SimulationCraft 1015-01

for World of Warcraft 10.2.0.52095 PTR (hotfix 2023-11-09/52095, git build e1ec9bc853)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
Adjust bear thrash periodic damage spell level requirement
Thrash spell_level 11.00 18.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-05-16 Base value of Frost aura's effect 191124 is truncated.
Frost Mage (effect#5) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191122 is truncated.
Frost Mage (effect#3) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191121 is truncated.
Frost Mage (effect#2) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 179703 is truncated.
Frost Mage (effect#1) base_value 9.00 9.20
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-01-08 Manually set secondary Malefic Rapture level requirement
Malefic Rapture spell_level 11.00 43.00

Table of Contents

Raid Summary

Created with Highcharts 4.2.3 Damage per Second(Click title for burst)941,930940,837939,023928,018buzzing_rune_3hissing_rune_3howling_rune_3Base
Created with Highcharts 4.2.3 Priority Target/Boss Damage 171,927171,751171,513169,352buzzing_rune_3hissing_rune_3howling_rune_3Base
Created with Highcharts 4.2.3 Damage Taken per Second(Click title for burst)4,9514,9304,9294,916howling_rune_3buzzing_rune_3Basehissing_rune_3

Additional Raid Information

Base : 928018 dps, 169352 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
928018.0 928018.0 461.5 / 0.050% 87692.9 / 9.4% 67337.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.8 13.9 Astral Power 0.00% 56.4 99.9% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Base 928018
Astral Smolder 140030 15.1% 387.5 0.83s 108030 0 Periodic 746.9 56037 0 56037 0.0% 83.0%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 387.46 0.00 746.93 746.93 303.01 0.0000 2.0000 41856851.08 41856851.08 0.00% 28019.22 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 746.93 533 945 56036.52 4650 267775 56116.36 48972 65645 41856851 41856851 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Fury of Elune 27878 3.0% 5.1 64.88s 1628114 1684784 Direct 763.7 6773 14444 10907 53.9%

Stats Details: Fury Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.12 763.73 0.00 0.00 0.00 0.9665 0.0000 8329573.21 8329573.21 0.00% 1684784.23 1684784.23
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 46.11% 352.15 202 515 6773.14 3258 21903 6781.87 5810 7863 2385150 2385150 0.00%
crit 53.89% 411.58 277 578 14443.79 6646 44683 14455.69 12874 16590 5944423 5944423 0.00%

Action Details: Fury Of Elune

  • id:202770
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:astral_power
  • energize_amount:3.0

Spelldata

  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r

Action Details: Fury Of Elune Tick

  • id:211545
  • school:astral
  • range:105.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.149000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:211545
  • name:Fury of Elune
  • school:astral
  • tooltip:
  • description:{$@spelldesc202770=Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r}

Action Priority List

    aoe
    [P]:5.12
  • if_expr:target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Hungering Shadowflame 3837 0.4% 17.1 17.00s 67369 0 Direct 17.1 51898 106100 67385 28.6%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.07 17.07 0.00 0.00 0.00 0.0000 0.0000 1149740.23 1149740.23 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.44% 12.19 2 26 51898.29 34936 202233 51655.55 34936 122319 632691 632691 0.00%
crit 28.56% 4.87 0 18 106099.81 71270 412555 104955.23 0 412555 517049 517049 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy5
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:31299.68
  • base_dd_max:31299.68
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 7086 0.8% 34.1 8.60s 62244 0 Direct 34.0 48090 98036 62423 28.7%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.08 33.99 0.00 0.00 0.00 0.0000 0.0000 2121495.97 2121495.97 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.30% 24.23 9 44 48090.10 47503 54996 48089.59 47503 50156 1165392 1165392 0.00%
crit 28.70% 9.75 1 23 98035.54 96907 112191 98037.63 96907 105277 956104 956104 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42559.30
  • base_dd_max:42559.30
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 76863 8.3% 3.0 1.07s 7665696 8326245 Direct 6.0 6969 14200 10593 50.1%
Periodic 1820.2 8703 17956 12600 42.1% 99.0%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.00 6.00 1820.16 1820.16 0.00 0.9209 0.9789 22997087.71 22997087.71 0.00% 12886.62 8326244.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.87% 2.99 0 6 6968.61 6880 8103 6858.73 0 8103 20851 20851 0.00%
crit 50.13% 3.01 0 6 14200.25 14034 16530 14017.67 0 16530 42712 42712 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 57.88% 1053.55 788 1340 8702.78 6630 14138 8702.74 8457 9001 9168598 9168598 0.00%
crit 42.12% 766.61 559 993 17955.74 13525 28841 17958.90 17443 18577 13764926 13764926 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    aoe
    [J]:3.00
  • if_expr:!fight_style.dungeonroute
  • target_if_expr:refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (80652) 0.0% (8.7%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 19938 2.1% 235.8 1.47s 25290 0 Direct 235.2 15897 34128 25354 51.9%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 235.83 235.23 0.00 0.00 0.00 0.0000 0.0000 5963977.68 5963977.68 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.12% 113.20 65 162 15897.00 10979 30135 15904.19 14662 17247 1799464 1799464 0.00%
crit 51.88% 122.03 78 175 34128.14 22398 61476 34156.31 32143 37258 4164514 4164514 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy5
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 20022 2.2% 237.5 1.46s 25213 0 Direct 236.9 15849 34017 25278 51.9%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 237.52 236.92 0.00 0.00 0.00 0.0000 0.0000 5988563.25 5988563.25 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.10% 113.96 68 174 15848.97 9912 30135 15855.43 14532 17288 1806040 1806040 0.00%
crit 51.90% 122.96 82 172 34016.55 20220 61476 34042.19 31701 36549 4182524 4182524 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 40692 4.4% 15.8 19.19s 771413 0 Direct 94.4 80844 174081 128935 51.6%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.78 94.41 0.00 0.00 0.00 0.0000 0.0000 12171360.67 12171360.67 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.43% 45.72 19 76 80844.28 40859 304293 80913.69 59403 100301 3695792 3695792 0.00%
crit 51.57% 48.69 22 80 174080.51 83352 620759 174185.46 135519 216805 8475568 8475568 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:enemy2
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfall 308381 33.2% 104.7 2.84s 880440 870337 Direct 1766.4 34183 73714 52186 45.5%

Stats Details: Starfall

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 104.69 1766.35 0.00 0.00 0.00 1.0116 0.0000 92176564.32 92176564.32 0.00% 870337.41 870337.41
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.46% 961.89 684 1237 34182.77 7537 128122 34256.88 31163 38204 32879086 32879086 0.00%
crit 45.54% 804.46 586 1045 73714.09 15375 276138 73846.49 67745 81940 59297478 59297478 0.00%

Action Details: Starfall

  • id:191034
  • school:astral
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:45.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]

Action Details: Starfall Damage

  • id:191037
  • school:astral
  • range:200.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.114000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.41

Spelldata

  • id:191037
  • name:Starfall
  • school:astral
  • tooltip:
  • description:{$@spelldesc191034=Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]}

Action Priority List

    aoe
    [L]:70.48
  • if_expr:variable.starfall_condition1
    aoe
    [Q]:34.21
  • if_expr:variable.starfall_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountLunar Shrapnel4151691PCT0.200
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 207561 22.4% 117.7 2.51s 527087 377875 Direct 712.5 54011 116593 87106 52.9%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.74 712.46 0.00 0.00 0.00 1.3949 0.0000 62061078.43 62061078.43 0.00% 377875.13 377875.13
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 47.12% 335.68 230 447 54011.44 7433 240137 54034.15 47494 61979 18130694 18130694 0.00%
crit 52.88% 376.78 281 491 116592.97 15163 491633 116654.88 104457 135883 43930384 43930384 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    aoe
    [M]:1.26
  • if_expr:buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
    aoe
    [R]:117.00
  • if_expr:spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Solar)4851710.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Sunfire16481550.283Mastery
Sunfire 64413 6.9% 1.0 0.00s 19258026 20752183 Direct 1.0 5472 11161 7055 27.8%
Periodic 1833.1 7322 15623 10502 38.3% 99.7%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 1833.07 1833.07 0.00 0.9285 0.9786 19258026.29 19258026.29 0.00% 10730.37 20752183.50
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.22% 0.72 0 1 5472.45 5438 5510 3951.95 0 5510 3952 3952 0.00%
crit 27.78% 0.28 0 1 11161.36 11094 11240 3101.15 0 11240 3101 3101 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 61.69% 1130.76 845 1415 7321.50 5479 12722 7325.07 7104 7630 8278711 8278711 0.00%
crit 38.31% 702.31 520 911 15623.39 11178 25953 15632.93 15039 16257 10972262 10972262 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    aoe
    [I]:1.00
  • target_if_expr:refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (7057) 0.0% (0.8%) 8.4 31.96s 251393 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.40 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy3
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 3686 0.4% 8.4 31.96s 131288 0 Direct 50.4 16858 34363 21881 28.7%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.40 50.40 0.00 0.00 0.00 0.0000 0.0000 1102795.28 1102795.28 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.30% 35.94 7 87 16858.07 16647 19272 16858.21 16647 18278 605826 605826 0.00%
crit 28.70% 14.46 1 43 34363.46 33959 39316 34366.78 33959 39316 496969 496969 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:51134.41
  • base_dd_max:51134.41
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 3371 0.4% 16.1 15.69s 62511 0 Direct 96.8 8021 16349 10418 28.8%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.14 96.83 0.00 0.00 0.00 0.0000 0.0000 1008871.10 1008871.10 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.21% 68.96 15 166 8021.11 7921 9170 8020.74 7921 8634 553097 553097 0.00%
crit 28.79% 27.88 5 76 16348.67 16159 18707 16350.79 16159 17590 455774 455774 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24330.91
  • base_dd_max:24330.91
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 4259 0.5% 26.4 10.32s 48499 62998 Direct 26.3 34206 69928 48762 40.7%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.43 26.29 0.00 0.00 0.00 0.7699 0.0000 1281699.93 1281699.93 0.00% 62998.28 62998.28
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.26% 15.58 5 27 34205.94 15081 65635 34135.00 24904 43726 532783 532783 0.00%
crit 40.74% 10.71 1 23 69928.04 30766 133895 69754.72 37402 97618 748917 748917 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    aoe
    [O]:24.51
  • if_expr:!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.800Spell Data
Eclipse (Solar)4851710.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Lunar)4851810.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
Base
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Base
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Base
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Base
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 180.88s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    aoe
    [N]:2.00
  • if_expr:variable.cd_condition_aoe

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.2 64.69s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.23 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Base
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:70932.17
  • base_dd_max:70932.17
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.38s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Base
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.74
Elemental Potion of Ultimate Power 1.4 305.47s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.44 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.44
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 17.4 6.0 17.7s 13.4s 9.6s 55.85% 57.87% 6.0 (20.5) 16.8

Buff Details

  • buff initial source:Base
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 50.9s
  • trigger_min/max:0.0s / 38.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.9s
  • uptime_min/max:51.35% / 59.68%

Stack Uptimes

  • balance_of_all_things_arcane_1:5.73%
  • balance_of_all_things_arcane_2:6.13%
  • balance_of_all_things_arcane_3:6.62%
  • balance_of_all_things_arcane_4:7.04%
  • balance_of_all_things_arcane_5:7.33%
  • balance_of_all_things_arcane_6:7.55%
  • balance_of_all_things_arcane_7:7.68%
  • balance_of_all_things_arcane_8:7.76%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 10.2 0.0 29.8s 29.7s 7.9s 27.19% 30.45% 0.0 (0.0) 10.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 47.3s
  • trigger_min/max:4.0s / 47.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:24.65% / 30.00%

Stack Uptimes

  • balance_of_all_things_nature_1:3.36%
  • balance_of_all_things_nature_2:3.38%
  • balance_of_all_things_nature_3:3.39%
  • balance_of_all_things_nature_4:3.40%
  • balance_of_all_things_nature_5:3.41%
  • balance_of_all_things_nature_6:3.41%
  • balance_of_all_things_nature_7:3.42%
  • balance_of_all_things_nature_8:3.43%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 15.1 86.4 20.3s 2.9s 17.5s 88.22% 0.00% 35.5 (35.5) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 59.1s
  • trigger_min/max:0.8s / 13.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:82.46% / 93.23%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:13.34%
  • balance_t31_4pc_buff_lunar_2:13.67%
  • balance_t31_4pc_buff_lunar_3:13.98%
  • balance_t31_4pc_buff_lunar_4:11.75%
  • balance_t31_4pc_buff_lunar_5:35.48%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 8.2 57.1 38.0s 4.4s 18.9s 52.00% 0.00% 26.4 (26.4) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.1s / 84.0s
  • trigger_min/max:0.8s / 39.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.22% / 59.41%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:7.42%
  • balance_t31_4pc_buff_solar_2:6.46%
  • balance_t31_4pc_buff_solar_3:6.29%
  • balance_t31_4pc_buff_solar_4:6.43%
  • balance_t31_4pc_buff_solar_5:25.39%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 70.2s 70.2s 10.8s 10.12% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 337.1s
  • trigger_min/max:12.0s / 337.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 36.70%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.90%
  • best_friends_with_aerwynn_2:0.91%
  • best_friends_with_aerwynn_3:0.91%
  • best_friends_with_aerwynn_4:0.91%
  • best_friends_with_aerwynn_5:0.92%
  • best_friends_with_aerwynn_6:0.92%
  • best_friends_with_aerwynn_7:0.92%
  • best_friends_with_aerwynn_8:0.93%
  • best_friends_with_aerwynn_9:0.93%
  • best_friends_with_aerwynn_10:0.93%
  • best_friends_with_aerwynn_11:0.94%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 113.7s 70.2s 45.3s 33.46% 0.00% 69.6 (69.6) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 342.5s
  • trigger_min/max:12.0s / 337.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 303.3s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.46%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 69.2s 69.2s 10.8s 10.17% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 329.2s
  • trigger_min/max:12.0s / 329.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 38.11%

Stack Uptimes

  • best_friends_with_pip_1:0.91%
  • best_friends_with_pip_2:0.91%
  • best_friends_with_pip_3:0.91%
  • best_friends_with_pip_4:0.92%
  • best_friends_with_pip_5:0.92%
  • best_friends_with_pip_6:0.92%
  • best_friends_with_pip_7:0.93%
  • best_friends_with_pip_8:0.93%
  • best_friends_with_pip_9:0.93%
  • best_friends_with_pip_10:0.94%
  • best_friends_with_pip_11:0.94%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 113.1s 69.2s 45.6s 33.53% 0.00% 69.2 (69.2) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 358.0s
  • trigger_min/max:12.0s / 329.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 305.7s
  • uptime_min/max:0.00% / 98.38%

Stack Uptimes

  • best_friends_with_pip_static_1:33.53%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 70.0s 70.0s 10.8s 10.09% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 350.0s
  • trigger_min/max:12.0s / 350.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 33.83%

Stack Uptimes

  • best_friends_with_urctos_1:0.90%
  • best_friends_with_urctos_2:0.90%
  • best_friends_with_urctos_3:0.91%
  • best_friends_with_urctos_4:0.91%
  • best_friends_with_urctos_5:0.91%
  • best_friends_with_urctos_6:0.92%
  • best_friends_with_urctos_7:0.92%
  • best_friends_with_urctos_8:0.92%
  • best_friends_with_urctos_9:0.93%
  • best_friends_with_urctos_10:0.93%
  • best_friends_with_urctos_11:0.93%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 113.0s 70.0s 44.7s 33.01% 0.00% 69.3 (69.3) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:13.3s / 350.0s
  • trigger_min/max:12.0s / 350.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 297.1s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.01%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.54% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.54%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 61.7s 58.1s 49.9s 80.11% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 335.0s
  • trigger_min/max:15.0s / 304.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 359.7s
  • uptime_min/max:44.29% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.11%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dreamstate 15.3 0.1 20.3s 21.3s 2.1s 10.81% 20.61% 0.1 (0.1) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.6s / 54.5s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.4s
  • uptime_min/max:6.94% / 15.61%

Stack Uptimes

  • dreamstate_1:7.36%
  • dreamstate_2:3.45%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 13.2 8.1 23.6s 14.8s 21.0s 93.11% 93.82% 8.1 (8.1) 12.3

Buff Details

  • buff initial source:Base
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.6s / 71.2s
  • trigger_min/max:0.0s / 57.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.0s
  • uptime_min/max:89.84% / 95.99%

Stack Uptimes

  • eclipse_lunar_1:93.11%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 8.2 0.0 38.1s 38.1s 19.1s 52.75% 54.68% 0.0 (0.0) 7.9

Buff Details

  • buff initial source:Base
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 84.4s
  • trigger_min/max:12.0s / 84.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:47.06% / 59.74%

Stack Uptimes

  • eclipse_solar_1:52.75%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 305.8s 305.8s 27.4s 12.91% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 325.7s
  • trigger_min/max:300.0s / 325.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.77% / 17.86%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.91%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Fury of Elune 5.1 0.0 65.1s 65.1s 7.9s 13.51% 0.00% 75.7 (75.7) 4.9

Buff Details

  • buff initial source:Base
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:60.0s / 88.7s
  • trigger_min/max:60.0s / 88.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:10.91% / 15.67%

Stack Uptimes

  • fury_of_elune_1:13.51%

Spelldata

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 8.2 0.0 38.1s 38.1s 19.1s 52.75% 55.39% 0.0 (0.0) 7.9

Buff Details

  • buff initial source:Base
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 84.4s
  • trigger_min/max:12.0s / 84.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:47.06% / 59.74%

Stack Uptimes

  • incarnation_chosen_of_elune_1:52.75%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.7 0.0 90.9s 90.9s 19.5s 24.01% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:Base
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:65.76

Trigger Details

  • interval_min/max:90.0s / 122.4s
  • trigger_min/max:90.0s / 122.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:21.18% / 26.98%

Stack Uptimes

  • kindled_soul_5:1.17%
  • kindled_soul_10:1.18%
  • kindled_soul_15:1.18%
  • kindled_soul_20:1.18%
  • kindled_soul_25:1.18%
  • kindled_soul_30:1.19%
  • kindled_soul_35:1.19%
  • kindled_soul_40:1.19%
  • kindled_soul_45:1.20%
  • kindled_soul_50:1.20%
  • kindled_soul_55:1.20%
  • kindled_soul_60:1.20%
  • kindled_soul_65:1.21%
  • kindled_soul_70:1.21%
  • kindled_soul_75:1.21%
  • kindled_soul_80:1.22%
  • kindled_soul_85:1.22%
  • kindled_soul_90:1.22%
  • kindled_soul_95:1.23%
  • kindled_soul_100:1.23%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Vigil 3.7 0.0 90.4s 90.4s 14.7s 18.42% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:Base
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.5s
  • trigger_min/max:90.0s / 91.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.52% / 21.01%

Stack Uptimes

  • natures_vigil_1:18.42%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.0 69.6s 69.0s 0.9s 0.75% 1.16% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 342.1s
  • trigger_min/max:0.0s / 342.1s
  • trigger_pct:14.86%
  • duration_min/max:0.0s / 6.2s
  • uptime_min/max:0.00% / 4.89%

Stack Uptimes

  • owlkin_frenzy_1:0.75%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 9.2 96.4 34.0s 34.0s 29.8s 91.37% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:21.0s / 46.8s
  • trigger_min/max:21.0s / 46.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.7s
  • uptime_min/max:87.41% / 94.83%

Stack Uptimes

  • primordial_arcanic_pulsar_5:7.24%
  • primordial_arcanic_pulsar_10:6.73%
  • primordial_arcanic_pulsar_15:7.53%
  • primordial_arcanic_pulsar_20:8.34%
  • primordial_arcanic_pulsar_25:8.63%
  • primordial_arcanic_pulsar_30:8.40%
  • primordial_arcanic_pulsar_35:8.67%
  • primordial_arcanic_pulsar_40:9.03%
  • primordial_arcanic_pulsar_45:9.08%
  • primordial_arcanic_pulsar_50:8.81%
  • primordial_arcanic_pulsar_55:8.90%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 19.7 3.7 15.6s 13.4s 6.7s 43.99% 43.20% 3.7 (3.7) 19.3

Buff Details

  • buff initial source:Base
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 44.7s
  • trigger_min/max:0.0s / 38.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:39.87% / 47.10%

Stack Uptimes

  • solstice_1:43.99%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starfall 104.7 0.0 143.0s 2.8s 295.6s 98.88% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_starfall
  • max_stacks:20
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:asynchronous
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.8s / 357.3s
  • trigger_min/max:0.7s / 8.4s
  • trigger_pct:99.99%
  • duration_min/max:24.5s / 358.1s
  • uptime_min/max:98.32% / 99.49%

Stack Uptimes

  • starfall_1:5.25%
  • starfall_2:32.49%
  • starfall_3:42.26%
  • starfall_4:15.17%
  • starfall_5:3.36%
  • starfall_6:0.36%
  • starfall_7:0.00%

Spelldata

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]
  • max_stacks:20
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Starlord 21.0 83.7 14.5s 2.8s 13.9s 97.49% 0.00% 42.4 (42.4) 6.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 19.2s
  • trigger_min/max:0.8s / 8.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:94.53% / 99.39%

Stack Uptimes

  • starlord_1:12.60%
  • starlord_2:17.67%
  • starlord_3:67.21%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Umbral Embrace 23.1 2.7 12.7s 11.3s 1.6s 12.45% 0.00% 2.7 (2.7) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_umbral_embrace
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 55.5s
  • trigger_min/max:0.0s / 55.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.7s
  • uptime_min/max:4.52% / 23.21%

Stack Uptimes

  • umbral_embrace_1:12.45%

Spelldata

  • id:393763
  • name:Umbral Embrace
  • tooltip:Your next Wrath or Starfire cast during an Eclipse deals Astral damage and deals {$=}w1% additional damage.
  • description:{$@spelldesc393760=Dealing Astral damage has a chance to cause your next Wrath or Starfire cast during an Eclipse to become Astral and deal {$s1=25}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Wafting Devotion 4.3 1.2 61.1s 45.7s 16.5s 23.52% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 205.8s
  • trigger_min/max:0.0s / 201.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 71.3s
  • uptime_min/max:4.82% / 59.15%

