4649 1.19 151796 325157 6.0 6.0 47.4% 0.0% 0.0% 0.0% 53.48sec 1394707 300.02sec
470 T31 2p 470 T31 2p half_moon 274282 1886494 6288 1.13 214420 436828 5.7 5.6 53.8% 0.0% 0.0% 0.0% 57.83sec 1886494 300.02sec
470 T31 2p 470 T31 2p natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.36sec 0 300.02sec
470 T31 2p 470 T31 2p overwhelming_rage ticks -374037 651283 2171 3.91 33313 0 4.0 19.6 0.0% 0.0% 0.0% 0.0% 56.50sec 719663 300.02sec
470 T31 2p 470 T31 2p potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 308.01sec 0 300.02sec
470 T31 2p 470 T31 2p shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
470 T31 2p 470 T31 2p shooting_stars_moonfire 202497 1817637 6058 18.82 12967 27503 94.3 94.1 43.7% 0.0% 0.0% 0.0% 3.15sec 1817637 300.02sec
470 T31 2p 470 T31 2p shooting_stars_sunfire 202497 1820265 6067 18.88 12951 27458 94.7 94.4 43.7% 0.0% 0.0% 0.0% 3.15sec 1820265 300.02sec
470 T31 2p 470 T31 2p orbit_breaker 274283 1223846 4079 1.25 131013 277853 6.3 6.3 43.7% 0.0% 0.0% 0.0% 48.12sec 1223846 300.02sec
470 T31 2p 470 T31 2p starfire 194153 1516139 5053 5.41 39491 80406 26.1 27.1 40.3% 0.0% 0.0% 0.0% 11.60sec 1516139 300.02sec
470 T31 2p 470 T31 2p starsurge 78674 17726447 59083 22.94 105824 222967 114.9 114.7 41.6% 0.0% 0.0% 0.0% 2.59sec 17726447 300.02sec
470 T31 2p 470 T31 2p goldrinns_fang 394047 6218215 20726 7.55 111334 234092 37.9 37.8 43.5% 0.0% 0.0% 0.0% 7.77sec 6218215 300.02sec
470 T31 2p 470 T31 2p sunfire 93402 183492 612 3.48 7501 15494 17.4 17.4 38.1% 0.0% 0.0% 0.0% 18.04sec 3058905 300.02sec
470 T31 2p 470 T31 2p sunfire ticks -93402 2875413 9585 61.82 6659 13753 17.4 309.1 37.3% 0.0% 0.0% 0.0% 18.04sec 3058905 300.02sec
470 T31 2p 470 T31 2p tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.5 0.0 0.0% 0.0% 0.0% 0.0% 31.36sec 0 300.02sec
470 T31 2p 470 T31 2p denizen_of_the_flame 426486 485744 1619 1.70 44617 90989 8.5 8.5 27.1% 0.0% 0.0% 0.0% 31.36sec 485744 300.02sec
470 T31 2p 470 T31 2p denizen_of_the_flame_secondary 426431 448302 1494 3.29 21217 43271 16.4 16.4 27.4% 0.0% 0.0% 0.0% 15.24sec 448302 300.02sec
470 T31 2p 470 T31 2p warrior_of_elune 202425 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 48.43sec 0 300.02sec
470 T31 2p 470 T31 2p wrath 190984 5426097 18086 22.94 31381 65852 115.1 114.7 46.2% 0.0% 0.0% 0.0% 2.54sec 5426097 300.02sec
470 T31 4p 470 T31 4p astral_smolder ticks -394061 4323516 14412 23.30 37108 0 63.9 116.5 0.0% 0.0% 0.0% 0.0% 4.67sec 4323516 300.30sec
470 T31 4p 470 T31 4p augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.30sec
470 T31 4p 470 T31 4p denizen_of_the_dream 394065 0 0 0.00 0 0 8.5 0.0 0.0% 0.0% 0.0% 0.0% 31.56sec 0 300.30sec
470 T31 4p 470 T31 4p_Denizen of the Dream fey_missile 188046 1929571 42708 197.19 10031 20834 149.4 148.5 27.4% 0.0% 0.0% 0.0% 1.72sec 1929571 45.18sec
470 T31 4p 470 T31 4p flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.30sec
470 T31 4p 470 T31 4p food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.30sec
470 T31 4p 470 T31 4p hungering_shadowflame 424324 879236 2928 3.43 40044 81116 17.1 17.1 27.3% 0.0% 0.0% 0.0% 17.10sec 879236 300.30sec
470 T31 4p 470 T31 4p hungering_shadowflame_self 424324 518671 1727 3.43 23520 47968 17.1 17.1 27.5% 0.0% 0.0% 0.0% 17.10sec 573517 300.30sec
470 T31 4p 470 T31 4p incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.64sec 0 300.30sec
470 T31 4p 470 T31 4p launched_thorns 379403 1678889 5591 6.77 38629 78731 34.0 33.9 27.2% 0.0% 0.0% 0.0% 8.54sec 1678889 300.30sec