Stack Uptimes

  • wafting_devotion_1:23.52%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:Base
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:Base
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:Base
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:Base
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:Base
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:Base
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:Base
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Primordial Arcanic Pulsar 8.3 6.0 10.0 35.2s 22.7s 47.3s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.05% 0.00% 0.63% 0.0s 0.0s 1.0s
Astral Smolder 75.00% 63.07% 84.45% 4.3s 0.0s 49.4s
Incarnation (Total) 52.75% 47.06% 59.74% 19.1s 0.0s 54.0s
Incarnation (Pulsar) 32.44% 29.66% 35.04% 11.8s 0.0s 12.0s
Lunar Eclipse Only 40.36% 32.57% 46.46% 9.2s 0.0s 15.0s
No Eclipse 6.86% 4.01% 9.94% 1.7s 0.0s 4.6s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Fury of Elune5.2460.00028.71026.8476.31074.709

Eclipse Utilization

NoneSolarLunarBoth
Wrath24.43100.0%0.000.0%0.000.0%0.000.0%
Starfire2.472.1%0.000.0%49.8041.9%66.4856.0%
Starfall20.787.0%0.000.0%117.8239.8%157.0953.1%
Fury of Elune15.642.0%0.000.0%142.7818.7%605.3179.3%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Base
Fury of EluneAstral Power80.67241.625.79%3.000.380.16%
MoonfireAstral Power3.0018.000.43%6.000.000.00%
Orbit BreakerAstral Power15.78471.1911.29%29.862.150.45%
Shooting Stars (Moonfire)Astral Power235.82471.3511.29%2.000.300.06%
Shooting Stars (Sunfire)Astral Power237.53474.7611.37%2.000.300.06%
StarfireAstral Power118.742226.9453.35%18.7535.191.56%
SunfireAstral Power1.006.000.14%6.000.000.00%
WrathAstral Power26.43264.296.33%10.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
Base
StarfallAstral Power 105.064135.05100.00%39.3639.5022291.52
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 896660.0 4277.84 4927.50 3505675.0 702094.0 -146904.8 896660.0
Astral Power 20.0 13.94 13.76 38.3 53.6 0.8 100.0

Statistics & Data Analysis

Fight Length
Base Fight Length
Count 9131
Mean 299.49
Minimum 240.01
Maximum 359.95
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 34.4322
5th Percentile 245.77
95th Percentile 353.55
( 95th Percentile - 5th Percentile ) 107.78
Mean Distribution
Standard Deviation 0.3603
95.00% Confidence Interval ( 298.78 - 300.20 )
Normalized 95.00% Confidence Interval ( 99.76% - 100.24% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 508
0.1% Error 50777
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1013
DPS
Base Damage Per Second
Count 9131
Mean 928017.98
Minimum 858030.54
Maximum 1031569.60
Spread ( max - min ) 173539.06
Range [ ( max - min ) / 2 * 100% ] 9.35%
Standard Deviation 22501.0909
5th Percentile 892815.06
95th Percentile 966542.02
( 95th Percentile - 5th Percentile ) 73726.96
Mean Distribution
Standard Deviation 235.4748
95.00% Confidence Interval ( 927556.45 - 928479.50 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2259
0.1 Scale Factor Error with Delta=300 4322061
0.05 Scale Factor Error with Delta=300 17288241
0.01 Scale Factor Error with Delta=300 432206024
Priority Target DPS
Base Priority Target Damage Per Second
Count 9131
Mean 169351.98
Minimum 151373.62
Maximum 191066.38
Spread ( max - min ) 39692.76
Range [ ( max - min ) / 2 * 100% ] 11.72%
Standard Deviation 5346.6655
5th Percentile 160740.79
95th Percentile 178368.37
( 95th Percentile - 5th Percentile ) 17627.59
Mean Distribution
Standard Deviation 55.9531
95.00% Confidence Interval ( 169242.31 - 169461.64 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3829
0.1 Scale Factor Error with Delta=300 244034
0.05 Scale Factor Error with Delta=300 976135
0.01 Scale Factor Error with Delta=300 24403365
DPS(e)
Base Damage Per Second (Effective)
Count 9131
Mean 928017.98
Minimum 858030.54
Maximum 1031569.60
Spread ( max - min ) 173539.06
Range [ ( max - min ) / 2 * 100% ] 9.35%
Damage
Base Damage
Count 9131
Mean 277467685.15
Minimum 217171510.26
Maximum 339011895.14
Spread ( max - min ) 121840384.88
Range [ ( max - min ) / 2 * 100% ] 21.96%
DTPS
Base Damage Taken Per Second
Count 9131
Mean 4928.72
Minimum 1340.99
Maximum 10484.61
Spread ( max - min ) 9143.62
Range [ ( max - min ) / 2 * 100% ] 92.76%
HPS
Base Healing Per Second
Count 9131
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Base Healing Per Second (Effective)
Count 9131
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Base Heal
Count 9131
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Base Healing Taken Per Second
Count 9131
Mean 4270.01
Minimum 922.26
Maximum 8931.01
Spread ( max - min ) 8008.75
Range [ ( max - min ) / 2 * 100% ] 93.78%
TMI
Base Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
BaseTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Base Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.44 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.68 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.74 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.aoe
# count action,conditions
0.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
0.00 variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
I 1.00 sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
J 3.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
0.00 variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
K 13.97 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
L 70.48 starfall,if=variable.starfall_condition1
M 1.26 starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
0.00 celestial_alignment,if=variable.cd_condition_aoe
N 2.00 incarnation,if=variable.cd_condition_aoe
0.00 warrior_of_elune
0.00 variable,name=enter_solar,value=spell_targets.starfire<3
0.00 starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
O 24.51 wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
0.00 wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
P 5.12 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
Q 34.21 starfall,if=variable.starfall_condition2
0.00 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+50
0.00 convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 new_moon,if=astral_power.deficit>variable.passive_asp+10
0.00 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
R 117.00 starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
0.00 wrath
S 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFIJJJLMNDEPLLRRLRLRLRLRKLQRRQRRRLRLRLRKLQRQRRRLRLLRRKLQROOQRRRLRKLQRRLRLPRLOLORLQRRQRRLRLOOQRFRQRQERRLRKLQOOQRRRLRRKLRQROOQRLRRKLQPRQRLRLRLOOKLRQRQRRRLROOLRLQRRRLRRLRLLRLOOFMLRLNRERLRLLPQRRLRLRLRKLQQRRRLRLRRKLQRQRRRLOORLRLQRQRRLRLOORKLQRRLRPLRLOOLRR

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask Base 0.0/100: 0% astral_power
Pre precombat 1 food Base 0.0/100: 0% astral_power corrupting_rage
Pre precombat 2 augmentation Base 0.0/100: 0% astral_power corrupting_rage
Pre precombat 4 no_cd_talent Base 0.0/100: 0% astral_power corrupting_rage
Pre precombat 5 on_use_trinket Base 0.0/100: 0% astral_power corrupting_rage
Pre precombat 6 on_use_trinket Base 0.0/100: 0% astral_power corrupting_rage
Pre precombat 7 on_use_trinket Base 0.0/100: 0% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 10.0/100: 10% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil Base 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.000 aoe I sunfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.927 aoe J moonfire Fluffy_Pillow 47.2/100: 47% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:01.855 aoe J moonfire enemy2 59.2/100: 59% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, owlkin_frenzy, solstice, dreamstate, corrupting_rage
0:02.783 aoe J moonfire enemy5 69.2/100: 69% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, owlkin_frenzy, solstice, dreamstate, corrupting_rage
0:03.712 aoe L starfall Fluffy_Pillow 81.2/100: 81% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, owlkin_frenzy, solstice, dreamstate, corrupting_rage
0:04.641 aoe M starfire Fluffy_Pillow 40.2/100: 40% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, owlkin_frenzy, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, corrupting_rage
0:05.396 aoe N incarnation_chosen_of_elune Fluffy_Pillow 63.4/100: 63% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, corrupting_rage
0:05.396 default D potion Fluffy_Pillow 63.4/100: 63% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), corrupting_rage
0:05.396 default E use_items Fluffy_Pillow 63.4/100: 63% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power
0:05.396 aoe P fury_of_elune Fluffy_Pillow 63.4/100: 63% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:06.208 aoe L starfall Fluffy_Pillow 70.4/100: 70% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:07.019 aoe L starfall Fluffy_Pillow 45.4/100: 45% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:07.802 aoe R starfire Fluffy_Pillow 49.4/100: 49% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:08.558 aoe R starfire Fluffy_Pillow 78.6/100: 79% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:09.313 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:10.068 aoe R starfire Fluffy_Pillow 77.0/100: 77% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
0:11.199 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:11.953 aoe R starfire Fluffy_Pillow 73.0/100: 73% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
0:13.084 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:13.839 aoe R starfire Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:14.969 aoe L starfall Fluffy_Pillow 91.2/100: 91% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:15.722 aoe R starfire Fluffy_Pillow 58.2/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:16.852 aoe K cancel_buff Fluffy_Pillow 81.4/100: 81% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:16.852 aoe L starfall Fluffy_Pillow 81.4/100: 81% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:17.697 aoe Q starfall Fluffy_Pillow 50.4/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:18.510 aoe R starfire Fluffy_Pillow 15.4/100: 15% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(5), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:19.682 aoe R starfire Fluffy_Pillow 34.6/100: 35% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:20.853 aoe Q starfall Fluffy_Pillow 53.8/100: 54% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:21.636 aoe R starfire Fluffy_Pillow 18.8/100: 19% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:22.766 aoe R starfire Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:23.895 aoe R starfire Fluffy_Pillow 63.2/100: 63% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:25.024 aoe L starfall Fluffy_Pillow 84.4/100: 84% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:25.779 aoe R starfire Fluffy_Pillow 49.4/100: 49% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:26.909 aoe L starfall Fluffy_Pillow 72.6/100: 73% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:27.664 aoe R starfire Fluffy_Pillow 71.6/100: 72% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:28.794 aoe L starfall Fluffy_Pillow 96.8/100: 97% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:29.546 aoe R starfire Fluffy_Pillow 65.8/100: 66% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:30.676 aoe K cancel_buff Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:30.676 aoe L starfall Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:31.520 aoe Q starfall Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:32.332 aoe R starfire Fluffy_Pillow 33.0/100: 33% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), solstice, starfall(5), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:33.504 aoe Q starfall Fluffy_Pillow 56.2/100: 56% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:34.285 aoe R starfire Fluffy_Pillow 23.2/100: 23% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:35.416 aoe R starfire Fluffy_Pillow 46.4/100: 46% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:36.544 aoe R starfire Fluffy_Pillow 69.6/100: 70% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:37.675 aoe L starfall Fluffy_Pillow 94.8/100: 95% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:38.429 aoe R starfire Fluffy_Pillow 63.8/100: 64% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:39.559 aoe L starfall Fluffy_Pillow 85.0/100: 85% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:40.314 aoe L starfall Fluffy_Pillow 52.0/100: 52% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:41.293 aoe R starfire Fluffy_Pillow 17.0/100: 17% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:42.760 aoe R starfire Fluffy_Pillow 70.2/100: 70% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:44.227 aoe K cancel_buff Fluffy_Pillow 91.4/100: 91% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:44.227 aoe L starfall Fluffy_Pillow 91.4/100: 91% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:45.324 aoe Q starfall Fluffy_Pillow 58.4/100: 58% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:46.379 aoe R starfire Fluffy_Pillow 25.4/100: 25% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:47.902 aoe O wrath Fluffy_Pillow 37.4/100: 37% astral_power primordial_arcanic_pulsar(45), starfall(3), starlord(2), dreamstate, corrupting_rage
0:48.658 aoe O wrath Fluffy_Pillow 47.4/100: 47% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(2), corrupting_rage
0:49.413 aoe Q starfall Fluffy_Pillow 57.4/100: 57% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), wafting_devotion, corrupting_rage
0:50.449 aoe R starfire Fluffy_Pillow 16.4/100: 16% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, wafting_devotion, corrupting_rage
0:51.947 aoe R starfire Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos(11), wafting_devotion, corrupting_rage
0:53.445 aoe R starfire Fluffy_Pillow 68.8/100: 69% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos(10), wafting_devotion, corrupting_rage
0:54.941 aoe L starfall Fluffy_Pillow 98.0/100: 98% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos(8), wafting_devotion, corrupting_rage
0:55.940 aoe R starfire Fluffy_Pillow 57.0/100: 57% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(7), wafting_devotion, corrupting_rage
0:57.435 aoe K cancel_buff Fluffy_Pillow 78.2/100: 78% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(6), wafting_devotion
0:57.435 aoe L starfall Fluffy_Pillow 78.2/100: 78% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(6), wafting_devotion
0:58.556 aoe Q starfall Fluffy_Pillow 39.2/100: 39% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(5), wafting_devotion
0:59.533 aoe R starfire Fluffy_Pillow 10.2/100: 10% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(4), wafting_devotion
1:00.947 aoe R starfire Fluffy_Pillow 33.4/100: 33% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(2), wafting_devotion
1:02.358 aoe L starfall Fluffy_Pillow 92.6/100: 93% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos, wafting_devotion
1:03.301 aoe R starfire Fluffy_Pillow 61.6/100: 62% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), wafting_devotion
1:04.661 aoe L starfall Fluffy_Pillow 84.8/100: 85% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5)
1:05.641 aoe P fury_of_elune Fluffy_Pillow 51.8/100: 52% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5)
1:06.619 aoe R starfire Fluffy_Pillow 56.8/100: 57% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5)
1:08.086 aoe L starfall Fluffy_Pillow 87.0/100: 87% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5)
1:09.066 aoe O wrath Fluffy_Pillow 58.0/100: 58% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5)
1:10.045 aoe L starfall Fluffy_Pillow 76.0/100: 76% astral_power fury_of_elune, primordial_arcanic_pulsar(20), starfall(3), starlord(3), dreamstate(2)
1:11.122 aoe O wrath Fluffy_Pillow 37.0/100: 37% astral_power fury_of_elune, primordial_arcanic_pulsar(25), starfall(3), starlord(3), dreamstate, corrupting_rage
1:11.877 aoe R starfire Fluffy_Pillow 55.0/100: 55% astral_power balance_of_all_things_arcane(8), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), corrupting_rage
1:12.847 aoe L starfall Fluffy_Pillow 86.2/100: 86% astral_power balance_of_all_things_arcane(7), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(2), corrupting_rage
1:14.053 aoe Q starfall Fluffy_Pillow 51.2/100: 51% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar, corrupting_rage
1:15.212 aoe R starfire Fluffy_Pillow 10.2/100: 10% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(4), starlord(2), balance_t31_4pc_buff_lunar(2), corrupting_rage
1:16.885 aoe R starfire Fluffy_Pillow 37.4/100: 37% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar(2), corrupting_rage
1:18.561 aoe Q starfall Fluffy_Pillow 60.6/100: 61% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), corrupting_rage
1:19.679 aoe R starfire Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), corrupting_rage
1:21.294 aoe R starfire Fluffy_Pillow 40.8/100: 41% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), corrupting_rage
1:22.910 aoe L starfall Fluffy_Pillow 96.0/100: 96% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), corrupting_rage
1:23.986 aoe R starfire Fluffy_Pillow 53.0/100: 53% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), corrupting_rage
1:25.599 aoe L starfall Fluffy_Pillow 76.2/100: 76% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), corrupting_rage
1:26.677 aoe O wrath Fluffy_Pillow 31.2/100: 31% astral_power eclipse_lunar, primordial_arcanic_pulsar(50), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(5), corrupting_rage
1:27.753 aoe O wrath Fluffy_Pillow 41.2/100: 41% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord(3), dreamstate, corrupting_rage
1:28.507 aoe Q starfall Fluffy_Pillow 51.2/100: 51% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), dreamstate, corrupting_rage
1:29.714 aoe R starfire Fluffy_Pillow 16.2/100: 16% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar, corrupting_rage
1:30.757 default F natures_vigil Base 37.4/100: 37% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar, corrupting_rage
1:30.757 aoe R starfire Fluffy_Pillow 37.4/100: 37% astral_power natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar, corrupting_rage
1:32.495 aoe Q starfall Fluffy_Pillow 64.6/100: 65% astral_power natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, corrupting_rage
1:33.654 aoe R starfire Fluffy_Pillow 23.6/100: 24% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), corrupting_rage
1:35.176 aoe Q starfall Fluffy_Pillow 50.8/100: 51% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), corrupting_rage
1:36.192 default E use_items Fluffy_Pillow 19.8/100: 20% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), corrupting_rage
1:36.192 aoe R starfire Fluffy_Pillow 19.8/100: 20% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), corrupting_rage, kindled_soul(100)
1:37.658 aoe R starfire Fluffy_Pillow 43.0/100: 43% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), corrupting_rage, kindled_soul(95)
1:39.124 aoe L starfall Fluffy_Pillow 68.2/100: 68% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), corrupting_rage, kindled_soul(90)
1:40.105 aoe R starfire Fluffy_Pillow 35.2/100: 35% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), corrupting_rage, kindled_soul(85)
1:41.572 aoe K cancel_buff Fluffy_Pillow 54.4/100: 54% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), corrupting_rage, kindled_soul(75)
1:41.572 aoe L starfall Fluffy_Pillow 54.4/100: 54% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), corrupting_rage, kindled_soul(75)
1:42.667 aoe Q starfall Fluffy_Pillow 51.4/100: 51% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord, umbral_embrace, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), corrupting_rage, kindled_soul(70)
1:43.721 aoe O wrath Fluffy_Pillow 20.4/100: 20% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(2), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, kindled_soul(65)
1:44.735 aoe O wrath Fluffy_Pillow 32.4/100: 32% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(3), starlord(2), umbral_embrace, dreamstate, corrupting_rage, kindled_soul(60)
1:45.489 aoe Q starfall Fluffy_Pillow 46.4/100: 46% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(2), umbral_embrace, dreamstate, corrupting_rage, kindled_soul(55)
1:46.607 aoe R starfire Fluffy_Pillow 5.4/100: 5% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar, corrupting_rage, kindled_soul(50)
1:47.576 aoe R starfire Fluffy_Pillow 28.6/100: 29% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, corrupting_rage, kindled_soul(45)
1:49.192 aoe R starfire Fluffy_Pillow 53.8/100: 54% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(35)
1:50.807 aoe L starfall Fluffy_Pillow 81.0/100: 81% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(30)
1:51.884 aoe R starfire Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(25)
1:53.498 aoe R starfire Fluffy_Pillow 59.2/100: 59% astral_power eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(15)
1:55.112 aoe K cancel_buff Fluffy_Pillow 80.4/100: 80% astral_power eclipse_lunar, primordial_arcanic_pulsar(30), starfall, starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(10)
1:55.112 aoe L starfall Fluffy_Pillow 80.4/100: 80% astral_power eclipse_lunar, primordial_arcanic_pulsar(30), starfall, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(10)
1:56.319 aoe R starfire Fluffy_Pillow 37.4/100: 37% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, corrupting_rage
1:58.055 aoe Q starfall Fluffy_Pillow 58.6/100: 59% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static, corrupting_rage
1:59.215 aoe R starfire Fluffy_Pillow 17.6/100: 18% astral_power eclipse_lunar, owlkin_frenzy, primordial_arcanic_pulsar(40), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, corrupting_rage
2:00.334 aoe O wrath Fluffy_Pillow 38.8/100: 39% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, corrupting_rage
2:01.452 aoe O wrath Fluffy_Pillow 50.8/100: 51% astral_power primordial_arcanic_pulsar(40), starfall(2), starlord(2), dreamstate, best_friends_with_aerwynn_static, corrupting_rage
2:02.207 aoe Q starfall Fluffy_Pillow 60.8/100: 61% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(40), solstice, starfall(2), starlord(2), dreamstate, best_friends_with_aerwynn_static, corrupting_rage
2:03.324 aoe R starfire Fluffy_Pillow 21.8/100: 22% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage
2:04.294 aoe L starfall Fluffy_Pillow 79.0/100: 79% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage
2:05.373 aoe R starfire Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar(2), best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage
2:06.987 aoe R starfire Fluffy_Pillow 67.2/100: 67% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar(2), best_friends_with_pip(8), best_friends_with_pip_static, corrupting_rage
2:08.601 aoe K cancel_buff Fluffy_Pillow 94.4/100: 94% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(50), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage
2:08.601 aoe L starfall Fluffy_Pillow 94.4/100: 94% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(50), starfall(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage
2:09.808 aoe Q starfall Fluffy_Pillow 49.4/100: 49% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(3), starlord, balance_t31_4pc_buff_lunar(3), best_friends_with_pip(5), best_friends_with_pip_static, corrupting_rage
2:10.968 aoe P fury_of_elune Fluffy_Pillow 10.4/100: 10% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(4), best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage
2:11.983 aoe R starfire Fluffy_Pillow 20.4/100: 20% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(4), best_friends_with_pip(3), best_friends_with_pip_static, corrupting_rage
2:13.504 aoe Q starfall Fluffy_Pillow 58.6/100: 59% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(4), best_friends_with_pip, best_friends_with_pip_static, corrupting_rage
2:14.519 aoe R starfire Fluffy_Pillow 35.6/100: 36% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
2:15.986 aoe L starfall Fluffy_Pillow 67.8/100: 68% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
2:16.966 aoe R starfire Fluffy_Pillow 37.8/100: 38% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
2:18.433 aoe L starfall Fluffy_Pillow 66.0/100: 66% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
2:19.412 aoe R starfire Fluffy_Pillow 69.0/100: 69% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
2:20.880 aoe L starfall Fluffy_Pillow 88.2/100: 88% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
2:21.860 aoe O wrath Fluffy_Pillow 55.2/100: 55% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage
2:22.616 aoe O wrath Fluffy_Pillow 67.2/100: 67% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage
2:23.368 aoe K cancel_buff Fluffy_Pillow 79.2/100: 79% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage
2:23.368 aoe L starfall Fluffy_Pillow 79.2/100: 79% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), best_friends_with_pip_static, corrupting_rage
2:24.575 aoe R starfire Fluffy_Pillow 40.2/100: 40% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
2:26.312 aoe Q starfall Fluffy_Pillow 65.4/100: 65% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
2:27.472 aoe R starfire Fluffy_Pillow 28.4/100: 28% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
2:29.147 aoe Q starfall Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
2:30.266 aoe R starfire Fluffy_Pillow 8.6/100: 9% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
2:31.878 aoe R starfire Fluffy_Pillow 27.8/100: 28% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
2:33.494 aoe R starfire Fluffy_Pillow 49.0/100: 49% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
2:35.109 aoe L starfall Fluffy_Pillow 72.2/100: 72% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:36.109 aoe R starfire Fluffy_Pillow 31.2/100: 31% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:37.606 aoe O wrath Fluffy_Pillow 50.4/100: 50% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:38.607 aoe O wrath Fluffy_Pillow 62.4/100: 62% astral_power primordial_arcanic_pulsar(40), starfall, dreamstate, best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:39.361 aoe L starfall Fluffy_Pillow 76.4/100: 76% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(40), solstice, starfall, dreamstate, best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:40.482 aoe R starfire Fluffy_Pillow 39.4/100: 39% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:41.451 aoe L starfall Fluffy_Pillow 92.6/100: 93% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:42.527 aoe Q starfall Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:43.562 aoe R starfire Fluffy_Pillow 14.6/100: 15% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:45.059 aoe R starfire Fluffy_Pillow 37.8/100: 38% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:46.556 aoe R starfire Fluffy_Pillow 61.0/100: 61% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:48.053 aoe L starfall Fluffy_Pillow 82.2/100: 82% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:49.053 aoe R starfire Fluffy_Pillow 45.2/100: 45% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
2:50.521 aoe R starfire Fluffy_Pillow 70.4/100: 70% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
2:51.986 aoe L starfall Fluffy_Pillow 95.6/100: 96% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
2:52.967 aoe R starfire Fluffy_Pillow 64.6/100: 65% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
2:54.435 aoe L starfall Fluffy_Pillow 89.8/100: 90% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
2:55.533 aoe L starfall Fluffy_Pillow 58.8/100: 59% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
2:56.587 aoe R starfire Fluffy_Pillow 23.8/100: 24% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
2:58.109 aoe L starfall Fluffy_Pillow 79.0/100: 79% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
2:59.125 aoe O wrath Fluffy_Pillow 46.0/100: 46% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:00.105 aoe O wrath Fluffy_Pillow 58.0/100: 58% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage
3:00.859 default F natures_vigil Base 70.0/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage
3:00.859 aoe M starfire Fluffy_Pillow 70.0/100: 70% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage
3:01.828 aoe L starfall Fluffy_Pillow 97.2/100: 97% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage
3:02.906 aoe R starfire Fluffy_Pillow 58.2/100: 58% astral_power natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage
3:04.521 aoe L starfall Fluffy_Pillow 85.4/100: 85% astral_power natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage
3:05.598 aoe N incarnation_chosen_of_elune Fluffy_Pillow 44.4/100: 44% astral_power natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(7), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:05.598 aoe R starfire Fluffy_Pillow 44.4/100: 44% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), dreamstate, best_friends_with_urctos(7), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:06.416 default E use_items Fluffy_Pillow 67.6/100: 68% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), dreamstate, best_friends_with_urctos(6), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:06.416 aoe R starfire Fluffy_Pillow 67.6/100: 68% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), best_friends_with_urctos(6), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(100)
3:07.235 aoe L starfall Fluffy_Pillow 92.8/100: 93% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), best_friends_with_urctos(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(100)
3:08.145 aoe R starfire Fluffy_Pillow 61.8/100: 62% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(95)
3:09.508 aoe L starfall Fluffy_Pillow 87.0/100: 87% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_urctos(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(85)
3:10.527 aoe L starfall Fluffy_Pillow 88.0/100: 88% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starfall(3), starlord, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(80)
3:11.504 aoe P fury_of_elune Fluffy_Pillow 59.0/100: 59% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), solstice, starfall(4), starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(75)
3:12.445 aoe Q starfall Fluffy_Pillow 64.0/100: 64% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), starfall(4), starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(70)
3:13.388 aoe R starfire Fluffy_Pillow 37.0/100: 37% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(70)
3:14.748 aoe R starfire Fluffy_Pillow 67.2/100: 67% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(11), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(60)
3:16.110 aoe L starfall Fluffy_Pillow 97.4/100: 97% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(9), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(55)
3:17.020 aoe R starfire Fluffy_Pillow 68.4/100: 68% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(50)
3:18.381 aoe L starfall Fluffy_Pillow 95.6/100: 96% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(45)
3:19.291 aoe R starfire Fluffy_Pillow 70.6/100: 71% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(6), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(40)
3:20.652 aoe L starfall Fluffy_Pillow 98.8/100: 99% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(30)
3:21.632 aoe R starfire Fluffy_Pillow 69.8/100: 70% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage, kindled_soul(25)
3:23.101 aoe K cancel_buff Fluffy_Pillow 97.0/100: 97% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage, kindled_soul(20)
3:23.101 aoe L starfall Fluffy_Pillow 97.0/100: 97% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage, kindled_soul(20)
3:24.196 aoe Q starfall Fluffy_Pillow 68.0/100: 68% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage, kindled_soul(15)
3:25.250 aoe Q starfall Fluffy_Pillow 37.0/100: 37% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(10)
3:26.266 aoe R starfire Fluffy_Pillow 4.0/100: 4% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(5)
3:27.734 aoe R starfire Fluffy_Pillow 23.2/100: 23% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:29.201 aoe R starfire Fluffy_Pillow 44.4/100: 44% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:30.669 aoe L starfall Fluffy_Pillow 67.6/100: 68% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:31.649 aoe R starfire Fluffy_Pillow 66.6/100: 67% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:33.116 aoe L starfall Fluffy_Pillow 85.8/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:34.096 aoe R starfire Fluffy_Pillow 50.8/100: 51% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:35.564 aoe R starfire Fluffy_Pillow 72.0/100: 72% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:37.031 aoe K cancel_buff Fluffy_Pillow 95.2/100: 95% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:37.031 aoe L starfall Fluffy_Pillow 95.2/100: 95% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:38.128 aoe Q starfall Fluffy_Pillow 64.2/100: 64% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:39.184 aoe R starfire Fluffy_Pillow 29.2/100: 29% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:40.706 aoe Q starfall Fluffy_Pillow 48.4/100: 48% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:41.722 aoe R starfire Fluffy_Pillow 13.4/100: 13% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:43.191 aoe R starfire Fluffy_Pillow 34.6/100: 35% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:44.657 aoe R starfire Fluffy_Pillow 55.8/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:46.124 aoe L starfall Fluffy_Pillow 77.0/100: 77% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:47.104 aoe O wrath Fluffy_Pillow 42.0/100: 42% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:48.083 aoe O wrath Fluffy_Pillow 56.0/100: 56% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord(3), dreamstate, best_friends_with_urctos_static, corrupting_rage
3:48.839 aoe R starfire Fluffy_Pillow 66.0/100: 66% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), best_friends_with_urctos_static, corrupting_rage
3:49.810 aoe L starfall Fluffy_Pillow 91.2/100: 91% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), best_friends_with_urctos_static, corrupting_rage
3:50.889 aoe R starfire Fluffy_Pillow 52.2/100: 52% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, corrupting_rage
3:52.503 aoe L starfall Fluffy_Pillow 79.4/100: 79% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, corrupting_rage
3:53.709 aoe Q starfall Fluffy_Pillow 40.4/100: 40% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, corrupting_rage
3:54.762 aoe R starfire Fluffy_Pillow 13.4/100: 13% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, corrupting_rage
3:56.283 aoe Q starfall Fluffy_Pillow 66.6/100: 67% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage
3:57.298 aoe R starfire Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage
3:58.765 aoe R starfire Fluffy_Pillow 66.8/100: 67% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage
4:00.232 aoe L starfall Fluffy_Pillow 86.0/100: 86% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage
4:01.213 aoe R starfire Fluffy_Pillow 55.0/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage
4:02.681 aoe L starfall Fluffy_Pillow 78.2/100: 78% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage
4:03.658 aoe O wrath Fluffy_Pillow 45.2/100: 45% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage
4:04.636 aoe O wrath Fluffy_Pillow 57.2/100: 57% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), dreamstate, best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage
4:05.391 aoe R starfire Fluffy_Pillow 69.2/100: 69% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage
4:06.361 aoe K cancel_buff Fluffy_Pillow 94.4/100: 94% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, corrupting_rage
4:06.361 aoe L starfall Fluffy_Pillow 94.4/100: 94% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), best_friends_with_urctos_static, corrupting_rage
4:07.567 aoe Q starfall Fluffy_Pillow 53.4/100: 53% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, corrupting_rage
4:08.725 aoe R starfire Fluffy_Pillow 14.4/100: 14% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, corrupting_rage
4:10.398 aoe R starfire Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, corrupting_rage
4:12.070 aoe L starfall Fluffy_Pillow 64.8/100: 65% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage
4:13.187 aoe R starfire Fluffy_Pillow 51.8/100: 52% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage
4:14.802 aoe P fury_of_elune Fluffy_Pillow 71.0/100: 71% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(8), best_friends_with_pip_static, corrupting_rage
4:15.880 aoe L starfall Fluffy_Pillow 81.0/100: 81% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(35), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(7), best_friends_with_pip_static, corrupting_rage
4:16.958 aoe R starfire Fluffy_Pillow 42.0/100: 42% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage
4:18.571 aoe L starfall Fluffy_Pillow 74.2/100: 74% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(5), best_friends_with_pip_static, corrupting_rage
4:19.648 aoe O wrath Fluffy_Pillow 37.2/100: 37% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(45), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage
4:20.726 aoe O wrath Fluffy_Pillow 57.2/100: 57% astral_power fury_of_elune, primordial_arcanic_pulsar(45), starfall(2), starlord(3), dreamstate, best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage
4:21.481 aoe L starfall Fluffy_Pillow 73.2/100: 73% astral_power balance_of_all_things_arcane(8), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(45), solstice, starfall(2), umbral_embrace, dreamstate, best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage
4:22.686 aoe R starfire Fluffy_Pillow 40.2/100: 40% astral_power balance_of_all_things_arcane(7), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord, umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
4:23.730 aoe R starfire Fluffy_Pillow 64.4/100: 64% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage

Stats

Level Bonus (70) Race Bonus (tauren) Raid-Buffed Unbuffed Gear Amount
Strength 898 2 986 900 0
Agility 2089 -2 2173 2087 0
Stamina 3848 2 44833 42698 38825
Intellect 2089 -2 15807 14885 12090 (7538)
Spirit 0 0 0 0 0
Health 896660 896660 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 15807 14885 0
Crit 28.51% 22.30% 3114
Haste 24.78% 24.78% 4212
Versatility 6.30% 1.30% 267
Mana Regen 2560 2560 0
Attack Power 16439 15480 0
Mastery 29.91% 29.91% 7842
Armor 5324 5324 5324
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 489.00
Local Head Benevolent Embersage's Casque
ilevel: 489, stats: { 673 Armor, +3966 Sta, +704 Crit, +330 Haste, +938 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }, enchant: incandescent_essence
Local Neck Eye of the Rising Flame
ilevel: 489, stats: { +2231 Sta, +256 Haste, +1537 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Life-Bound Shoulderpads
ilevel: 486, stats: { 603 Armor, +2875 Sta, +383 Mastery, +383 Haste, +684 AgiInt }
item effects: { equip: Toxified }
Local Chest Benevolent Embersage's Robe
ilevel: 489, stats: { 897 Armor, +3966 Sta, +715 Crit, +318 Mastery, +938 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 489, stats: { 505 Armor, +2975 Sta, +535 Haste, +241 Mastery, +704 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 489, stats: { 785 Armor, +3966 Sta, +705 Haste, +328 Mastery, +938 AgiInt }, enchant: { +155 StrAgiInt, +41 Vers (lambent_armor_kit_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 486, stats: { 548 Armor, +2875 Sta, +274 Crit, +438 Haste, +684 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Thermal Bindings
ilevel: 489, stats: { 449 Armor, +2231 Sta, +191 Crit, +390 Mastery, +528 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Benevolent Embersage's Talons
ilevel: 489, stats: { 505 Armor, +2975 Sta, +226 Vers, +549 Mastery, +704 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 489, stats: { +2231 Sta, +512 Haste, +1281 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 489, stats: { +2231 Sta, +1230 Crit, +564 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 489, stats: { +892 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 489, stats: { +738 Mastery }
item effects: { use: Balefire Branch }
Local Back Drape of the Loyal Vassal
ilevel: 489, stats: { 359 Armor, +2231 Sta, +328 Haste, +253 Mastery, +528 StrAgiInt }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 489, weapon: { 606 - 781, 2.6 }, stats: { +469 Int, +2264 Int, +1983 Sta, +156 Haste, +361 Mastery }, enchant: wafting_devotion_3
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 489, stats: { +1439 Int, +1983 Sta, +174 Haste, +343 Mastery }

Profile

druid="Base"
source=default
spec=balance
level=70
race=tauren
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=489,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=489,gem_id=192961/192961/192961
shoulders=lifebound_shoulderpads,id=193406,bonus_id=8836/1576/8797/8960,ilevel=486,crafted_stats=49/36
back=drape_of_the_loyal_vassal,id=158375,bonus_id=4795,ilevel=489
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=489,enchant_id=6625
wrists=thermal_bindings,id=134461,bonus_id=4795,ilevel=489,gem_id=192961
hands=benevolent_embersages_talons,id=207255,bonus_id=4795,ilevel=489
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=489,enchant_id=6830
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=486
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=489
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=489
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=489,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=489

# Gear Summary
# gear_ilvl=488.63
# gear_stamina=38825
# gear_intellect=12090
# gear_crit_rating=3114
# gear_haste_rating=4212
# gear_mastery_rating=7842
# gear_versatility_rating=267
# gear_armor=5324
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

buzzing_rune_3 : 941930 dps, 171927 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
941929.7 941929.7 469.6 / 0.050% 88680.7 / 9.4% 68338.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.8 13.9 Astral Power 0.00% 56.4 100.2% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
buzzing_rune_3 941930
Astral Smolder 144442 15.3% 401.4 0.81s 107924 0 Periodic 761.7 56878 0 56878 0.0% 84.7%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 401.45 0.00 761.72 761.72 319.67 0.0000 2.0000 43326008.63 43326008.63 0.00% 28439.72 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 761.72 569 958 56877.74 4650 275508 56960.22 49017 66746 43326009 43326009 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Fury of Elune 28199 3.0% 5.1 65.03s 1649235 1706863 Direct 765.9 6773 14435 11039 55.7%

Stats Details: Fury Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.13 765.87 0.00 0.00 0.00 0.9663 0.0000 8454090.85 8454090.85 0.00% 1706862.68 1706862.68
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 44.33% 339.48 195 508 6773.33 3258 21903 6781.30 5756 7875 2299254 2299254 0.00%
crit 55.67% 426.39 288 612 14435.33 6646 44683 14447.57 12860 16689 6154837 6154837 0.00%

Action Details: Fury Of Elune

  • id:202770
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:astral_power
  • energize_amount:3.0

Spelldata

  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r

Action Details: Fury Of Elune Tick

  • id:211545
  • school:astral
  • range:105.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.149000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:211545
  • name:Fury of Elune
  • school:astral
  • tooltip:
  • description:{$@spelldesc202770=Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r}

Action Priority List

    aoe
    [P]:5.13
  • if_expr:target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Hungering Shadowflame 3907 0.4% 17.1 16.84s 68685 0 Direct 17.1 52081 106331 68684 30.6%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.10 17.10 0.00 0.00 0.00 0.0000 0.0000 1174170.17 1174170.17 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.39% 11.86 2 25 52081.02 34936 202233 51947.84 34936 120281 617783 617783 0.00%
crit 30.61% 5.23 0 17 106330.96 71270 412555 105389.59 0 370397 556387 556387 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:31299.68
  • base_dd_max:31299.68
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 7224 0.8% 34.4 8.63s 63168 0 Direct 34.3 48099 98059 63330 30.5%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.35 34.26 0.00 0.00 0.00 0.0000 0.0000 2169953.78 2169953.78 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.51% 23.82 8 43 48098.61 47503 54996 48097.33 47503 51057 1145524 1145524 0.00%
crit 30.49% 10.45 1 24 98058.98 96907 112191 98063.86 96907 103529 1024430 1024430 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy5
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42559.30
  • base_dd_max:42559.30
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 77813 8.3% 3.0 1.07s 7787080 8458088 Direct 6.0 6977 14215 10694 51.4%
Periodic 1826.4 8701 17954 12756 43.8% 99.4%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.00 6.00 1826.37 1826.37 0.00 0.9209 0.9790 23361239.87 23361239.87 0.00% 13045.68 8458088.30
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.65% 2.92 0 6 6977.13 6880 8103 6859.22 0 8103 20365 20365 0.00%
crit 51.35% 3.08 0 6 14214.85 14034 16530 14033.77 0 16530 43800 43800 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 56.17% 1025.96 743 1296 8700.70 6630 13994 8700.59 8435 8971 8926489 8926489 0.00%
crit 43.83% 800.41 571 1026 17954.18 13525 28549 17957.13 17456 18538 14370586 14370586 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy3
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    aoe
    [J]:3.00
  • if_expr:!fight_style.dungeonroute
  • target_if_expr:refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (81619) 0.0% (8.7%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 20175 2.1% 236.7 1.47s 25587 0 Direct 236.1 15882 34094 25653 53.7%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 236.66 236.05 0.00 0.00 0.00 0.0000 0.0000 6055530.10 6055530.10 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 46.34% 109.40 65 163 15882.48 10979 30135 15888.53 14772 17376 1737425 1737425 0.00%
crit 53.66% 126.66 79 178 34093.56 22398 61476 34120.10 31912 36766 4318105 4318105 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 20246 2.2% 238.3 1.46s 25501 0 Direct 237.7 15836 33988 25565 53.6%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 238.31 237.71 0.00 0.00 0.00 0.0000 0.0000 6076945.02 6076945.02 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 46.40% 110.30 62 164 15836.27 9912 30135 15842.98 14791 17327 1746785 1746785 0.00%
crit 53.60% 127.40 83 182 33988.18 20220 61476 34013.56 32084 37191 4330160 4330160 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 41199 4.4% 15.8 19.17s 780826 0 Direct 94.7 80730 173946 130500 53.4%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.84 94.75 0.00 0.00 0.00 0.0000 0.0000 12364686.95 12364686.95 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 46.60% 44.16 18 76 80729.94 40859 295676 80787.45 58038 102706 3564647 3564647 0.00%
crit 53.40% 50.59 25 83 173946.45 83352 611012 174087.47 130528 225144 8800040 8800040 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:enemy2
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfall 312123 33.1% 105.1 2.84s 891097 880853 Direct 1772.5 34139 73642 52811 47.3%

Stats Details: Starfall

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 105.05 1772.55 0.00 0.00 0.00 1.0116 0.0000 93610061.53 93610061.53 0.00% 880853.48 880853.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.73% 934.67 665 1212 34139.16 7537 128122 34213.89 31182 38286 31907859 31907859 0.00%
crit 47.27% 837.88 614 1081 73642.43 15375 284689 73780.10 67801 82327 61702203 61702203 0.00%

Action Details: Starfall

  • id:191034
  • school:astral
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:45.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]

Action Details: Starfall Damage

  • id:191037
  • school:astral
  • range:200.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy5
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.114000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.41

Spelldata

  • id:191037
  • name:Starfall
  • school:astral
  • tooltip:
  • description:{$@spelldesc191034=Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]}

Action Priority List

    aoe
    [L]:70.77
  • if_expr:variable.starfall_condition1
    aoe
    [Q]:34.28
  • if_expr:variable.starfall_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountLunar Shrapnel4151691PCT0.200
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 209894 22.3% 118.1 2.50s 533093 382262 Direct 714.8 53956 116499 88103 54.6%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 118.13 714.81 0.00 0.00 0.00 1.3946 0.0000 62976588.93 62976588.93 0.00% 382262.43 382262.43
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 45.40% 324.55 222 439 53956.12 7433 243760 53977.51 47172 61272 17511232 17511232 0.00%
crit 54.60% 390.26 286 514 116498.63 15163 489879 116557.02 104929 131545 45465356 45465356 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    aoe
    [M]:1.27
  • if_expr:buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
    aoe
    [R]:117.40
  • if_expr:spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Solar)4851710.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Sunfire16481550.283Mastery
Sunfire 65222 6.9% 1.0 0.00s 19566812 21084927 Direct 1.0 5473 11164 7280 31.7%
Periodic 1839.3 7316 15605 10634 40.0% 100.1%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 1839.30 1839.30 0.00 0.9285 0.9786 19566812.35 19566812.35 0.00% 10865.09 21084927.10
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.29% 0.68 0 1 5473.15 5438 5510 3737.73 0 5510 3738 3738 0.00%
crit 31.71% 0.32 0 1 11163.78 11094 11240 3539.79 0 11240 3540 3540 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 59.97% 1103.07 824 1399 7316.46 5479 12722 7320.03 7094 7708 8070462 8070462 0.00%
crit 40.03% 736.23 517 979 15605.49 11178 25953 15614.89 15022 16353 11489073 11489073 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    aoe
    [I]:1.00
  • target_if_expr:refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (7173) 0.0% (0.8%) 8.5 32.30s 254762 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.46 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 3749 0.4% 8.5 32.30s 133158 0 Direct 50.8 16860 34365 22194 30.5%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.46 50.76 0.00 0.00 0.00 0.0000 0.0000 1126625.63 1126625.63 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.53% 35.30 6 90 16859.82 16647 19272 16859.65 16647 18330 595124 595124 0.00%
crit 30.47% 15.47 0 46 34365.12 33959 39316 34364.05 0 37679 531501 531501 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:51134.41
  • base_dd_max:51134.41
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 3424 0.4% 16.2 15.76s 63332 0 Direct 97.5 8021 16349 10555 30.4%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.25 97.47 0.00 0.00 0.00 0.0000 0.0000 1028857.60 1028857.60 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.57% 67.81 11 163 8020.87 7921 9170 8020.27 7921 8560 543881 543881 0.00%
crit 30.43% 29.66 4 76 16348.79 16159 18707 16351.13 16159 17645 484977 484977 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24330.91
  • base_dd_max:24330.91
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 4314 0.5% 26.6 10.33s 49031 63598 Direct 26.4 34202 69773 49308 42.5%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.56 26.41 0.00 0.00 0.00 0.7710 0.0000 1302286.31 1302286.31 0.00% 63597.51 63597.51
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 57.51% 15.19 3 27 34202.37 15081 66682 34127.01 24155 43408 519478 519478 0.00%
crit 42.49% 11.22 2 23 69773.21 30766 132378 69597.08 36685 92623 782809 782809 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    aoe
    [O]:24.64
  • if_expr:!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.800Spell Data
Eclipse (Solar)4851710.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Lunar)4851810.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
buzzing_rune_3
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:buzzing_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:buzzing_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:buzzing_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 180.89s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    aoe
    [N]:2.00
  • if_expr:variable.cd_condition_aoe