470 T31 4p 470 T31 4p launched_thorns_heal 379407 0 0 0.00 0 0 0.7 0.0 0.0% 0.0% 0.0% 0.0% 91.08sec 0 300.30sec
470 T31 4p 470 T31 4p moonfire 8921 155631 518 2.87 7919 16527 14.4 14.4 34.0% 0.0% 0.0% 0.0% 21.61sec 3232812 300.30sec
470 T31 4p 470 T31 4p moonfire ticks -8921 3077181 10257 61.68 7157 15235 14.4 308.4 34.9% 0.0% 0.0% 0.0% 21.61sec 3232812 300.30sec
470 T31 4p 470 T31 4p moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.30sec
470 T31 4p 470 T31 4p moons_talent 274281 0 0 0.00 0 0 17.0 0.0 0.0% 0.0% 0.0% 0.0% 18.02sec 0 300.30sec
470 T31 4p 470 T31 4p full_moon 274283 2095801 6979 1.05 271424 543401 5.3 5.3 46.7% 0.0% 0.0% 0.0% 63.17sec 2095801 300.30sec
470 T31 4p 470 T31 4p new_moon 274281 1582596 5270 1.19 173045 367144 6.0 6.0 47.4% 0.0% 0.0% 0.0% 53.93sec 1582596 300.30sec
470 T31 4p 470 T31 4p half_moon 274282 2066508 6882 1.13 235874 477814 5.7 5.6 54.0% 0.0% 0.0% 0.0% 57.98sec 2066508 300.30sec
470 T31 4p 470 T31 4p natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.33sec 0 300.30sec
470 T31 4p 470 T31 4p overwhelming_rage ticks -374037 660490 2202 3.97 33312 0 4.1 19.8 0.0% 0.0% 0.0% 0.0% 58.46sec 729852 300.30sec
470 T31 4p 470 T31 4p potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 306.34sec 0 300.30sec
470 T31 4p 470 T31 4p shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.30sec
470 T31 4p 470 T31 4p shooting_stars_moonfire 202497 1982146 6601 18.78 14107 30106 94.2 94.0 43.7% 0.0% 0.0% 0.0% 3.16sec 1982146 300.30sec
470 T31 4p 470 T31 4p shooting_stars_sunfire 202497 1993966 6640 18.92 14090 30073 94.9 94.7 43.6% 0.0% 0.0% 0.0% 3.15sec 1993966 300.30sec
470 T31 4p 470 T31 4p orbit_breaker 274283 1341833 4468 1.26 142302 305065 6.3 6.3 43.7% 0.0% 0.0% 0.0% 48.12sec 1341833 300.30sec
470 T31 4p 470 T31 4p starfire 194153 1516611 5050 5.42 39472 80375 26.1 27.1 40.3% 0.0% 0.0% 0.0% 11.46sec 1516611 300.30sec
470 T31 4p 470 T31 4p starsurge 78674 19476363 64857 22.93 116329 244706 115.0 114.8 41.6% 0.0% 0.0% 0.0% 2.60sec 19476363 300.30sec
470 T31 4p 470 T31 4p goldrinns_fang 394047 6791841 22617 7.53 122354 255577 37.9 37.7 43.5% 0.0% 0.0% 0.0% 7.85sec 6791841 300.30sec
470 T31 4p 470 T31 4p sunfire 93402 194380 647 3.48 7922 16370 17.4 17.4 38.4% 0.0% 0.0% 0.0% 18.04sec 3244298 300.30sec
470 T31 4p 470 T31 4p sunfire ticks -93402 3049919 10166 61.87 7055 14576 17.4 309.4 37.3% 0.0% 0.0% 0.0% 18.04sec 3244298 300.30sec
470 T31 4p 470 T31 4p tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.5 0.0 0.0% 0.0% 0.0% 0.0% 31.70sec 0 300.30sec
470 T31 4p 470 T31 4p denizen_of_the_flame 426486 486042 1619 1.69 44624 90950 8.5 8.5 27.4% 0.0% 0.0% 0.0% 31.70sec 486042 300.30sec
470 T31 4p 470 T31 4p denizen_of_the_flame_secondary 426431 448243 1493 3.29 21219 43270 16.4 16.4 27.3% 0.0% 0.0% 0.0% 15.32sec 448243 300.30sec
470 T31 4p 470 T31 4p warrior_of_elune 202425 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 48.33sec 0 300.30sec
470 T31 4p 470 T31 4p wrath 190984 5772454 19223 22.94 33342 70054 115.2 114.8 46.1% 0.0% 0.0% 0.0% 2.54sec 5772454 300.30sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
176865.4 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Waning Twilight 5.7 0.0 53.9s 54.0s 48.2s 91.02% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 330.6s
  • trigger_min/max:6.4s / 330.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 345.4s
  • uptime_min/max:70.81% / 99.72%