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.2 59.26s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.22 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:buzzing_rune_3
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:70932.17
  • base_dd_max:70932.17
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.42s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:buzzing_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.74
Elemental Potion of Ultimate Power 1.5 307.22s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.46 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.45
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 17.5 6.0 17.7s 13.4s 9.6s 55.86% 57.87% 6.0 (20.6) 16.9

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.3s
  • trigger_min/max:0.0s / 38.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.6s
  • uptime_min/max:51.52% / 59.42%

Stack Uptimes

  • balance_of_all_things_arcane_1:5.73%
  • balance_of_all_things_arcane_2:6.12%
  • balance_of_all_things_arcane_3:6.62%
  • balance_of_all_things_arcane_4:7.04%
  • balance_of_all_things_arcane_5:7.33%
  • balance_of_all_things_arcane_6:7.56%
  • balance_of_all_things_arcane_7:7.69%
  • balance_of_all_things_arcane_8:7.76%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 10.3 0.0 29.8s 29.7s 7.9s 27.17% 30.43% 0.0 (0.1) 10.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 48.1s
  • trigger_min/max:3.7s / 48.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:24.69% / 30.00%

Stack Uptimes

  • balance_of_all_things_nature_1:3.36%
  • balance_of_all_things_nature_2:3.37%
  • balance_of_all_things_nature_3:3.38%
  • balance_of_all_things_nature_4:3.40%
  • balance_of_all_things_nature_5:3.40%
  • balance_of_all_things_nature_6:3.41%
  • balance_of_all_things_nature_7:3.42%
  • balance_of_all_things_nature_8:3.43%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 15.2 86.7 20.2s 2.9s 17.5s 88.24% 0.00% 35.5 (35.5) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 59.1s
  • trigger_min/max:0.8s / 13.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:82.22% / 92.88%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:13.37%
  • balance_t31_4pc_buff_lunar_2:13.68%
  • balance_t31_4pc_buff_lunar_3:13.99%
  • balance_t31_4pc_buff_lunar_4:11.73%
  • balance_t31_4pc_buff_lunar_5:35.47%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 8.2 57.2 38.0s 4.4s 18.9s 51.94% 0.00% 26.5 (26.5) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 85.6s
  • trigger_min/max:0.8s / 40.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.37% / 59.49%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:7.43%
  • balance_t31_4pc_buff_solar_2:6.46%
  • balance_t31_4pc_buff_solar_3:6.30%
  • balance_t31_4pc_buff_solar_4:6.43%
  • balance_t31_4pc_buff_solar_5:25.32%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 69.6s 69.6s 10.8s 10.23% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 319.3s
  • trigger_min/max:12.0s / 319.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 11.0s
  • uptime_min/max:0.00% / 34.95%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.91%
  • best_friends_with_aerwynn_2:0.92%
  • best_friends_with_aerwynn_3:0.92%
  • best_friends_with_aerwynn_4:0.92%
  • best_friends_with_aerwynn_5:0.93%
  • best_friends_with_aerwynn_6:0.93%
  • best_friends_with_aerwynn_7:0.93%
  • best_friends_with_aerwynn_8:0.94%
  • best_friends_with_aerwynn_9:0.94%
  • best_friends_with_aerwynn_10:0.94%
  • best_friends_with_aerwynn_11:0.95%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 1.0 113.2s 69.6s 45.2s 33.45% 0.00% 69.9 (69.9) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 353.5s
  • trigger_min/max:12.0s / 319.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 299.2s
  • uptime_min/max:0.00% / 99.90%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.45%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 69.5s 69.5s 10.8s 10.18% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 336.1s
  • trigger_min/max:12.0s / 336.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 34.60%

Stack Uptimes

  • best_friends_with_pip_1:0.91%
  • best_friends_with_pip_2:0.91%
  • best_friends_with_pip_3:0.92%
  • best_friends_with_pip_4:0.92%
  • best_friends_with_pip_5:0.92%
  • best_friends_with_pip_6:0.93%
  • best_friends_with_pip_7:0.93%
  • best_friends_with_pip_8:0.93%
  • best_friends_with_pip_9:0.93%
  • best_friends_with_pip_10:0.94%
  • best_friends_with_pip_11:0.94%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 113.1s 69.5s 45.3s 33.43% 0.00% 69.6 (69.6) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 339.8s
  • trigger_min/max:12.0s / 336.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 332.0s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.43%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 69.8s 69.8s 10.8s 10.10% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 343.7s
  • trigger_min/max:12.0s / 343.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 35.43%

Stack Uptimes

  • best_friends_with_urctos_1:0.90%
  • best_friends_with_urctos_2:0.90%
  • best_friends_with_urctos_3:0.91%
  • best_friends_with_urctos_4:0.91%
  • best_friends_with_urctos_5:0.91%
  • best_friends_with_urctos_6:0.92%
  • best_friends_with_urctos_7:0.92%
  • best_friends_with_urctos_8:0.92%
  • best_friends_with_urctos_9:0.93%
  • best_friends_with_urctos_10:0.93%
  • best_friends_with_urctos_11:0.93%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 113.4s 69.8s 44.8s 33.12% 0.00% 69.2 (69.2) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.4s / 353.9s
  • trigger_min/max:12.0s / 343.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 277.1s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.12%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.8 0.0 62.1s 58.4s 50.5s 80.31% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 350.0s
  • trigger_min/max:15.0s / 329.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 359.6s
  • uptime_min/max:46.76% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.31%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dreamstate 15.4 0.1 20.3s 21.2s 2.1s 10.83% 20.63% 0.1 (0.1) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.6s / 55.7s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:7.50% / 15.46%

Stack Uptimes

  • dreamstate_1:7.38%
  • dreamstate_2:3.45%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 13.3 8.1 23.6s 14.8s 21.0s 93.11% 93.82% 8.1 (8.1) 12.4

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.6s / 71.9s
  • trigger_min/max:0.0s / 57.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.0s
  • uptime_min/max:90.11% / 96.07%

Stack Uptimes

  • eclipse_lunar_1:93.11%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 8.2 0.0 38.1s 38.1s 19.1s 52.68% 54.62% 0.0 (0.0) 7.9

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 86.6s
  • trigger_min/max:12.0s / 86.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:47.14% / 59.85%

Stack Uptimes

  • eclipse_solar_1:52.68%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 305.9s 305.9s 27.3s 12.99% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 325.7s
  • trigger_min/max:300.0s / 325.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.76% / 17.87%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.99%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Fury of Elune 5.1 0.0 65.2s 65.2s 7.9s 13.50% 0.00% 75.9 (75.9) 5.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:60.0s / 88.4s
  • trigger_min/max:60.0s / 88.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:10.91% / 15.59%

Stack Uptimes

  • fury_of_elune_1:13.50%

Spelldata

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 8.2 0.0 38.1s 38.1s 19.1s 52.68% 55.33% 0.0 (0.0) 7.9

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 86.6s
  • trigger_min/max:12.0s / 86.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:47.14% / 59.85%

Stack Uptimes

  • incarnation_chosen_of_elune_1:52.68%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.7 0.0 90.9s 90.9s 19.6s 24.00% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:65.76

Trigger Details

  • interval_min/max:90.0s / 122.2s
  • trigger_min/max:90.0s / 122.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:21.22% / 27.00%

Stack Uptimes

  • kindled_soul_5:1.17%
  • kindled_soul_10:1.18%
  • kindled_soul_15:1.18%
  • kindled_soul_20:1.18%
  • kindled_soul_25:1.19%
  • kindled_soul_30:1.19%
  • kindled_soul_35:1.19%
  • kindled_soul_40:1.19%
  • kindled_soul_45:1.20%
  • kindled_soul_50:1.20%
  • kindled_soul_55:1.20%
  • kindled_soul_60:1.20%
  • kindled_soul_65:1.21%
  • kindled_soul_70:1.21%
  • kindled_soul_75:1.21%
  • kindled_soul_80:1.22%
  • kindled_soul_85:1.22%
  • kindled_soul_90:1.22%
  • kindled_soul_95:1.22%
  • kindled_soul_100:1.23%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Vigil 3.7 0.0 90.4s 90.4s 14.8s 18.39% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.5s
  • trigger_min/max:90.0s / 91.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s
  • uptime_min/max:16.50% / 21.02%

Stack Uptimes

  • natures_vigil_1:18.39%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.6 0.0 69.5s 68.9s 0.9s 0.76% 1.17% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 331.1s
  • trigger_min/max:0.1s / 331.1s
  • trigger_pct:15.09%
  • duration_min/max:0.0s / 6.2s
  • uptime_min/max:0.00% / 4.67%

Stack Uptimes

  • owlkin_frenzy_1:0.76%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 9.2 96.8 34.0s 34.0s 29.8s 91.36% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.8s / 47.6s
  • trigger_min/max:20.8s / 47.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 45.5s
  • uptime_min/max:87.11% / 94.72%

Stack Uptimes

  • primordial_arcanic_pulsar_5:7.24%
  • primordial_arcanic_pulsar_10:6.74%
  • primordial_arcanic_pulsar_15:7.52%
  • primordial_arcanic_pulsar_20:8.34%
  • primordial_arcanic_pulsar_25:8.64%
  • primordial_arcanic_pulsar_30:8.39%
  • primordial_arcanic_pulsar_35:8.68%
  • primordial_arcanic_pulsar_40:9.05%
  • primordial_arcanic_pulsar_45:9.07%
  • primordial_arcanic_pulsar_50:8.85%
  • primordial_arcanic_pulsar_55:8.86%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 19.8 3.7 15.6s 13.4s 6.7s 44.00% 43.20% 3.7 (3.7) 19.4

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 43.5s
  • trigger_min/max:0.0s / 38.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:40.44% / 47.53%

Stack Uptimes

  • solstice_1:44.00%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starfall 105.0 0.0 143.5s 2.8s 296.7s 98.89% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_starfall
  • max_stacks:20
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:asynchronous
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.9s / 357.1s
  • trigger_min/max:0.7s / 9.0s
  • trigger_pct:99.99%
  • duration_min/max:0.5s / 357.9s
  • uptime_min/max:98.43% / 99.49%

Stack Uptimes

  • starfall_1:5.25%
  • starfall_2:32.48%
  • starfall_3:42.28%
  • starfall_4:15.15%
  • starfall_5:3.35%
  • starfall_6:0.37%
  • starfall_7:0.00%

Spelldata

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]
  • max_stacks:20
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Starlord 21.0 84.0 14.5s 2.8s 13.9s 97.49% 0.00% 42.5 (42.5) 6.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 19.2s
  • trigger_min/max:0.8s / 9.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:94.49% / 99.39%

Stack Uptimes

  • starlord_1:12.59%
  • starlord_2:17.71%
  • starlord_3:67.20%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Umbral Embrace 23.1 2.6 12.7s 11.4s 1.6s 12.42% 0.00% 2.6 (2.6) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_umbral_embrace
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 53.3s
  • trigger_min/max:0.0s / 53.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.9s
  • uptime_min/max:4.90% / 24.36%

Stack Uptimes

  • umbral_embrace_1:12.42%

Spelldata

  • id:393763
  • name:Umbral Embrace
  • tooltip:Your next Wrath or Starfire cast during an Eclipse deals Astral damage and deals {$=}w1% additional damage.
  • description:{$@spelldesc393760=Dealing Astral damage has a chance to cause your next Wrath or Starfire cast during an Eclipse to become Astral and deal {$s1=25}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Wafting Devotion 4.3 1.2 60.7s 45.2s 16.5s 23.76% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 224.3s
  • trigger_min/max:0.0s / 224.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 78.3s
  • uptime_min/max:4.97% / 60.75%

Stack Uptimes

  • wafting_devotion_1:23.76%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Primordial Arcanic Pulsar 8.3 6.0 10.0 35.2s 22.1s 48.1s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.05% 0.00% 0.55% 0.0s 0.0s 1.1s
Astral Smolder 76.01% 63.45% 84.87% 4.5s 0.0s 54.9s
Incarnation (Total) 52.68% 47.14% 59.85% 19.1s 0.0s 54.0s
Incarnation (Pulsar) 32.44% 29.48% 34.91% 11.8s 0.0s 12.0s
Lunar Eclipse Only 40.43% 32.89% 46.31% 9.2s 0.0s 15.0s
No Eclipse 6.85% 3.93% 9.68% 1.7s 0.0s 4.4s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Fury of Elune5.3070.00028.42127.2065.74979.374

Eclipse Utilization

NoneSolarLunarBoth
Wrath24.56100.0%0.000.0%0.000.0%0.000.0%
Starfire2.452.1%0.000.0%50.0842.0%66.6055.9%
Starfall20.847.0%0.000.0%118.4539.9%157.4453.1%
Fury of Elune15.572.0%0.000.0%142.0818.6%608.2279.4%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
buzzing_rune_3
Fury of EluneAstral Power80.87242.235.78%3.000.370.15%
MoonfireAstral Power3.0018.000.43%6.000.000.00%
Orbit BreakerAstral Power15.84472.9511.29%29.872.110.44%
Shooting Stars (Moonfire)Astral Power236.66473.0411.29%2.000.280.06%
Shooting Stars (Sunfire)Astral Power238.31476.3211.37%2.000.290.06%
StarfireAstral Power119.132234.5753.35%18.7635.161.55%
SunfireAstral Power1.006.000.14%6.000.000.00%
WrathAstral Power26.56265.596.34%10.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
buzzing_rune_3
StarfallAstral Power 105.434149.99100.00%39.3639.5022556.70
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 896660.0 4267.40 4929.68 3571506.3 697633.7 -75114.8 896660.0
Astral Power 20.0 13.94 13.76 38.2 53.6 0.2 100.0

Statistics & Data Analysis

Fight Length
buzzing_rune_3 Fight Length
Count 8900
Mean 300.52
Minimum 240.01
Maximum 360.00
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 19.96%
Standard Deviation 34.5970
5th Percentile 246.36
95th Percentile 354.16
( 95th Percentile - 5th Percentile ) 107.81
Mean Distribution
Standard Deviation 0.3667
95.00% Confidence Interval ( 299.80 - 301.24 )
Normalized 95.00% Confidence Interval ( 99.76% - 100.24% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 510
0.1% Error 50914
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1022
DPS
buzzing_rune_3 Damage Per Second
Count 8900
Mean 941929.67
Minimum 876215.51
Maximum 1052333.43
Spread ( max - min ) 176117.92
Range [ ( max - min ) / 2 * 100% ] 9.35%
Standard Deviation 22603.6752
5th Percentile 906931.77
95th Percentile 980293.66
( 95th Percentile - 5th Percentile ) 73361.90
Mean Distribution
Standard Deviation 239.5985
95.00% Confidence Interval ( 941460.06 - 942399.27 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2213
0.1 Scale Factor Error with Delta=300 4361560
0.05 Scale Factor Error with Delta=300 17446238
0.01 Scale Factor Error with Delta=300 436155935
Priority Target DPS
buzzing_rune_3 Priority Target Damage Per Second
Count 8900
Mean 171927.05
Minimum 153539.06
Maximum 194739.96
Spread ( max - min ) 41200.91
Range [ ( max - min ) / 2 * 100% ] 11.98%
Standard Deviation 5404.0227
5th Percentile 163308.21
95th Percentile 181062.65
( 95th Percentile - 5th Percentile ) 17754.44
Mean Distribution
Standard Deviation 57.2825
95.00% Confidence Interval ( 171814.77 - 172039.32 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3796
0.1 Scale Factor Error with Delta=300 249298
0.05 Scale Factor Error with Delta=300 997191
0.01 Scale Factor Error with Delta=300 24929755
DPS(e)
buzzing_rune_3 Damage Per Second (Effective)
Count 8900
Mean 941929.67
Minimum 876215.51
Maximum 1052333.43
Spread ( max - min ) 176117.92
Range [ ( max - min ) / 2 * 100% ] 9.35%
Damage
buzzing_rune_3 Damage
Count 8900
Mean 282593857.72
Minimum 220658895.35
Maximum 348130914.65
Spread ( max - min ) 127472019.31
Range [ ( max - min ) / 2 * 100% ] 22.55%
DTPS
buzzing_rune_3 Damage Taken Per Second
Count 8900
Mean 4930.29
Minimum 1221.97
Maximum 9531.90
Spread ( max - min ) 8309.93
Range [ ( max - min ) / 2 * 100% ] 84.27%
HPS
buzzing_rune_3 Healing Per Second
Count 8900
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
buzzing_rune_3 Healing Per Second (Effective)
Count 8900
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
buzzing_rune_3 Heal
Count 8900
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
buzzing_rune_3 Healing Taken Per Second
Count 8900
Mean 4258.96
Minimum 723.67
Maximum 8660.51
Spread ( max - min ) 7936.84
Range [ ( max - min ) / 2 * 100% ] 93.18%
TMI
buzzing_rune_3 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
buzzing_rune_3Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
buzzing_rune_3 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.45 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.69 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.74 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.aoe
# count action,conditions
0.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
0.00 variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
I 1.00 sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
J 3.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
0.00 variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
K 14.07 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
L 70.77 starfall,if=variable.starfall_condition1
M 1.27 starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
0.00 celestial_alignment,if=variable.cd_condition_aoe
N 2.00 incarnation,if=variable.cd_condition_aoe
0.00 warrior_of_elune
0.00 variable,name=enter_solar,value=spell_targets.starfire<3
0.00 starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
O 24.64 wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
0.00 wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
P 5.13 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
Q 34.28 starfall,if=variable.starfall_condition2
0.00 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+50
0.00 convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 new_moon,if=astral_power.deficit>variable.passive_asp+10
0.00 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
R 117.40 starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
0.00 wrath
S 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFIJJJLMLNDEPQRRLRLRLRLRKLQRLRRLRRLRLRLRRLQRLRRLRLRRLRKLOOQRQRRRLRKLQQRRPRLOLORLRLRLQRRRLOORKLFRQRQRELRRLRKLOOQRQRRRLRRLOOQRLRRLRRKLPQRQLRLRLOORKLQRRQRRRLROOLRLQRRRLRRKLQOOFQMLRRLNERRKLQRQPRLRLRLRKLQQRRRRLRLLRRLQRQRRRLROLORRLQRQRRLRLOOLRRLQRRQRRRLOOKLRQRFQPRRLREKLQROLO

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask buzzing_rune_3 0.0/100: 0% astral_power
Pre precombat 1 food buzzing_rune_3 0.0/100: 0% astral_power corrupting_rage
Pre precombat 2 augmentation buzzing_rune_3 0.0/100: 0% astral_power corrupting_rage
Pre precombat 4 no_cd_talent buzzing_rune_3 0.0/100: 0% astral_power corrupting_rage
Pre precombat 5 on_use_trinket buzzing_rune_3 0.0/100: 0% astral_power corrupting_rage
Pre precombat 6 on_use_trinket buzzing_rune_3 0.0/100: 0% astral_power corrupting_rage
Pre precombat 7 on_use_trinket buzzing_rune_3 0.0/100: 0% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 10.0/100: 10% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil buzzing_rune_3 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.000 aoe I sunfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.930 aoe J moonfire Fluffy_Pillow 45.2/100: 45% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:01.859 aoe J moonfire enemy2 55.2/100: 55% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:02.789 aoe J moonfire enemy3 67.2/100: 67% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:03.718 aoe L starfall Fluffy_Pillow 77.2/100: 77% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:04.646 aoe M starfire Fluffy_Pillow 40.2/100: 40% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, corrupting_rage
0:05.450 aoe L starfall Fluffy_Pillow 65.4/100: 65% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, corrupting_rage
0:06.343 aoe N incarnation_chosen_of_elune Fluffy_Pillow 22.4/100: 22% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(10), starfall(2), starlord(2), umbral_embrace, balance_t31_4pc_buff_lunar(2), corrupting_rage
0:06.343 default D potion Fluffy_Pillow 22.4/100: 22% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), umbral_embrace, dreamstate(2), corrupting_rage
0:06.343 default E use_items Fluffy_Pillow 22.4/100: 22% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), umbral_embrace, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power
0:06.343 aoe P fury_of_elune Fluffy_Pillow 22.4/100: 22% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), umbral_embrace, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:07.126 aoe Q starfall Fluffy_Pillow 61.4/100: 61% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), umbral_embrace, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:07.908 aoe R starfire Fluffy_Pillow 38.4/100: 38% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:08.663 aoe R starfire Fluffy_Pillow 64.6/100: 65% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:09.418 aoe L starfall Fluffy_Pillow 95.8/100: 96% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:10.174 aoe R starfire Fluffy_Pillow 67.8/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:11.304 aoe L starfall Fluffy_Pillow 97.0/100: 97% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
0:12.059 aoe R starfire Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:13.189 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
0:13.943 aoe R starfire Fluffy_Pillow 73.0/100: 73% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:15.073 aoe L starfall Fluffy_Pillow 97.2/100: 97% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:15.829 aoe R starfire Fluffy_Pillow 64.2/100: 64% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:16.958 aoe K cancel_buff Fluffy_Pillow 85.4/100: 85% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:16.958 aoe L starfall Fluffy_Pillow 85.4/100: 85% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:17.803 aoe Q starfall Fluffy_Pillow 52.4/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:18.615 aoe R starfire Fluffy_Pillow 17.4/100: 17% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(5), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:19.787 aoe L starfall Fluffy_Pillow 42.6/100: 43% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:20.569 aoe R starfire Fluffy_Pillow 9.6/100: 10% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:21.697 aoe R starfire Fluffy_Pillow 60.8/100: 61% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:22.828 aoe L starfall Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:23.582 aoe R starfire Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:24.712 aoe R starfire Fluffy_Pillow 66.2/100: 66% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:25.841 aoe L starfall Fluffy_Pillow 89.4/100: 89% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:26.596 aoe R starfire Fluffy_Pillow 60.4/100: 60% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:27.724 aoe L starfall Fluffy_Pillow 85.6/100: 86% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:28.479 aoe R starfire Fluffy_Pillow 56.6/100: 57% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:29.609 aoe L starfall Fluffy_Pillow 85.8/100: 86% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:30.363 aoe R starfire Fluffy_Pillow 54.8/100: 55% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:31.492 aoe R starfire Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:32.620 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:33.465 aoe Q starfall Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:34.278 aoe R starfire Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:35.449 aoe L starfall Fluffy_Pillow 55.2/100: 55% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:36.232 aoe R starfire Fluffy_Pillow 52.2/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:37.360 aoe R starfire Fluffy_Pillow 73.4/100: 73% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage
0:38.490 aoe L starfall Fluffy_Pillow 92.6/100: 93% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage
0:39.244 aoe R starfire Fluffy_Pillow 61.6/100: 62% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
0:40.372 aoe L starfall Fluffy_Pillow 84.8/100: 85% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
0:41.351 aoe R starfire Fluffy_Pillow 51.8/100: 52% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
0:42.818 aoe R starfire Fluffy_Pillow 75.0/100: 75% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
0:44.287 aoe L starfall Fluffy_Pillow 96.2/100: 96% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
0:45.267 aoe R starfire Fluffy_Pillow 63.2/100: 63% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
0:46.735 aoe K cancel_buff Fluffy_Pillow 82.4/100: 82% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
0:46.735 aoe L starfall Fluffy_Pillow 82.4/100: 82% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
0:47.830 aoe O wrath Fluffy_Pillow 49.4/100: 49% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
0:48.885 aoe O wrath Fluffy_Pillow 59.4/100: 59% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord, dreamstate, best_friends_with_urctos_static, corrupting_rage
0:49.639 aoe Q starfall Fluffy_Pillow 71.4/100: 71% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord, dreamstate, best_friends_with_urctos_static, corrupting_rage
0:50.799 aoe R starfire Fluffy_Pillow 30.4/100: 30% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, corrupting_rage
0:51.804 aoe Q starfall Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, corrupting_rage
0:52.922 aoe R starfire Fluffy_Pillow 12.6/100: 13% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, corrupting_rage
0:54.538 aoe R starfire Fluffy_Pillow 37.8/100: 38% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, corrupting_rage
0:56.152 aoe R starfire Fluffy_Pillow 61.0/100: 61% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, corrupting_rage
0:57.766 aoe L starfall Fluffy_Pillow 80.2/100: 80% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall, starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, corrupting_rage
0:58.844 aoe R starfire Fluffy_Pillow 39.2/100: 39% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, corrupting_rage
1:00.312 aoe K cancel_buff Fluffy_Pillow 98.4/100: 98% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, corrupting_rage
1:00.312 aoe L starfall Fluffy_Pillow 98.4/100: 98% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, corrupting_rage
1:01.409 aoe Q starfall Fluffy_Pillow 69.4/100: 69% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage
1:02.463 aoe Q starfall Fluffy_Pillow 40.4/100: 40% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
1:03.479 aoe R starfire Fluffy_Pillow 11.4/100: 11% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
1:04.947 aoe R starfire Fluffy_Pillow 32.6/100: 33% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:06.307 aoe P fury_of_elune Fluffy_Pillow 53.8/100: 54% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:07.252 aoe R starfire Fluffy_Pillow 56.8/100: 57% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:08.616 aoe L starfall Fluffy_Pillow 89.0/100: 89% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:09.525 aoe O wrath Fluffy_Pillow 62.0/100: 62% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), starfall(2), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:10.436 aoe L starfall Fluffy_Pillow 80.0/100: 80% astral_power fury_of_elune, primordial_arcanic_pulsar(20), starfall(2), starlord(3), umbral_embrace, dreamstate(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:11.435 aoe O wrath Fluffy_Pillow 43.0/100: 43% astral_power fury_of_elune, primordial_arcanic_pulsar(25), starfall(2), starlord(3), umbral_embrace, dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:12.191 aoe R starfire Fluffy_Pillow 56.0/100: 56% astral_power balance_of_all_things_arcane(8), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), umbral_embrace, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:13.089 aoe L starfall Fluffy_Pillow 85.2/100: 85% astral_power balance_of_all_things_arcane(7), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:14.089 aoe R starfire Fluffy_Pillow 52.2/100: 52% astral_power balance_of_all_things_arcane(6), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:15.586 aoe L starfall Fluffy_Pillow 82.4/100: 82% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:16.706 aoe R starfire Fluffy_Pillow 41.4/100: 41% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:18.320 aoe L starfall Fluffy_Pillow 96.6/100: 97% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:19.397 aoe Q starfall Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, corrupting_rage
1:20.513 aoe R starfire Fluffy_Pillow 10.6/100: 11% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(4), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage
1:22.126 aoe R starfire Fluffy_Pillow 33.8/100: 34% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage
1:23.741 aoe R starfire Fluffy_Pillow 55.0/100: 55% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage
1:25.355 aoe L starfall Fluffy_Pillow 76.2/100: 76% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage
1:26.433 aoe O wrath Fluffy_Pillow 33.2/100: 33% astral_power eclipse_lunar, primordial_arcanic_pulsar(50), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
1:27.511 aoe O wrath Fluffy_Pillow 45.2/100: 45% astral_power owlkin_frenzy, primordial_arcanic_pulsar(50), starfall, starlord(3), dreamstate, best_friends_with_urctos_static, corrupting_rage
1:28.264 aoe R starfire Fluffy_Pillow 55.2/100: 55% astral_power balance_of_all_things_arcane(8), eclipse_lunar, owlkin_frenzy, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), best_friends_with_urctos_static, corrupting_rage
1:29.018 aoe K cancel_buff Fluffy_Pillow 74.4/100: 74% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), best_friends_with_urctos_static, corrupting_rage
1:29.018 aoe L starfall Fluffy_Pillow 74.4/100: 74% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, best_friends_with_urctos_static, corrupting_rage
1:30.225 default F natures_vigil buzzing_rune_3 35.4/100: 35% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, corrupting_rage
1:30.225 aoe R starfire Fluffy_Pillow 35.4/100: 35% astral_power natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, corrupting_rage
1:31.961 aoe Q starfall Fluffy_Pillow 64.6/100: 65% astral_power natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage
1:33.121 aoe R starfire Fluffy_Pillow 25.6/100: 26% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage
1:34.642 aoe Q starfall Fluffy_Pillow 54.8/100: 55% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip(7), best_friends_with_pip_static, corrupting_rage
1:35.658 aoe R starfire Fluffy_Pillow 23.8/100: 24% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage
1:37.126 default E use_items Fluffy_Pillow 47.0/100: 47% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(5), best_friends_with_pip_static, corrupting_rage
1:37.126 aoe L starfall Fluffy_Pillow 47.0/100: 47% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
1:38.105 aoe R starfire Fluffy_Pillow 46.0/100: 46% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
1:39.087 aoe R starfire Fluffy_Pillow 67.2/100: 67% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(95)
1:40.554 aoe L starfall Fluffy_Pillow 86.4/100: 86% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip, best_friends_with_pip_static, corrupting_rage, kindled_soul(85)
1:41.534 aoe R starfire Fluffy_Pillow 51.4/100: 51% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(80)
1:43.002 aoe K cancel_buff Fluffy_Pillow 72.6/100: 73% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(75)
1:43.002 aoe L starfall Fluffy_Pillow 72.6/100: 73% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(75)
1:44.099 aoe O wrath Fluffy_Pillow 39.6/100: 40% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(3), starlord, dreamstate, best_friends_with_pip_static, corrupting_rage, kindled_soul(70)
1:44.853 aoe O wrath Fluffy_Pillow 51.6/100: 52% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(3), starlord, best_friends_with_pip_static, corrupting_rage, kindled_soul(65)
1:45.605 aoe Q starfall Fluffy_Pillow 63.6/100: 64% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord, best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage, kindled_soul(60)
1:46.765 aoe R starfire Fluffy_Pillow 26.6/100: 27% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage, kindled_soul(55)
1:48.437 aoe Q starfall Fluffy_Pillow 51.8/100: 52% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_pip(8), best_friends_with_pip_static, corrupting_rage, kindled_soul(45)
1:49.555 aoe R starfire Fluffy_Pillow 10.8/100: 11% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(7), best_friends_with_pip_static, corrupting_rage, kindled_soul(40)
1:51.169 aoe R starfire Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(30)
1:52.784 aoe R starfire Fluffy_Pillow 59.2/100: 59% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage, kindled_soul(25)
1:54.398 aoe L starfall Fluffy_Pillow 80.4/100: 80% astral_power eclipse_lunar, primordial_arcanic_pulsar(30), starfall, starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(15)
1:55.475 aoe R starfire Fluffy_Pillow 35.4/100: 35% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip, best_friends_with_pip_static, corrupting_rage, kindled_soul(10)
1:57.088 aoe R starfire Fluffy_Pillow 56.6/100: 57% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(5)
1:58.703 aoe L starfall Fluffy_Pillow 79.8/100: 80% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
1:59.910 aoe O wrath Fluffy_Pillow 36.8/100: 37% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
2:01.069 aoe O wrath Fluffy_Pillow 46.8/100: 47% astral_power primordial_arcanic_pulsar(40), starfall(2), starlord, dreamstate, best_friends_with_pip_static, corrupting_rage
2:01.823 aoe Q starfall Fluffy_Pillow 56.8/100: 57% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(40), solstice, starfall(2), starlord, dreamstate, best_friends_with_pip_static, corrupting_rage
2:02.980 aoe R starfire Fluffy_Pillow 15.8/100: 16% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
2:03.986 aoe L starfall Fluffy_Pillow 73.0/100: 73% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
2:05.103 aoe R starfire Fluffy_Pillow 36.0/100: 36% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
2:06.718 aoe R starfire Fluffy_Pillow 63.2/100: 63% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
2:08.334 aoe L starfall Fluffy_Pillow 86.4/100: 86% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(50), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
2:09.413 aoe R starfire Fluffy_Pillow 45.4/100: 45% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
2:11.028 aoe R starfire Fluffy_Pillow 68.6/100: 69% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
2:12.643 aoe K cancel_buff Fluffy_Pillow 87.8/100: 88% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
2:12.643 aoe L starfall Fluffy_Pillow 87.8/100: 88% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
2:13.849 aoe P fury_of_elune Fluffy_Pillow 46.8/100: 47% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
2:14.904 aoe Q starfall Fluffy_Pillow 56.8/100: 57% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static
2:15.959 aoe R starfire Fluffy_Pillow 31.8/100: 32% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static
2:17.480 aoe Q starfall Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static
2:18.495 aoe L starfall Fluffy_Pillow 49.0/100: 49% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static
2:19.475 aoe R starfire Fluffy_Pillow 52.0/100: 52% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static
2:20.941 aoe L starfall Fluffy_Pillow 82.2/100: 82% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static
2:21.921 aoe R starfire Fluffy_Pillow 53.2/100: 53% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static
2:23.389 aoe L starfall Fluffy_Pillow 74.4/100: 74% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static
2:24.368 aoe O wrath Fluffy_Pillow 43.4/100: 43% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static
2:25.348 aoe O wrath Fluffy_Pillow 53.4/100: 53% astral_power primordial_arcanic_pulsar(25), starfall(4), starlord(3), dreamstate, best_friends_with_pip_static
2:26.104 aoe R starfire Fluffy_Pillow 65.4/100: 65% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), best_friends_with_pip_static
2:27.075 aoe K cancel_buff Fluffy_Pillow 88.6/100: 89% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_pip_static
2:27.075 aoe L starfall Fluffy_Pillow 88.6/100: 89% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), best_friends_with_pip_static
2:28.281 aoe Q starfall Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar, best_friends_with_pip_static
2:29.440 aoe R starfire Fluffy_Pillow 10.6/100: 11% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
2:31.114 aoe R starfire Fluffy_Pillow 33.8/100: 34% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
2:32.788 aoe Q starfall Fluffy_Pillow 61.0/100: 61% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
2:33.904 aoe R starfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage
2:35.518 aoe R starfire Fluffy_Pillow 41.2/100: 41% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage
2:37.132 aoe R starfire Fluffy_Pillow 60.4/100: 60% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(7), best_friends_with_pip_static, corrupting_rage
2:38.747 aoe L starfall Fluffy_Pillow 83.6/100: 84% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage
2:39.825 aoe R starfire Fluffy_Pillow 40.6/100: 41% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(5), best_friends_with_pip_static, corrupting_rage
2:41.439 aoe O wrath Fluffy_Pillow 54.6/100: 55% astral_power primordial_arcanic_pulsar(45), starfall, starlord(3), dreamstate, best_friends_with_pip(3), best_friends_with_pip_static, corrupting_rage
2:42.195 aoe O wrath Fluffy_Pillow 64.6/100: 65% astral_power primordial_arcanic_pulsar(45), starfall, best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage
2:42.950 aoe L starfall Fluffy_Pillow 74.6/100: 75% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage
2:44.157 aoe R starfire Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
2:45.893 aoe L starfall Fluffy_Pillow 90.8/100: 91% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
2:47.052 aoe Q starfall Fluffy_Pillow 49.8/100: 50% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
2:48.168 aoe R starfire Fluffy_Pillow 8.8/100: 9% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
2:49.636 aoe R starfire Fluffy_Pillow 32.0/100: 32% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
2:51.104 aoe R starfire Fluffy_Pillow 61.2/100: 61% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
2:52.571 aoe L starfall Fluffy_Pillow 86.4/100: 86% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
2:53.552 aoe R starfire Fluffy_Pillow 57.4/100: 57% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
2:55.021 aoe R starfire Fluffy_Pillow 80.6/100: 81% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
2:56.489 aoe K cancel_buff Fluffy_Pillow 99.8/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall, starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
2:56.489 aoe L starfall Fluffy_Pillow 99.8/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
2:57.584 aoe Q starfall Fluffy_Pillow 68.8/100: 69% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
2:58.637 aoe O wrath Fluffy_Pillow 37.8/100: 38% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(2), umbral_embrace, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
2:59.652 aoe O wrath Fluffy_Pillow 47.8/100: 48% astral_power primordial_arcanic_pulsar(15), starfall(3), starlord(2), umbral_embrace, dreamstate, best_friends_with_pip_static, corrupting_rage
3:00.408 default F natures_vigil buzzing_rune_3 57.8/100: 58% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(2), umbral_embrace, dreamstate, best_friends_with_pip_static, corrupting_rage
3:00.408 aoe Q starfall Fluffy_Pillow 57.8/100: 58% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(2), umbral_embrace, dreamstate, best_friends_with_pip_static, corrupting_rage
3:01.527 aoe M starfire Fluffy_Pillow 16.8/100: 17% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
3:02.497 aoe L starfall Fluffy_Pillow 72.0/100: 72% astral_power natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
3:03.574 aoe R starfire Fluffy_Pillow 33.0/100: 33% astral_power natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
3:05.189 aoe R starfire Fluffy_Pillow 58.2/100: 58% astral_power natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
3:06.804 aoe L starfall Fluffy_Pillow 85.4/100: 85% astral_power natures_vigil, balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(25), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
3:07.880 aoe N incarnation_chosen_of_elune Fluffy_Pillow 42.4/100: 42% astral_power natures_vigil, balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
3:07.880 default E use_items Fluffy_Pillow 42.4/100: 42% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), dreamstate(2), best_friends_with_pip_static, corrupting_rage
3:07.880 aoe R starfire Fluffy_Pillow 42.4/100: 42% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
3:08.761 aoe R starfire Fluffy_Pillow 65.6/100: 66% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
3:09.644 aoe K cancel_buff Fluffy_Pillow 88.8/100: 89% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(95)
3:09.644 aoe L starfall Fluffy_Pillow 88.8/100: 89% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(95)
3:10.741 aoe Q starfall Fluffy_Pillow 59.8/100: 60% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(2), starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(90)
3:11.720 aoe R starfire Fluffy_Pillow 30.8/100: 31% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(85)
3:13.130 aoe Q starfall Fluffy_Pillow 54.0/100: 54% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(11), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(75)
3:14.071 aoe P fury_of_elune Fluffy_Pillow 27.0/100: 27% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(10), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(70)
3:14.982 aoe R starfire Fluffy_Pillow 34.0/100: 34% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(9), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(65)
3:16.344 aoe L starfall Fluffy_Pillow 94.2/100: 94% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(8), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(60)
3:17.253 aoe R starfire Fluffy_Pillow 67.2/100: 67% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(7), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(55)
3:18.615 aoe L starfall Fluffy_Pillow 97.4/100: 97% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(6), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(50)
3:19.524 aoe R starfire Fluffy_Pillow 67.4/100: 67% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(45)
3:20.885 aoe L starfall Fluffy_Pillow 99.6/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(35)
3:21.795 aoe R starfire Fluffy_Pillow 74.6/100: 75% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(35)
3:23.156 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip, best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(25)
3:23.156 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip, best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(25)
3:24.174 aoe Q starfall Fluffy_Pillow 71.0/100: 71% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(4), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(20)
3:25.154 aoe Q starfall Fluffy_Pillow 40.0/100: 40% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(15)
3:26.169 aoe R starfire Fluffy_Pillow 9.0/100: 9% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), solstice, starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(10)
3:27.636 aoe R starfire Fluffy_Pillow 34.2/100: 34% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(5)
3:29.104 aoe R starfire Fluffy_Pillow 55.4/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:30.571 aoe R starfire Fluffy_Pillow 80.6/100: 81% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:32.039 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:33.018 aoe R starfire Fluffy_Pillow 69.0/100: 69% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:34.486 aoe L starfall Fluffy_Pillow 90.2/100: 90% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:35.465 aoe L starfall Fluffy_Pillow 57.2/100: 57% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:36.373 aoe R starfire Fluffy_Pillow 24.2/100: 24% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:37.734 aoe R starfire Fluffy_Pillow 75.4/100: 75% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:39.095 aoe L starfall Fluffy_Pillow 96.6/100: 97% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:40.113 aoe Q starfall Fluffy_Pillow 63.6/100: 64% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:41.091 aoe R starfire Fluffy_Pillow 30.6/100: 31% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:42.501 aoe Q starfall Fluffy_Pillow 49.8/100: 50% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:43.444 aoe R starfire Fluffy_Pillow 16.8/100: 17% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:44.806 aoe R starfire Fluffy_Pillow 38.0/100: 38% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:46.169 aoe R starfire Fluffy_Pillow 61.2/100: 61% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:47.532 aoe L starfall Fluffy_Pillow 80.4/100: 80% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:48.441 aoe R starfire Fluffy_Pillow 47.4/100: 47% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:49.802 aoe O wrath Fluffy_Pillow 68.6/100: 69% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:50.713 aoe L starfall Fluffy_Pillow 78.6/100: 79% astral_power primordial_arcanic_pulsar(50), starfall, starlord(3), dreamstate(2), best_friends_with_pip_static, corrupting_rage
3:51.789 aoe O wrath Fluffy_Pillow 35.6/100: 36% astral_power primordial_arcanic_pulsar(55), starfall(2), starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage
3:52.543 aoe R starfire Fluffy_Pillow 45.6/100: 46% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), best_friends_with_pip_static
3:53.514 aoe R starfire Fluffy_Pillow 70.8/100: 71% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), best_friends_with_pip_static
3:55.128 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), best_friends_with_pip_static
3:56.336 aoe Q starfall Fluffy_Pillow 59.0/100: 59% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_pip_static
3:57.392 aoe R starfire Fluffy_Pillow 28.0/100: 28% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static
3:58.915 aoe Q starfall Fluffy_Pillow 51.2/100: 51% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static
3:59.930 aoe R starfire Fluffy_Pillow 22.2/100: 22% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static
4:01.396 aoe R starfire Fluffy_Pillow 77.4/100: 77% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static
4:02.864 aoe L starfall Fluffy_Pillow 98.6/100: 99% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static
4:03.844 aoe R starfire Fluffy_Pillow 65.6/100: 66% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static
4:05.312 aoe L starfall Fluffy_Pillow 88.8/100: 89% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static
4:06.292 aoe O wrath Fluffy_Pillow 55.8/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static
4:07.271 aoe O wrath Fluffy_Pillow 65.8/100: 66% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage
4:08.025 aoe L starfall Fluffy_Pillow 79.8/100: 80% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage
4:09.104 aoe R starfire Fluffy_Pillow 38.8/100: 39% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
4:10.076 aoe R starfire Fluffy_Pillow 58.0/100: 58% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
4:11.690 aoe L starfall Fluffy_Pillow 89.2/100: 89% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), balance_t31_4pc_buff_lunar, best_friends_with_pip_static
4:12.896 aoe Q starfall Fluffy_Pillow 52.2/100: 52% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion
4:13.971 aoe R starfire Fluffy_Pillow 13.2/100: 13% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion
4:15.525 aoe R starfire Fluffy_Pillow 32.4/100: 32% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion
4:17.077 aoe Q starfall Fluffy_Pillow 55.6/100: 56% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion
4:18.112 aoe R starfire Fluffy_Pillow 10.6/100: 11% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, wafting_devotion
4:19.610 aoe R starfire Fluffy_Pillow 31.8/100: 32% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, wafting_devotion
4:21.105 aoe R starfire Fluffy_Pillow 53.0/100: 53% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, wafting_devotion
4:22.603 aoe L starfall Fluffy_Pillow 76.2/100: 76% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, wafting_devotion
4:23.604 aoe O wrath Fluffy_Pillow 31.2/100: 31% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(3), dreamstate, best_friends_with_pip_static, wafting_devotion
4:24.357 aoe O wrath Fluffy_Pillow 41.2/100: 41% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_pip_static, wafting_devotion
4:25.111 aoe K cancel_buff Fluffy_Pillow 51.2/100: 51% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), best_friends_with_pip_static, wafting_devotion
4:25.111 aoe L starfall Fluffy_Pillow 51.2/100: 51% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), best_friends_with_pip_static, wafting_devotion
4:26.230 aoe R starfire Fluffy_Pillow 40.2/100: 40% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:27.842 aoe Q starfall Fluffy_Pillow 63.4/100: 63% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
4:29.004 aoe R starfire Fluffy_Pillow 26.4/100: 26% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), umbral_embrace, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
4:30.676 default F natures_vigil buzzing_rune_3 49.6/100: 50% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
4:30.676 aoe Q starfall Fluffy_Pillow 49.6/100: 50% astral_power natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
4:31.793 aoe P fury_of_elune Fluffy_Pillow 10.6/100: 11% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
4:32.773 aoe R starfire Fluffy_Pillow 17.6/100: 18% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage
4:34.242 aoe R starfire Fluffy_Pillow 53.8/100: 54% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage
4:35.709 aoe L starfall Fluffy_Pillow 88.0/100: 88% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip(8), best_friends_with_pip_static, corrupting_rage
4:36.688 aoe R starfire Fluffy_Pillow 63.0/100: 63% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(7), best_friends_with_pip_static, corrupting_rage
4:38.153 default E use_items Fluffy_Pillow 95.2/100: 95% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage
4:38.153 aoe K cancel_buff Fluffy_Pillow 95.2/100: 95% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
4:38.153 aoe L starfall Fluffy_Pillow 95.2/100: 95% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), starfall(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
4:39.250 aoe Q starfall Fluffy_Pillow 66.2/100: 66% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(2), starlord, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(5), best_friends_with_pip_static, kindled_soul(95)
4:40.305 aoe R starfire Fluffy_Pillow 39.2/100: 39% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(4), best_friends_with_pip_static, kindled_soul(90)
4:41.827 aoe O wrath Fluffy_Pillow 60.4/100: 60% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(2), best_friends_with_pip_static, kindled_soul(85)
4:42.843 aoe L starfall Fluffy_Pillow 74.4/100: 74% astral_power natures_vigil, primordial_arcanic_pulsar(15), starfall(3), starlord(2), dreamstate(2), best_friends_with_pip, best_friends_with_pip_static, kindled_soul(80)
4:43.960 aoe O wrath Fluffy_Pillow 29.4/100: 29% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(3), starlord(3), umbral_embrace, dreamstate, best_friends_with_pip_static, kindled_soul(75)