Stack Uptimes

  • waning_twilight_1:91.02%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 5.6 0.0 55.1s 55.2s 49.4s 92.24% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p+2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 325.7s
  • trigger_min/max:6.5s / 325.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 325.3s
  • uptime_min/max:76.57% / 99.70%

Stack Uptimes

  • waning_twilight_1:92.24%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 5.6 0.0 54.6s 54.7s 49.2s 92.14% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p+2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 336.2s
  • trigger_min/max:6.4s / 336.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 342.0s
  • uptime_min/max:65.82% / 99.67%

Stack Uptimes

  • waning_twilight_1:92.14%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 5.6 0.0 54.9s 55.0s 49.6s 92.18% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 326.5s
  • trigger_min/max:6.5s / 326.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 335.7s
  • uptime_min/max:71.26% / 99.72%

Stack Uptimes

  • waning_twilight_1:92.18%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 5.6 0.0 55.0s 55.1s 49.5s 92.31% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 334.0s
  • trigger_min/max:6.1s / 334.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 340.0s
  • uptime_min/max:74.38% / 99.72%

Stack Uptimes

  • waning_twilight_1:92.31%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 5.7 0.0 54.7s 54.7s 49.1s 92.23% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31 4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 333.1s
  • trigger_min/max:6.1s / 333.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 356.3s
  • uptime_min/max:71.86% / 99.74%

Stack Uptimes

  • waning_twilight_1:92.23%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 5.6 0.0 55.3s 55.4s 49.7s 92.30% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31 4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 333.0s
  • trigger_min/max:6.3s / 333.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 347.2s
  • uptime_min/max:72.01% / 99.70%

Stack Uptimes

  • waning_twilight_1:92.30%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 36517
Mean 300.36
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 19.97%
Standard Deviation 34.6205
5th Percentile 246.22
95th Percentile 354.22
( 95th Percentile - 5th Percentile ) 108.00
Mean Distribution
Standard Deviation 0.1812
95.00% Confidence Interval ( 300.01 - 300.72 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 511
0.1% Error 51036
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1024
DPS
Fluffy_Pillow Damage Per Second
Count 36517
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 36517
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 36517
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 36517
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 36517
Mean 189884.29
Minimum 159920.61
Maximum 232561.20
Spread ( max - min ) 72640.59
Range [ ( max - min ) / 2 * 100% ] 19.13%
Standard Deviation 10069.5561
5th Percentile 175319.47
95th Percentile 208125.38
( 95th Percentile - 5th Percentile ) 32805.91
Mean Distribution
Standard Deviation 52.6942
95.00% Confidence Interval ( 189781.01 - 189987.57 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 109
0.1% Error 10803
0.1 Scale Factor Error with Delta=300 865575
0.05 Scale Factor Error with Delta=300 3462297
0.01 Scale Factor Error with Delta=300 86557424
HPS
Fluffy_Pillow Healing Per Second
Count 36517
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 36517
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 36517
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 36517
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 36517
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 36517
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 1789
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 64069743 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.