Stats

Level Bonus (70) Race Bonus (tauren) Raid-Buffed Unbuffed Gear Amount
Strength 898 2 986 900 0
Agility 2089 -2 2173 2087 0
Stamina 3848 2 44833 42698 38825
Intellect 2089 -2 15807 14885 12090 (7538)
Spirit 0 0 0 0 0
Health 896660 896660 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 15807 14885 0
Crit 30.23% 24.02% 3424
Haste 24.78% 24.78% 4212
Versatility 6.30% 1.30% 267
Mana Regen 2560 2560 0
Attack Power 16439 15480 0
Mastery 29.91% 29.91% 7842
Armor 5324 5324 5324
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 489.00
Local Head Benevolent Embersage's Casque
ilevel: 489, stats: { 673 Armor, +3966 Sta, +704 Crit, +330 Haste, +938 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }, enchant: incandescent_essence
Local Neck Eye of the Rising Flame
ilevel: 489, stats: { +2231 Sta, +256 Haste, +1537 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Life-Bound Shoulderpads
ilevel: 486, stats: { 603 Armor, +2875 Sta, +383 Mastery, +383 Haste, +684 AgiInt }
item effects: { equip: Toxified }
Local Chest Benevolent Embersage's Robe
ilevel: 489, stats: { 897 Armor, +3966 Sta, +715 Crit, +318 Mastery, +938 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 489, stats: { 505 Armor, +2975 Sta, +535 Haste, +241 Mastery, +704 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 489, stats: { 785 Armor, +3966 Sta, +705 Haste, +328 Mastery, +938 AgiInt }, enchant: { +155 StrAgiInt, +41 Vers (lambent_armor_kit_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 486, stats: { 548 Armor, +2875 Sta, +274 Crit, +438 Haste, +684 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Thermal Bindings
ilevel: 489, stats: { 449 Armor, +2231 Sta, +191 Crit, +390 Mastery, +528 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Benevolent Embersage's Talons
ilevel: 489, stats: { 505 Armor, +2975 Sta, +226 Vers, +549 Mastery, +704 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 489, stats: { +2231 Sta, +512 Haste, +1281 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 489, stats: { +2231 Sta, +1230 Crit, +564 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 489, stats: { +892 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 489, stats: { +738 Mastery }
item effects: { use: Balefire Branch }
Local Back Drape of the Loyal Vassal
ilevel: 489, stats: { 359 Armor, +2231 Sta, +328 Haste, +253 Mastery, +528 StrAgiInt }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 489, weapon: { 606 - 781, 2.6 }, stats: { +469 Int, +2264 Int, +1983 Sta, +156 Haste, +361 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Buzzing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 489, stats: { +1439 Int, +1983 Sta, +174 Haste, +343 Mastery }

Profile

druid="buzzing_rune_3"
source=default
spec=balance
level=70
race=tauren
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:buzzing_rune_3

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=489,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=489,gem_id=192961/192961/192961
shoulders=lifebound_shoulderpads,id=193406,bonus_id=8836/1576/8797/8960,ilevel=486,crafted_stats=49/36
back=drape_of_the_loyal_vassal,id=158375,bonus_id=4795,ilevel=489
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=489,enchant_id=6625
wrists=thermal_bindings,id=134461,bonus_id=4795,ilevel=489,gem_id=192961
hands=benevolent_embersages_talons,id=207255,bonus_id=4795,ilevel=489
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=489,enchant_id=6830
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=486
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=489
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=489
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=489,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=489

# Gear Summary
# gear_ilvl=488.63
# gear_stamina=38825
# gear_intellect=12090
# gear_crit_rating=3424
# gear_haste_rating=4212
# gear_mastery_rating=7842
# gear_versatility_rating=267
# gear_armor=5324
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

hissing_rune_3 : 940837 dps, 171751 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
940836.8 940836.8 468.3 / 0.050% 87504.3 / 9.3% 68272.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.8 13.9 Astral Power 0.00% 56.4 100.0% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
hissing_rune_3 940837
Astral Smolder 141471 15.0% 387.9 0.84s 109084 0 Periodic 747.9 56577 0 56577 0.0% 83.1%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 387.90 0.00 747.92 747.92 303.38 0.0000 2.0000 42313918.02 42313918.02 0.00% 28287.92 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 747.92 554 947 56577.24 4695 290598 56657.11 49306 68776 42313918 42313918 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Fury of Elune 28374 3.0% 5.1 65.18s 1658126 1716451 Direct 763.4 6905 14721 11115 53.9%

Stats Details: Fury Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.12 763.39 0.00 0.00 0.00 0.9662 0.0000 8484418.75 8484418.75 0.00% 1716451.30 1716451.30
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 46.14% 352.24 185 513 6905.25 3321 22203 6913.42 5950 8090 2432171 2432171 0.00%
crit 53.86% 411.15 275 601 14720.56 6774 45295 14734.78 13052 16760 6052248 6052248 0.00%

Action Details: Fury Of Elune

  • id:202770
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:astral_power
  • energize_amount:3.0

Spelldata

  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r

Action Details: Fury Of Elune Tick

  • id:211545
  • school:astral
  • range:105.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.149000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:211545
  • name:Fury of Elune
  • school:astral
  • tooltip:
  • description:{$@spelldesc202770=Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r}

Action Priority List

    aoe
    [P]:5.12
  • if_expr:target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Hungering Shadowflame 3835 0.4% 17.0 16.87s 67427 0 Direct 17.0 51914 105977 67412 28.7%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.04 17.04 0.00 0.00 0.00 0.0000 0.0000 1149176.16 1149176.16 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.33% 12.16 3 27 51914.39 34936 202233 51735.98 34936 116531 631304 631304 0.00%
crit 28.67% 4.89 0 15 105976.73 71270 412555 105351.74 0 412555 517872 517872 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:31299.68
  • base_dd_max:31299.68
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 7121 0.8% 34.2 8.69s 62344 0 Direct 34.1 48096 98050 62497 28.8%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.19 34.11 0.00 0.00 0.00 0.0000 0.0000 2131701.14 2131701.14 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.17% 24.28 8 45 48096.35 47503 54996 48094.55 47503 50441 1167580 1167580 0.00%
crit 28.83% 9.83 0 24 98049.83 96907 112191 98028.14 0 106671 964121 964121 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42559.30
  • base_dd_max:42559.30
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 77597 8.3% 3.0 1.06s 7743964 8408213 Direct 6.0 7015 14295 10620 49.5%
Periodic 1821.5 8784 18129 12719 42.1% 99.1%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.00 6.00 1821.54 1821.54 0.00 0.9212 0.9789 23231892.09 23231892.09 0.00% 13009.04 8408212.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 50.48% 3.03 0 6 7015.24 6922 8153 6912.15 0 8153 21249 21249 0.00%
crit 49.52% 2.97 0 6 14295.13 14121 16633 14081.65 0 16633 42473 42473 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 57.89% 1054.48 766 1354 8783.67 6693 14226 8783.68 8508 9031 9262146 9262146 0.00%
crit 42.11% 767.06 559 1002 18129.33 13655 29021 18132.69 17611 18790 13906024 13906024 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy3
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    aoe
    [J]:3.00
  • if_expr:!fight_style.dungeonroute
  • target_if_expr:refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (82221) 0.0% (8.7%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 20318 2.2% 235.9 1.46s 25781 0 Direct 235.3 16198 34775 25849 51.9%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 235.89 235.28 0.00 0.00 0.00 0.0000 0.0000 6081428.72 6081428.72 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.05% 113.05 64 174 16198.46 11191 30548 16206.09 14918 17471 1831256 1831256 0.00%
crit 51.95% 122.22 75 181 34774.53 22829 62318 34803.76 32604 38304 4250173 4250173 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 20400 2.2% 237.6 1.46s 25693 0 Direct 237.0 16148 34661 25761 51.9%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 237.64 237.02 0.00 0.00 0.00 0.0000 0.0000 6105693.97 6105693.97 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.08% 113.95 63 166 16148.12 10069 30548 16154.03 14887 17477 1840105 1840105 0.00%
crit 51.92% 123.07 80 173 34661.15 20540 62318 34688.33 32565 38434 4265589 4265589 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy3
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 41503 4.4% 15.8 19.14s 787165 0 Direct 94.4 82463 177356 131580 51.8%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.78 94.40 0.00 0.00 0.00 0.0000 0.0000 12421358.98 12421358.98 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.24% 45.54 19 75 82462.52 41506 308463 82530.27 62104 110012 3754945 3754945 0.00%
crit 51.76% 48.87 22 78 177356.24 84672 619384 177500.09 134253 219878 8666414 8666414 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:enemy4
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfall 314189 33.4% 104.8 2.84s 897046 886799 Direct 1767.5 34819 75111 53166 45.5%

Stats Details: Starfall

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 104.75 1767.48 0.00 0.00 0.00 1.0116 0.0000 93966135.51 93966135.51 0.00% 886799.25 886799.25
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.47% 962.67 678 1240 34818.75 7656 138956 34897.17 31783 39051 33517530 33517530 0.00%
crit 45.53% 804.82 600 1041 75111.27 15618 264950 75255.75 69116 82994 60448605 60448605 0.00%

Action Details: Starfall

  • id:191034
  • school:astral
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:45.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]

Action Details: Starfall Damage

  • id:191037
  • school:astral
  • range:200.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.114000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.41

Spelldata

  • id:191037
  • name:Starfall
  • school:astral
  • tooltip:
  • description:{$@spelldesc191034=Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]}

Action Priority List

    aoe
    [L]:70.55
  • if_expr:variable.starfall_condition1
    aoe
    [Q]:34.20
  • if_expr:variable.starfall_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountLunar Shrapnel4151691PCT0.200
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 209634 22.3% 117.8 2.51s 532333 381647 Direct 712.9 54553 117728 87977 52.9%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.82 712.93 0.00 0.00 0.00 1.3948 0.0000 62720255.67 62720255.67 0.00% 381647.04 381647.04
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 47.09% 335.74 234 447 54552.61 7504 246924 54581.41 47688 61666 18315691 18315691 0.00%
crit 52.91% 377.19 273 486 117727.88 15308 502950 117785.50 106731 132624 44404564 44404564 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    aoe
    [M]:1.27
  • if_expr:buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
    aoe
    [R]:117.08
  • if_expr:spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Solar)4851710.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Sunfire16481550.283Mastery
Sunfire 65034 6.9% 1.0 0.00s 19455889 20965398 Direct 1.0 5507 11234 7141 28.5%
Periodic 1834.4 7390 15773 10602 38.3% 99.8%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 1834.42 1834.42 0.00 0.9285 0.9785 19455889.24 19455889.24 0.00% 10833.05 20965397.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.50% 0.71 0 1 5507.01 5472 5544 3937.30 0 5544 3937 3937 0.00%
crit 28.50% 0.29 0 1 11234.03 11163 11309 3202.17 0 11309 3202 3202 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 61.68% 1131.49 847 1422 7390.02 5532 12844 7393.86 7156 7661 8361592 8361592 0.00%
crit 38.32% 702.94 509 899 15772.73 11285 26202 15782.77 15208 16484 11087158 11087158 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    aoe
    [I]:1.00
  • target_if_expr:refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (7060) 0.0% (0.8%) 8.4 32.60s 251443 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.41 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 3689 0.4% 8.4 32.60s 131373 0 Direct 50.5 16858 34361 21895 28.8%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.41 50.48 0.00 0.00 0.00 0.0000 0.0000 1105288.20 1105288.20 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.22% 35.95 7 92 16858.06 16647 19272 16858.43 16647 18166 606075 606075 0.00%
crit 28.78% 14.53 0 41 34360.66 33959 39316 34363.17 0 39316 499213 499213 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:51134.41
  • base_dd_max:51134.41
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 3371 0.4% 16.2 15.83s 62475 0 Direct 97.0 8021 16349 10412 28.7%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.17 97.02 0.00 0.00 0.00 0.0000 0.0000 1010182.41 1010182.41 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.29% 69.16 9 179 8021.36 7921 9170 8021.49 7921 8575 554757 554757 0.00%
crit 28.71% 27.86 4 81 16348.70 16159 18707 16352.15 16159 17787 455426 455426 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24330.91
  • base_dd_max:24330.91
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 4303 0.5% 26.5 10.34s 48957 63587 Direct 26.3 34551 70523 49236 40.8%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.47 26.32 0.00 0.00 0.00 0.7699 0.0000 1295714.26 1295714.26 0.00% 63587.10 63587.10
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.18% 15.58 5 30 34550.76 15177 67321 34476.03 21953 43156 538162 538162 0.00%
crit 40.82% 10.74 2 22 70523.42 30962 135777 70386.95 36783 92865 757553 757553 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    aoe
    [O]:24.55
  • if_expr:!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.800Spell Data
Eclipse (Solar)4851710.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Lunar)4851810.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
hissing_rune_3
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:hissing_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:hissing_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:hissing_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 180.90s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    aoe
    [N]:2.00
  • if_expr:variable.cd_condition_aoe

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.2 95.42s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.22 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:hissing_rune_3
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:70932.17
  • base_dd_max:70932.17
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.40s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.73 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:hissing_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.73
Elemental Potion of Ultimate Power 1.4 305.70s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.45 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.45
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 17.4 6.0 17.7s 13.4s 9.6s 55.86% 57.86% 6.0 (20.6) 16.8

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 52.1s
  • trigger_min/max:0.0s / 37.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 24.0s
  • uptime_min/max:51.94% / 59.24%

Stack Uptimes

  • balance_of_all_things_arcane_1:5.74%
  • balance_of_all_things_arcane_2:6.12%
  • balance_of_all_things_arcane_3:6.62%
  • balance_of_all_things_arcane_4:7.04%
  • balance_of_all_things_arcane_5:7.33%
  • balance_of_all_things_arcane_6:7.56%
  • balance_of_all_things_arcane_7:7.69%
  • balance_of_all_things_arcane_8:7.76%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 10.2 0.0 29.8s 29.7s 7.9s 27.20% 30.45% 0.0 (0.0) 10.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 46.7s
  • trigger_min/max:3.7s / 46.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:24.65% / 30.00%

Stack Uptimes

  • balance_of_all_things_nature_1:3.36%
  • balance_of_all_things_nature_2:3.38%
  • balance_of_all_things_nature_3:3.39%
  • balance_of_all_things_nature_4:3.40%
  • balance_of_all_things_nature_5:3.41%
  • balance_of_all_things_nature_6:3.41%
  • balance_of_all_things_nature_7:3.42%
  • balance_of_all_things_nature_8:3.43%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 15.1 86.4 20.2s 2.9s 17.5s 88.22% 0.00% 35.5 (35.5) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 59.2s
  • trigger_min/max:0.8s / 13.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:82.93% / 92.68%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:13.34%
  • balance_t31_4pc_buff_lunar_2:13.68%
  • balance_t31_4pc_buff_lunar_3:13.97%
  • balance_t31_4pc_buff_lunar_4:11.75%
  • balance_t31_4pc_buff_lunar_5:35.47%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 8.2 57.1 38.0s 4.4s 18.9s 52.01% 0.00% 26.4 (26.4) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.1s / 83.7s
  • trigger_min/max:0.8s / 39.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.24% / 59.34%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:7.44%
  • balance_t31_4pc_buff_solar_2:6.47%
  • balance_t31_4pc_buff_solar_3:6.31%
  • balance_t31_4pc_buff_solar_4:6.44%
  • balance_t31_4pc_buff_solar_5:25.35%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 69.3s 69.3s 10.8s 10.15% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 326.5s
  • trigger_min/max:12.0s / 326.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 34.36%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.91%
  • best_friends_with_aerwynn_2:0.91%
  • best_friends_with_aerwynn_3:0.91%
  • best_friends_with_aerwynn_4:0.92%
  • best_friends_with_aerwynn_5:0.92%
  • best_friends_with_aerwynn_6:0.92%
  • best_friends_with_aerwynn_7:0.93%
  • best_friends_with_aerwynn_8:0.93%
  • best_friends_with_aerwynn_9:0.93%
  • best_friends_with_aerwynn_10:0.93%
  • best_friends_with_aerwynn_11:0.94%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 111.8s 69.3s 45.3s 33.27% 0.00% 69.4 (69.4) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:13.0s / 348.0s
  • trigger_min/max:12.0s / 326.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 319.6s
  • uptime_min/max:0.00% / 99.50%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.27%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 69.3s 69.3s 10.8s 10.16% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 327.9s
  • trigger_min/max:12.0s / 327.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 35.96%

Stack Uptimes

  • best_friends_with_pip_1:0.91%
  • best_friends_with_pip_2:0.91%
  • best_friends_with_pip_3:0.91%
  • best_friends_with_pip_4:0.92%
  • best_friends_with_pip_5:0.92%
  • best_friends_with_pip_6:0.92%
  • best_friends_with_pip_7:0.93%
  • best_friends_with_pip_8:0.93%
  • best_friends_with_pip_9:0.93%
  • best_friends_with_pip_10:0.94%
  • best_friends_with_pip_11:0.94%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 1.0 113.2s 69.3s 45.5s 33.42% 0.00% 69.6 (69.6) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 352.0s
  • trigger_min/max:12.0s / 327.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 326.5s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.42%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 69.8s 69.8s 10.8s 10.16% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 335.2s
  • trigger_min/max:12.0s / 335.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 37.48%

Stack Uptimes

  • best_friends_with_urctos_1:0.91%
  • best_friends_with_urctos_2:0.91%
  • best_friends_with_urctos_3:0.91%
  • best_friends_with_urctos_4:0.92%
  • best_friends_with_urctos_5:0.92%
  • best_friends_with_urctos_6:0.92%
  • best_friends_with_urctos_7:0.93%
  • best_friends_with_urctos_8:0.93%
  • best_friends_with_urctos_9:0.93%
  • best_friends_with_urctos_10:0.94%
  • best_friends_with_urctos_11:0.94%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 113.2s 69.8s 44.8s 33.31% 0.00% 69.5 (69.5) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 348.0s
  • trigger_min/max:12.0s / 335.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 327.3s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.31%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.53% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.53%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 62.4s 58.7s 50.1s 80.17% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 349.0s
  • trigger_min/max:15.0s / 327.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 345.3s
  • uptime_min/max:45.38% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.17%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dreamstate 15.3 0.0 20.3s 21.3s 2.1s 10.82% 20.62% 0.0 (0.1) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.6s / 55.6s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.4s
  • uptime_min/max:7.20% / 15.94%

Stack Uptimes

  • dreamstate_1:7.37%
  • dreamstate_2:3.45%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 13.3 8.1 23.6s 14.8s 21.0s 93.10% 93.81% 8.1 (8.1) 12.4

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.6s / 71.5s
  • trigger_min/max:0.0s / 58.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.0s
  • uptime_min/max:90.21% / 96.07%

Stack Uptimes

  • eclipse_lunar_1:93.10%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 8.2 0.0 38.1s 38.1s 19.1s 52.76% 54.69% 0.0 (0.0) 7.9

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.1s / 85.3s
  • trigger_min/max:12.1s / 85.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:47.06% / 59.79%

Stack Uptimes

  • eclipse_solar_1:52.76%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 305.9s 305.9s 27.3s 12.97% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 326.4s
  • trigger_min/max:300.0s / 326.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.77% / 17.85%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.97%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Fury of Elune 5.1 0.0 65.1s 65.1s 7.9s 13.49% 0.00% 75.7 (75.7) 4.9

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:60.0s / 88.6s
  • trigger_min/max:60.0s / 88.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:10.77% / 15.63%

Stack Uptimes

  • fury_of_elune_1:13.49%

Spelldata

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 8.2 0.0 38.1s 38.1s 19.1s 52.76% 55.40% 0.0 (0.0) 7.9

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.1s / 85.3s
  • trigger_min/max:12.1s / 85.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:47.06% / 59.79%

Stack Uptimes

  • incarnation_chosen_of_elune_1:52.76%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.7 0.0 90.9s 90.9s 19.6s 24.01% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:65.76

Trigger Details

  • interval_min/max:90.0s / 122.4s
  • trigger_min/max:90.0s / 122.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.16% / 27.03%

Stack Uptimes

  • kindled_soul_5:1.17%
  • kindled_soul_10:1.18%
  • kindled_soul_15:1.18%
  • kindled_soul_20:1.18%
  • kindled_soul_25:1.18%
  • kindled_soul_30:1.19%
  • kindled_soul_35:1.19%
  • kindled_soul_40:1.19%
  • kindled_soul_45:1.20%
  • kindled_soul_50:1.20%
  • kindled_soul_55:1.20%
  • kindled_soul_60:1.20%
  • kindled_soul_65:1.21%
  • kindled_soul_70:1.21%
  • kindled_soul_75:1.21%
  • kindled_soul_80:1.22%
  • kindled_soul_85:1.22%
  • kindled_soul_90:1.22%
  • kindled_soul_95:1.23%
  • kindled_soul_100:1.23%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Vigil 3.7 0.0 90.4s 90.4s 14.8s 18.41% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.5s
  • trigger_min/max:90.0s / 91.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.51% / 21.03%

Stack Uptimes

  • natures_vigil_1:18.41%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.0 69.1s 68.5s 0.9s 0.76% 1.17% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 331.4s
  • trigger_min/max:0.0s / 331.4s
  • trigger_pct:14.91%
  • duration_min/max:0.0s / 6.9s
  • uptime_min/max:0.00% / 6.02%

Stack Uptimes

  • owlkin_frenzy_1:0.76%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 9.2 96.5 34.0s 34.0s 29.8s 91.35% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:21.0s / 45.8s
  • trigger_min/max:21.0s / 45.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.7s
  • uptime_min/max:87.59% / 94.32%

Stack Uptimes

  • primordial_arcanic_pulsar_5:7.25%
  • primordial_arcanic_pulsar_10:6.74%
  • primordial_arcanic_pulsar_15:7.52%
  • primordial_arcanic_pulsar_20:8.34%
  • primordial_arcanic_pulsar_25:8.64%
  • primordial_arcanic_pulsar_30:8.39%
  • primordial_arcanic_pulsar_35:8.67%
  • primordial_arcanic_pulsar_40:9.03%
  • primordial_arcanic_pulsar_45:9.06%
  • primordial_arcanic_pulsar_50:8.83%
  • primordial_arcanic_pulsar_55:8.88%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 19.7 3.7 15.6s 13.4s 6.7s 44.00% 43.20% 3.7 (3.7) 19.3

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 42.6s
  • trigger_min/max:0.0s / 37.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:40.50% / 47.09%

Stack Uptimes

  • solstice_1:44.00%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starfall 104.7 0.0 143.1s 2.8s 295.9s 98.88% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_starfall
  • max_stacks:20
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:asynchronous
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.8s / 357.4s
  • trigger_min/max:0.7s / 9.1s
  • trigger_pct:99.99%
  • duration_min/max:7.5s / 357.9s
  • uptime_min/max:98.43% / 99.49%

Stack Uptimes

  • starfall_1:5.24%
  • starfall_2:32.47%
  • starfall_3:42.30%
  • starfall_4:15.18%
  • starfall_5:3.34%
  • starfall_6:0.36%
  • starfall_7:0.00%

Spelldata

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]
  • max_stacks:20
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Starlord 21.0 83.8 14.5s 2.8s 13.9s 97.48% 0.00% 42.4 (42.4) 6.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 19.2s
  • trigger_min/max:0.8s / 9.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:94.62% / 99.36%

Stack Uptimes

  • starlord_1:12.58%
  • starlord_2:17.71%
  • starlord_3:67.19%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Umbral Embrace 23.0 2.7 12.7s 11.3s 1.6s 12.36% 0.00% 2.7 (2.7) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_umbral_embrace
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 51.3s
  • trigger_min/max:0.0s / 51.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:4.91% / 24.06%

Stack Uptimes

  • umbral_embrace_1:12.36%

Spelldata

  • id:393763
  • name:Umbral Embrace
  • tooltip:Your next Wrath or Starfire cast during an Eclipse deals Astral damage and deals {$=}w1% additional damage.
  • description:{$@spelldesc393760=Dealing Astral damage has a chance to cause your next Wrath or Starfire cast during an Eclipse to become Astral and deal {$s1=25}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Wafting Devotion 4.3 1.2 60.7s 45.4s 16.5s 23.63% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 203.1s
  • trigger_min/max:0.0s / 201.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 66.5s
  • uptime_min/max:5.13% / 56.08%

Stack Uptimes

  • wafting_devotion_1:23.63%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Primordial Arcanic Pulsar 8.3 6.0 10.0 35.2s 23.1s 46.4s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.05% 0.00% 0.71% 0.0s 0.0s 1.0s
Astral Smolder 75.03% 64.94% 85.28% 4.3s 0.0s 48.0s
Incarnation (Total) 52.76% 47.06% 59.79% 19.1s 0.0s 54.0s
Incarnation (Pulsar) 32.46% 29.58% 34.97% 11.8s 0.0s 12.0s
Lunar Eclipse Only 40.34% 33.06% 46.36% 9.2s 0.0s 15.0s
No Eclipse 6.87% 3.93% 9.79% 1.7s 0.0s 4.5s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Fury of Elune5.2380.00028.63326.8066.12679.323

Eclipse Utilization

NoneSolarLunarBoth
Wrath24.47100.0%0.000.0%0.000.0%0.000.0%
Starfire2.472.1%0.000.0%49.8341.9%66.5256.0%
Starfall20.827.0%0.000.0%117.8739.8%157.1853.1%
Fury of Elune16.012.1%0.000.0%141.9318.6%605.4579.3%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
hissing_rune_3
Fury of EluneAstral Power80.62241.525.78%3.000.350.14%
MoonfireAstral Power3.0018.000.43%6.000.000.00%
Orbit BreakerAstral Power15.78471.2911.28%29.872.110.45%
Shooting Stars (Moonfire)Astral Power235.88471.5011.29%2.000.270.06%
Shooting Stars (Sunfire)Astral Power237.64475.0211.37%2.000.270.06%
StarfireAstral Power118.822228.4153.36%18.7535.151.55%
SunfireAstral Power1.006.000.14%6.000.000.00%
WrathAstral Power26.47264.666.34%10.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
hissing_rune_3
StarfallAstral Power 105.124137.28100.00%39.3639.5022712.05
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 896660.0 4251.22 4914.31 3600449.4 697933.5 -20895.4 896660.0
Astral Power 20.0 13.94 13.76 38.2 53.6 0.2 100.0

Statistics & Data Analysis

Fight Length
hissing_rune_3 Fight Length
Count 9104
Mean 299.70
Minimum 240.02
Maximum 359.98
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 34.9197
5th Percentile 245.44
95th Percentile 354.03
( 95th Percentile - 5th Percentile ) 108.59
Mean Distribution
Standard Deviation 0.3660
95.00% Confidence Interval ( 298.98 - 300.41 )
Normalized 95.00% Confidence Interval ( 99.76% - 100.24% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 522
0.1% Error 52153
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1041
DPS
hissing_rune_3 Damage Per Second
Count 9104
Mean 940836.85
Minimum 872422.68
Maximum 1034871.47
Spread ( max - min ) 162448.79
Range [ ( max - min ) / 2 * 100% ] 8.63%
Standard Deviation 22796.0002
5th Percentile 905325.45
95th Percentile 980436.68
( 95th Percentile - 5th Percentile ) 75111.22
Mean Distribution
Standard Deviation 238.9145
95.00% Confidence Interval ( 940368.58 - 941305.11 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2256
0.1 Scale Factor Error with Delta=300 4436097
0.05 Scale Factor Error with Delta=300 17744386
0.01 Scale Factor Error with Delta=300 443609637
Priority Target DPS
hissing_rune_3 Priority Target Damage Per Second
Count 9104
Mean 171750.52
Minimum 154310.15
Maximum 194610.78
Spread ( max - min ) 40300.63
Range [ ( max - min ) / 2 * 100% ] 11.73%
Standard Deviation 5437.2915
5th Percentile 163211.71
95th Percentile 181171.57
( 95th Percentile - 5th Percentile ) 17959.86
Mean Distribution
Standard Deviation 56.9858
95.00% Confidence Interval ( 171638.83 - 171862.21 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3851
0.1 Scale Factor Error with Delta=300 252377
0.05 Scale Factor Error with Delta=300 1009506
0.01 Scale Factor Error with Delta=300 25237649
DPS(e)
hissing_rune_3 Damage Per Second (Effective)
Count 9104
Mean 940836.85
Minimum 872422.68
Maximum 1034871.47
Spread ( max - min ) 162448.79
Range [ ( max - min ) / 2 * 100% ] 8.63%
Damage
hissing_rune_3 Damage
Count 9104
Mean 281473053.11
Minimum 221764763.05
Maximum 346568762.79
Spread ( max - min ) 124803999.74
Range [ ( max - min ) / 2 * 100% ] 22.17%
DTPS
hissing_rune_3 Damage Taken Per Second
Count 9104
Mean 4916.28
Minimum 1176.81
Maximum 10304.48
Spread ( max - min ) 9127.68
Range [ ( max - min ) / 2 * 100% ] 92.83%
HPS
hissing_rune_3 Healing Per Second
Count 9104
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
hissing_rune_3 Healing Per Second (Effective)
Count 9104
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
hissing_rune_3 Heal
Count 9104
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
hissing_rune_3 Healing Taken Per Second
Count 9104
Mean 4242.83
Minimum 819.84
Maximum 8980.58
Spread ( max - min ) 8160.73
Range [ ( max - min ) / 2 * 100% ] 96.17%
TMI
hissing_rune_3 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
hissing_rune_3Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
hissing_rune_3 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.45 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.68 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.73 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.aoe
# count action,conditions
0.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
0.00 variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
I 1.00 sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
J 3.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
0.00 variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
K 13.98 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
L 70.55 starfall,if=variable.starfall_condition1
M 1.27 starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
0.00 celestial_alignment,if=variable.cd_condition_aoe
N 2.00 incarnation,if=variable.cd_condition_aoe
0.00 warrior_of_elune
0.00 variable,name=enter_solar,value=spell_targets.starfire<3
0.00 starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
O 24.55 wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
0.00 wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
P 5.12 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
Q 34.20 starfall,if=variable.starfall_condition2
0.00 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+50
0.00 convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 new_moon,if=astral_power.deficit>variable.passive_asp+10
0.00 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
R 117.08 starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
0.00 wrath
S 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFIJJJLMNDEPQQRLRLRLRLRLRRKLQRQRRRLLRRLRLRKLQRQRRRRLRLRKLLOORLRRLRRKLQQRRLOOPLRLRKLRQRQROOLRRKLQFRQRRERLRRKLOOLRLRRLRRKLROLORQRLRRKLQPRQRRLRLRKLOOLQRRRLRRKLRQOORQRLRRKLQRQRRRLFRLOOKLNQERQRRRLPRLRKLQQRLRRLRLRRKLQRQRRRLRLRKLOOLRQRRLRRLKLQRQROORLRLRRLRQRROLORLRKLRFQPRQLERLRLRKLOOQRQRRRLRRLLOOQRRRLRRKLQQRRLOORLRDLRQRRQROOQRLRRLPQRQRLLRLR

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask hissing_rune_3 0.0/100: 0% astral_power
Pre precombat 1 food hissing_rune_3 0.0/100: 0% astral_power corrupting_rage
Pre precombat 2 augmentation hissing_rune_3 0.0/100: 0% astral_power corrupting_rage
Pre precombat 4 no_cd_talent hissing_rune_3 0.0/100: 0% astral_power corrupting_rage
Pre precombat 5 on_use_trinket hissing_rune_3 0.0/100: 0% astral_power corrupting_rage
Pre precombat 6 on_use_trinket hissing_rune_3 0.0/100: 0% astral_power corrupting_rage
Pre precombat 7 on_use_trinket hissing_rune_3 0.0/100: 0% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 10.0/100: 10% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil hissing_rune_3 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.000 aoe I sunfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.929 aoe J moonfire Fluffy_Pillow 45.2/100: 45% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:01.857 aoe J moonfire enemy2 57.2/100: 57% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:02.786 aoe J moonfire enemy4 67.2/100: 67% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:03.714 aoe L starfall Fluffy_Pillow 79.2/100: 79% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, solstice, dreamstate, wafting_devotion, corrupting_rage
0:04.577 aoe M starfire Fluffy_Pillow 42.2/100: 42% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, wafting_devotion, corrupting_rage
0:05.330 aoe N incarnation_chosen_of_elune Fluffy_Pillow 63.4/100: 63% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, wafting_devotion, corrupting_rage
0:05.330 default D potion Fluffy_Pillow 63.4/100: 63% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), wafting_devotion, corrupting_rage
0:05.330 default E use_items Fluffy_Pillow 63.4/100: 63% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:05.330 aoe P fury_of_elune Fluffy_Pillow 63.4/100: 63% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:06.083 aoe Q starfall Fluffy_Pillow 72.4/100: 72% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:06.839 aoe Q starfall Fluffy_Pillow 49.4/100: 49% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:07.592 aoe R starfire Fluffy_Pillow 25.4/100: 25% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:08.346 aoe L starfall Fluffy_Pillow 58.6/100: 59% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:09.101 aoe R starfire Fluffy_Pillow 60.6/100: 61% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:09.855 aoe L starfall Fluffy_Pillow 89.8/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
0:10.610 aoe R starfire Fluffy_Pillow 61.8/100: 62% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(5), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:11.658 aoe L starfall Fluffy_Pillow 93.0/100: 93% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), starfall(5), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
0:12.411 aoe R starfire Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:13.460 aoe L starfall Fluffy_Pillow 95.2/100: 95% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:14.215 aoe R starfire Fluffy_Pillow 62.2/100: 62% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:15.265 aoe L starfall Fluffy_Pillow 81.4/100: 81% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:16.018 aoe R starfire Fluffy_Pillow 48.4/100: 48% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:17.066 aoe R starfire Fluffy_Pillow 69.6/100: 70% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:18.113 aoe K cancel_buff Fluffy_Pillow 94.8/100: 95% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:18.113 aoe L starfall Fluffy_Pillow 94.8/100: 95% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:18.898 aoe Q starfall Fluffy_Pillow 61.8/100: 62% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:19.708 aoe R starfire Fluffy_Pillow 30.8/100: 31% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:20.879 aoe Q starfall Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:21.662 aoe R starfire Fluffy_Pillow 19.0/100: 19% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:22.792 aoe R starfire Fluffy_Pillow 40.2/100: 40% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:23.922 aoe R starfire Fluffy_Pillow 61.4/100: 61% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:25.051 aoe L starfall Fluffy_Pillow 80.6/100: 81% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:25.806 aoe L starfall Fluffy_Pillow 49.6/100: 50% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:26.561 aoe R starfire Fluffy_Pillow 18.6/100: 19% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:27.690 aoe R starfire Fluffy_Pillow 73.8/100: 74% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:28.819 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:29.574 aoe R starfire Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:30.704 aoe L starfall Fluffy_Pillow 94.2/100: 94% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:31.460 aoe R starfire Fluffy_Pillow 65.2/100: 65% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:32.590 aoe K cancel_buff Fluffy_Pillow 88.4/100: 88% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:32.590 aoe L starfall Fluffy_Pillow 88.4/100: 88% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:33.434 aoe Q starfall Fluffy_Pillow 53.4/100: 53% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:34.249 aoe R starfire Fluffy_Pillow 18.4/100: 18% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:35.420 aoe Q starfall Fluffy_Pillow 39.6/100: 40% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5)
0:36.201 aoe R starfire Fluffy_Pillow 10.6/100: 11% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5)
0:37.330 aoe R starfire Fluffy_Pillow 33.8/100: 34% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5)
0:38.459 aoe R starfire Fluffy_Pillow 53.0/100: 53% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5)
0:39.588 aoe R starfire Fluffy_Pillow 74.2/100: 74% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5)
0:40.718 aoe L starfall Fluffy_Pillow 97.4/100: 97% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5)
0:41.698 aoe R starfire Fluffy_Pillow 64.4/100: 64% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5)
0:43.166 aoe L starfall Fluffy_Pillow 85.6/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(10)
0:44.143 aoe R starfire Fluffy_Pillow 52.6/100: 53% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9)
0:45.612 aoe K cancel_buff Fluffy_Pillow 71.8/100: 72% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(8), corrupting_rage
0:45.612 aoe L starfall Fluffy_Pillow 71.8/100: 72% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(8), corrupting_rage
0:46.708 aoe L starfall Fluffy_Pillow 38.8/100: 39% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(7), corrupting_rage
0:47.762 aoe O wrath Fluffy_Pillow 5.8/100: 6% astral_power primordial_arcanic_pulsar(50), starfall(4), starlord(2), dreamstate, best_friends_with_pip(6), corrupting_rage
0:48.516 aoe O wrath Fluffy_Pillow 15.8/100: 16% astral_power primordial_arcanic_pulsar(50), starfall(4), starlord(2), best_friends_with_pip(5), corrupting_rage
0:49.272 aoe R starfire Fluffy_Pillow 25.8/100: 26% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(2), best_friends_with_pip(4), corrupting_rage
0:50.945 aoe L starfall Fluffy_Pillow 83.0/100: 83% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(2), best_friends_with_pip(2), corrupting_rage
0:52.062 aoe R starfire Fluffy_Pillow 44.0/100: 44% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip, corrupting_rage
0:53.676 aoe R starfire Fluffy_Pillow 67.2/100: 67% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, corrupting_rage
0:55.291 aoe L starfall Fluffy_Pillow 92.4/100: 92% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall, starlord(3), balance_t31_4pc_buff_lunar, corrupting_rage
0:56.369 aoe R starfire Fluffy_Pillow 55.4/100: 55% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), corrupting_rage
0:57.837 aoe R starfire Fluffy_Pillow 80.6/100: 81% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), corrupting_rage
0:59.305 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), corrupting_rage
0:59.305 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), corrupting_rage
1:00.400 aoe Q starfall Fluffy_Pillow 69.0/100: 69% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), corrupting_rage
1:01.454 aoe Q starfall Fluffy_Pillow 40.0/100: 40% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), corrupting_rage
1:02.467 aoe R starfire Fluffy_Pillow 7.0/100: 7% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), corrupting_rage
1:03.933 aoe R starfire Fluffy_Pillow 26.2/100: 26% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), corrupting_rage
1:05.399 aoe L starfall Fluffy_Pillow 77.4/100: 77% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), corrupting_rage
1:06.379 aoe O wrath Fluffy_Pillow 42.4/100: 42% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
1:07.358 aoe O wrath Fluffy_Pillow 54.4/100: 54% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(3), dreamstate, corrupting_rage
1:08.113 aoe P fury_of_elune Fluffy_Pillow 64.4/100: 64% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), dreamstate, corrupting_rage
1:09.192 aoe L starfall Fluffy_Pillow 74.4/100: 74% astral_power balance_of_all_things_arcane(7), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), dreamstate, corrupting_rage
1:10.269 aoe R starfire Fluffy_Pillow 39.4/100: 39% astral_power balance_of_all_things_arcane(6), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, corrupting_rage
1:11.241 aoe L starfall Fluffy_Pillow 72.6/100: 73% astral_power balance_of_all_things_arcane(5), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, corrupting_rage
1:12.320 aoe R starfire Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_arcane(4), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), corrupting_rage
1:13.934 aoe K cancel_buff Fluffy_Pillow 77.8/100: 78% astral_power balance_of_all_things_arcane(3), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), corrupting_rage
1:13.934 aoe L starfall Fluffy_Pillow 77.8/100: 78% astral_power balance_of_all_things_arcane(3), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), solstice, starfall(2), balance_t31_4pc_buff_lunar(2), corrupting_rage
1:15.142 aoe R starfire Fluffy_Pillow 41.8/100: 42% astral_power balance_of_all_things_arcane, eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(35), starfall(3), starlord, balance_t31_4pc_buff_lunar(3), corrupting_rage
1:16.880 aoe Q starfall Fluffy_Pillow 71.0/100: 71% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord, balance_t31_4pc_buff_lunar(3), corrupting_rage
1:18.040 aoe R starfire Fluffy_Pillow 28.0/100: 28% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), balance_t31_4pc_buff_lunar(4), corrupting_rage
1:19.714 aoe Q starfall Fluffy_Pillow 47.2/100: 47% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(4), corrupting_rage
1:20.830 aoe R starfire Fluffy_Pillow 4.2/100: 4% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage
1:22.443 aoe O wrath Fluffy_Pillow 31.4/100: 31% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage
1:23.522 aoe O wrath Fluffy_Pillow 43.4/100: 43% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(3), dreamstate, best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, corrupting_rage
1:24.277 aoe L starfall Fluffy_Pillow 53.4/100: 53% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), dreamstate, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, corrupting_rage
1:25.356 aoe R starfire Fluffy_Pillow 12.4/100: 12% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, corrupting_rage
1:26.324 aoe R starfire Fluffy_Pillow 65.6/100: 66% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, corrupting_rage
1:27.937 aoe K cancel_buff Fluffy_Pillow 92.8/100: 93% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, corrupting_rage
1:27.937 aoe L starfall Fluffy_Pillow 92.8/100: 93% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, corrupting_rage
1:29.142 aoe Q starfall Fluffy_Pillow 53.8/100: 54% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, corrupting_rage
1:30.301 default F natures_vigil hissing_rune_3 12.8/100: 13% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static, corrupting_rage
1:30.301 aoe R starfire Fluffy_Pillow 12.8/100: 13% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static, corrupting_rage
1:31.823 aoe Q starfall Fluffy_Pillow 38.0/100: 38% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, corrupting_rage
1:32.838 aoe R starfire Fluffy_Pillow 9.0/100: 9% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, corrupting_rage
1:34.305 aoe R starfire Fluffy_Pillow 38.2/100: 38% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, corrupting_rage
1:35.774 default E use_items Fluffy_Pillow 63.4/100: 63% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, corrupting_rage
1:35.774 aoe R starfire Fluffy_Pillow 63.4/100: 63% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(100)
1:37.241 aoe L starfall Fluffy_Pillow 84.6/100: 85% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall, starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage, kindled_soul(95)
1:38.220 aoe R starfire Fluffy_Pillow 49.6/100: 50% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage, kindled_soul(90)
1:39.687 aoe R starfire Fluffy_Pillow 68.8/100: 69% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage, kindled_soul(85)
1:41.154 aoe K cancel_buff Fluffy_Pillow 84.8/100: 85% astral_power natures_vigil, primordial_arcanic_pulsar(10), starfall, starlord(3), dreamstate(2), best_friends_with_pip(8), best_friends_with_pip_static, corrupting_rage, kindled_soul(75)
1:41.154 aoe L starfall Fluffy_Pillow 84.8/100: 85% astral_power natures_vigil, primordial_arcanic_pulsar(10), starfall, dreamstate(2), best_friends_with_pip(8), best_friends_with_pip_static, corrupting_rage, kindled_soul(75)
1:42.361 aoe O wrath Fluffy_Pillow 41.8/100: 42% astral_power natures_vigil, primordial_arcanic_pulsar(15), starfall(2), starlord, dreamstate, best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage, kindled_soul(70)
1:43.116 aoe O wrath Fluffy_Pillow 51.8/100: 52% astral_power natures_vigil, primordial_arcanic_pulsar(15), starfall(2), starlord, best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage, kindled_soul(65)
1:43.870 aoe L starfall Fluffy_Pillow 61.8/100: 62% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(15), solstice, starfall(2), starlord, umbral_embrace, best_friends_with_pip(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(60)
1:45.029 aoe R starfire Fluffy_Pillow 20.8/100: 21% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(2), umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage, kindled_soul(55)
1:46.703 aoe L starfall Fluffy_Pillow 80.0/100: 80% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(50)
1:47.821 aoe R starfire Fluffy_Pillow 39.0/100: 39% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip, best_friends_with_pip_static, corrupting_rage, kindled_soul(40)
1:49.437 aoe R starfire Fluffy_Pillow 62.2/100: 62% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(35)
1:51.051 aoe L starfall Fluffy_Pillow 85.4/100: 85% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(25), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(25)
1:52.129 aoe R starfire Fluffy_Pillow 40.4/100: 40% astral_power eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(20)
1:53.745 aoe R starfire Fluffy_Pillow 61.6/100: 62% astral_power eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(15)
1:55.359 aoe K cancel_buff Fluffy_Pillow 82.8/100: 83% astral_power eclipse_lunar, primordial_arcanic_pulsar(30), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(5)
1:55.359 aoe L starfall Fluffy_Pillow 82.8/100: 83% astral_power eclipse_lunar, primordial_arcanic_pulsar(30), starfall, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(5)
1:56.565 aoe R starfire Fluffy_Pillow 41.8/100: 42% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
1:58.303 aoe O wrath Fluffy_Pillow 63.0/100: 63% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
1:59.463 aoe L starfall Fluffy_Pillow 73.0/100: 73% astral_power primordial_arcanic_pulsar(35), starfall, starlord, dreamstate(2), best_friends_with_pip_static, corrupting_rage
2:00.621 aoe O wrath Fluffy_Pillow 32.0/100: 32% astral_power primordial_arcanic_pulsar(40), starfall(2), starlord(2), dreamstate, best_friends_with_pip_static, corrupting_rage
2:01.377 aoe R starfire Fluffy_Pillow 42.0/100: 42% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(40), solstice, starfall(2), starlord(2), best_friends_with_pip_static, corrupting_rage
2:02.381 aoe Q starfall Fluffy_Pillow 69.2/100: 69% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(40), solstice, starfall(2), starlord(2), best_friends_with_pip_static, corrupting_rage
2:03.496 aoe R starfire Fluffy_Pillow 28.2/100: 28% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
2:05.110 aoe L starfall Fluffy_Pillow 55.4/100: 55% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
2:06.187 aoe R starfire Fluffy_Pillow 14.4/100: 14% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
2:07.803 aoe R starfire Fluffy_Pillow 67.6/100: 68% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(50), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
2:09.419 aoe K cancel_buff Fluffy_Pillow 88.8/100: 89% astral_power eclipse_lunar, primordial_arcanic_pulsar(50), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
2:09.419 aoe L starfall Fluffy_Pillow 88.8/100: 89% astral_power eclipse_lunar, primordial_arcanic_pulsar(50), starfall(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
2:10.625 aoe Q starfall Fluffy_Pillow 47.8/100: 48% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
2:11.783 aoe P fury_of_elune Fluffy_Pillow 6.8/100: 7% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
2:12.799 aoe R starfire Fluffy_Pillow 20.8/100: 21% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
2:14.321 aoe Q starfall Fluffy_Pillow 53.0/100: 53% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
2:15.337 aoe R starfire Fluffy_Pillow 28.0/100: 28% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
2:16.804 aoe R starfire Fluffy_Pillow 64.2/100: 64% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
2:18.271 aoe L starfall Fluffy_Pillow 91.4/100: 91% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
2:19.251 aoe R starfire Fluffy_Pillow 62.4/100: 62% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
2:20.718 aoe L starfall Fluffy_Pillow 91.6/100: 92% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:21.627 aoe R starfire Fluffy_Pillow 56.6/100: 57% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:22.990 aoe K cancel_buff Fluffy_Pillow 72.6/100: 73% astral_power primordial_arcanic_pulsar(15), starfall(2), starlord(3), dreamstate(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:22.990 aoe L starfall Fluffy_Pillow 72.6/100: 73% astral_power primordial_arcanic_pulsar(15), starfall(2), dreamstate(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:24.110 aoe O wrath Fluffy_Pillow 31.6/100: 32% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord, dreamstate, best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:24.865 aoe O wrath Fluffy_Pillow 43.6/100: 44% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord, best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:25.618 aoe L starfall Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord, best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:26.696 aoe Q starfall Fluffy_Pillow 48.6/100: 49% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:27.730 aoe R starfire Fluffy_Pillow 7.6/100: 8% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:29.227 aoe R starfire Fluffy_Pillow 32.8/100: 33% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:30.726 aoe R starfire Fluffy_Pillow 62.0/100: 62% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:32.222 aoe L starfall Fluffy_Pillow 85.2/100: 85% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:33.222 aoe R starfire Fluffy_Pillow 40.2/100: 40% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:34.720 aoe R starfire Fluffy_Pillow 61.4/100: 61% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
2:36.333 aoe K cancel_buff Fluffy_Pillow 82.6/100: 83% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
2:36.333 aoe L starfall Fluffy_Pillow 82.6/100: 83% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
2:37.539 aoe R starfire Fluffy_Pillow 43.6/100: 44% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
2:39.276 aoe Q starfall Fluffy_Pillow 62.8/100: 63% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage
2:40.435 aoe O wrath Fluffy_Pillow 17.8/100: 18% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage
2:41.553 aoe O wrath Fluffy_Pillow 29.8/100: 30% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(2), dreamstate, best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage
2:42.307 aoe R starfire Fluffy_Pillow 41.8/100: 42% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage
2:43.313 aoe Q starfall Fluffy_Pillow 67.0/100: 67% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage
2:44.430 aoe R starfire Fluffy_Pillow 26.0/100: 26% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage
2:46.044 aoe L starfall Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage
2:47.123 aoe R starfire Fluffy_Pillow 40.2/100: 40% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage
2:48.736 aoe R starfire Fluffy_Pillow 67.4/100: 67% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage
2:50.352 aoe K cancel_buff Fluffy_Pillow 90.6/100: 91% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, corrupting_rage
2:50.352 aoe L starfall Fluffy_Pillow 90.6/100: 91% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, corrupting_rage
2:51.558 aoe Q starfall Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, corrupting_rage
2:52.612 aoe R starfire Fluffy_Pillow 20.6/100: 21% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage
2:54.133 aoe Q starfall Fluffy_Pillow 47.8/100: 48% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:55.077 aoe R starfire Fluffy_Pillow 16.8/100: 17% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:56.439 aoe R starfire Fluffy_Pillow 42.0/100: 42% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:57.800 aoe R starfire Fluffy_Pillow 67.2/100: 67% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:59.160 aoe L starfall Fluffy_Pillow 88.4/100: 88% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:00.071 default F natures_vigil hissing_rune_3 53.4/100: 53% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:00.301 aoe R starfire Fluffy_Pillow 55.4/100: 55% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:01.662 aoe L starfall Fluffy_Pillow 74.6/100: 75% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:02.571 aoe O wrath Fluffy_Pillow 41.6/100: 42% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(2), starlord(3), umbral_embrace, dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:03.326 aoe O wrath Fluffy_Pillow 51.6/100: 52% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(2), starlord(3), umbral_embrace, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:04.080 aoe K cancel_buff Fluffy_Pillow 65.6/100: 66% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), umbral_embrace, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:04.080 aoe L starfall Fluffy_Pillow 65.6/100: 66% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), umbral_embrace, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:05.199 aoe N incarnation_chosen_of_elune Fluffy_Pillow 54.6/100: 55% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord, umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:05.330 aoe Q starfall Fluffy_Pillow 54.6/100: 55% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord, umbral_embrace, dreamstate(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:06.308 default E use_items Fluffy_Pillow 23.6/100: 24% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(4), starlord(2), umbral_embrace, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:06.308 aoe R starfire Fluffy_Pillow 23.6/100: 24% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(4), starlord(2), umbral_embrace, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(100)
3:07.159 aoe Q starfall Fluffy_Pillow 46.8/100: 47% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(4), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(100)
3:08.101 aoe R starfire Fluffy_Pillow 15.8/100: 16% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(95)
3:08.920 aoe R starfire Fluffy_Pillow 39.0/100: 39% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage, kindled_soul(90)
3:10.387 aoe R starfire Fluffy_Pillow 62.2/100: 62% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage, kindled_soul(80)
3:11.854 aoe L starfall Fluffy_Pillow 87.4/100: 87% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage, kindled_soul(75)
3:12.833 aoe P fury_of_elune Fluffy_Pillow 56.4/100: 56% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage, kindled_soul(70)
3:13.812 aoe R starfire Fluffy_Pillow 61.4/100: 61% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage, kindled_soul(65)
3:15.280 aoe L starfall Fluffy_Pillow 93.6/100: 94% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(40), starfall, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(60)
3:16.260 aoe R starfire Fluffy_Pillow 66.6/100: 67% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage, kindled_soul(55)
3:17.728 aoe K cancel_buff Fluffy_Pillow 96.8/100: 97% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage, kindled_soul(45)
3:17.728 aoe L starfall Fluffy_Pillow 96.8/100: 97% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), starfall(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage, kindled_soul(45)
3:18.825 aoe Q starfall Fluffy_Pillow 69.8/100: 70% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(3), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage, kindled_soul(40)
3:19.879 aoe Q starfall Fluffy_Pillow 47.8/100: 48% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(3), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(35)
3:20.894 aoe R starfire Fluffy_Pillow 24.8/100: 25% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(30)
3:22.362 aoe L starfall Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(20)
3:23.340 aoe R starfire Fluffy_Pillow 51.0/100: 51% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(15)
3:24.808 aoe R starfire Fluffy_Pillow 82.2/100: 82% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(10)
3:26.277 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(5)
3:27.256 aoe R starfire Fluffy_Pillow 67.0/100: 67% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:28.723 aoe L starfall Fluffy_Pillow 90.2/100: 90% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:29.701 aoe R starfire Fluffy_Pillow 55.2/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:31.169 aoe R starfire Fluffy_Pillow 74.4/100: 74% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:32.636 aoe K cancel_buff Fluffy_Pillow 99.6/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:32.636 aoe L starfall Fluffy_Pillow 99.6/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:33.732 aoe Q starfall Fluffy_Pillow 64.6/100: 65% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:34.786 aoe R starfire Fluffy_Pillow 33.6/100: 34% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(3), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:36.306 aoe Q starfall Fluffy_Pillow 58.8/100: 59% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(3), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:37.320 aoe R starfire Fluffy_Pillow 23.8/100: 24% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:38.788 aoe R starfire Fluffy_Pillow 45.0/100: 45% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:40.256 aoe R starfire Fluffy_Pillow 68.2/100: 68% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion
3:41.617 aoe L starfall Fluffy_Pillow 87.4/100: 87% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion
3:42.525 aoe R starfire Fluffy_Pillow 54.4/100: 54% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:43.887 aoe L starfall Fluffy_Pillow 75.6/100: 76% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:44.796 aoe R starfire Fluffy_Pillow 42.6/100: 43% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:46.157 aoe K cancel_buff Fluffy_Pillow 63.8/100: 64% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:46.157 aoe L starfall Fluffy_Pillow 63.8/100: 64% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:47.175 aoe O wrath Fluffy_Pillow 28.8/100: 29% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:48.154 aoe O wrath Fluffy_Pillow 38.8/100: 39% astral_power primordial_arcanic_pulsar(45), starfall(3), starlord, dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:48.909 aoe L starfall Fluffy_Pillow 82.8/100: 83% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(3), starlord, dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:49.983 aoe R starfire Fluffy_Pillow 41.8/100: 42% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:50.917 aoe Q starfall Fluffy_Pillow 67.0/100: 67% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:51.952 aoe R starfire Fluffy_Pillow 26.0/100: 26% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:53.451 aoe R starfire Fluffy_Pillow 51.2/100: 51% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:54.947 aoe L starfall Fluffy_Pillow 78.4/100: 78% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, corrupting_rage
3:56.024 aoe R starfire Fluffy_Pillow 41.4/100: 41% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, corrupting_rage
3:57.490 aoe R starfire Fluffy_Pillow 66.6/100: 67% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, corrupting_rage
3:58.956 aoe L starfall Fluffy_Pillow 95.8/100: 96% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, corrupting_rage
3:59.935 aoe K cancel_buff Fluffy_Pillow 66.8/100: 67% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage
3:59.935 aoe L starfall Fluffy_Pillow 66.8/100: 67% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage
4:01.032 aoe Q starfall Fluffy_Pillow 67.8/100: 68% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
4:02.086 aoe R starfire Fluffy_Pillow 34.8/100: 35% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
4:03.608 aoe Q starfall Fluffy_Pillow 56.0/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
4:04.623 aoe R starfire Fluffy_Pillow 25.0/100: 25% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
4:06.092 aoe O wrath Fluffy_Pillow 46.2/100: 46% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
4:07.072 aoe O wrath Fluffy_Pillow 56.2/100: 56% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(3), dreamstate, best_friends_with_urctos_static, corrupting_rage
4:07.826 aoe R starfire Fluffy_Pillow 68.2/100: 68% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), best_friends_with_urctos_static, corrupting_rage
4:08.796 aoe L starfall Fluffy_Pillow 93.4/100: 93% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, corrupting_rage
4:09.874 aoe R starfire Fluffy_Pillow 52.4/100: 52% astral_power balance_of_all_things_arcane(6), eclipse_lunar, owlkin_frenzy, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, corrupting_rage
4:10.952 aoe L starfall Fluffy_Pillow 75.6/100: 76% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static
4:12.031 aoe R starfire Fluffy_Pillow 34.6/100: 35% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static
4:13.646 aoe R starfire Fluffy_Pillow 59.8/100: 60% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static
4:15.261 aoe L starfall Fluffy_Pillow 83.0/100: 83% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static
4:16.469 aoe R starfire Fluffy_Pillow 40.0/100: 40% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static
4:18.207 aoe Q starfall Fluffy_Pillow 63.2/100: 63% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static
4:19.367 aoe R starfire Fluffy_Pillow 18.2/100: 18% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, wafting_devotion
4:20.921 aoe R starfire Fluffy_Pillow 39.4/100: 39% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, wafting_devotion
4:22.473 aoe O wrath Fluffy_Pillow 60.6/100: 61% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, wafting_devotion
4:23.509 aoe L starfall Fluffy_Pillow 72.6/100: 73% astral_power primordial_arcanic_pulsar(40), starfall, starlord(2), dreamstate(2), best_friends_with_pip(11), best_friends_with_pip_static, wafting_devotion
4:24.546 aoe O wrath Fluffy_Pillow 27.6/100: 28% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(3), dreamstate, best_friends_with_pip(10), best_friends_with_pip_static, wafting_devotion
4:25.303 aoe R starfire Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), best_friends_with_pip(10), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:26.202 aoe L starfall Fluffy_Pillow 92.8/100: 93% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), best_friends_with_pip(9), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:27.201 aoe R starfire Fluffy_Pillow 51.8/100: 52% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip(8), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:28.700 aoe K cancel_buff Fluffy_Pillow 75.0/100: 75% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip(6), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:28.700 aoe L starfall Fluffy_Pillow 75.0/100: 75% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), balance_t31_4pc_buff_lunar, best_friends_with_pip(6), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:29.819 aoe R starfire Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_pip(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:31.429 default F natures_vigil hissing_rune_3 61.2/100: 61% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(3), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_pip(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:31.429 aoe Q starfall Fluffy_Pillow 61.2/100: 61% astral_power natures_vigil, balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(3), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_pip(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:32.504 aoe P fury_of_elune Fluffy_Pillow 20.2/100: 20% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(2), umbral_embrace, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:33.445 aoe R starfire Fluffy_Pillow 31.2/100: 31% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(3), starlord(2), umbral_embrace, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:34.857 aoe Q starfall Fluffy_Pillow 71.4/100: 71% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
4:35.874 aoe L starfall Fluffy_Pillow 48.4/100: 48% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
4:36.854 default E use_items Fluffy_Pillow 23.4/100: 23% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
4:36.854 aoe R starfire Fluffy_Pillow 23.4/100: 23% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
4:38.322 aoe L starfall Fluffy_Pillow 85.6/100: 86% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(95)
4:39.302 aoe R starfire Fluffy_Pillow 58.6/100: 59% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(90)
4:40.769 aoe L starfall Fluffy_Pillow 90.8/100: 91% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(85)
4:41.748 aoe R starfire Fluffy_Pillow 57.8/100: 58% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(80)
4:42.728 aoe K cancel_buff Fluffy_Pillow 79.0/100: 79% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(75)
4:42.728 aoe L starfall Fluffy_Pillow 79.0/100: 79% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(75)
4:43.826 aoe O wrath Fluffy_Pillow 46.0/100: 46% astral_power natures_vigil, primordial_arcanic_pulsar(25), starfall(4), starlord, dreamstate, best_friends_with_pip_static, corrupting_rage, kindled_soul(70)
4:44.579 aoe O wrath Fluffy_Pillow 56.0/100: 56% astral_power natures_vigil, primordial_arcanic_pulsar(25), starfall(3), starlord, best_friends_with_pip_static, corrupting_rage, kindled_soul(65)
4:45.333 aoe Q starfall Fluffy_Pillow 68.0/100: 68% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord, best_friends_with_pip_static, corrupting_rage, kindled_soul(60)
4:46.493 aoe R starfire Fluffy_Pillow 29.0/100: 29% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(2), umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage, kindled_soul(55)
4:48.167 aoe Q starfall Fluffy_Pillow 60.2/100: 60% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage, kindled_soul(45)
4:49.285 aoe R starfire Fluffy_Pillow 21.2/100: 21% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(40)
4:50.899 aoe R starfire Fluffy_Pillow 44.4/100: 44% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(30)
4:52.514 aoe R starfire Fluffy_Pillow 71.6/100: 72% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(25)
4:54.130 aoe L starfall Fluffy_Pillow 92.8/100: 93% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, kindled_soul(15)
4:55.207 aoe R starfire Fluffy_Pillow 47.8/100: 48% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, kindled_soul(10)
4:56.821 aoe R starfire Fluffy_Pillow 67.0/100: 67% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, kindled_soul(5)
4:58.436 aoe L starfall Fluffy_Pillow 88.2/100: 88% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static
4:59.640 aoe L starfall Fluffy_Pillow 45.2/100: 45% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static
5:00.801 aoe O wrath Fluffy_Pillow 0.2/100: 0% astral_power primordial_arcanic_pulsar(50), starfall(3), starlord(2), dreamstate, best_friends_with_pip_static
5:01.554 aoe O wrath Fluffy_Pillow 44.2/100: 44% astral_power primordial_arcanic_pulsar(50), starfall(3), starlord(2), best_friends_with_pip_static
5:02.308 aoe Q starfall Fluffy_Pillow 54.2/100: 54% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), best_friends_with_pip_static
5:03.424 aoe R starfire Fluffy_Pillow 13.2/100: 13% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static
5:05.039 aoe R starfire Fluffy_Pillow 40.4/100: 40% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static
5:06.652 aoe R starfire Fluffy_Pillow 63.6/100: 64% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static
5:08.266 aoe L starfall Fluffy_Pillow 92.8/100: 93% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static
5:09.344 aoe R starfire Fluffy_Pillow 53.8/100: 54% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
5:10.811 aoe R starfire Fluffy_Pillow 77.0/100: 77% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
5:12.278 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
5:12.278 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
5:13.374 aoe Q starfall Fluffy_Pillow 69.0/100: 69% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
5:14.431 aoe Q starfall Fluffy_Pillow 40.0/100: 40% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
5:15.447 aoe R starfire Fluffy_Pillow 5.0/100: 5% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
5:16.914 aoe R starfire Fluffy_Pillow 26.2/100: 26% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
5:18.382 aoe L starfall Fluffy_Pillow 45.4/100: 45% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
5:19.361 aoe O wrath Fluffy_Pillow 10.4/100: 10% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
5:20.340 aoe O wrath Fluffy_Pillow 52.4/100: 52% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage
5:21.093 aoe R starfire Fluffy_Pillow 64.4/100: 64% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage
5:22.064 aoe L starfall Fluffy_Pillow 87.6/100: 88% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
5:23.141 aoe R starfire Fluffy_Pillow 48.6/100: 49% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
5:24.755 default D potion Fluffy_Pillow 73.8/100: 74% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
5:24.755 aoe L starfall Fluffy_Pillow 73.8/100: 74% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power
5:25.832 aoe R starfire Fluffy_Pillow 32.8/100: 33% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power
5:27.445 aoe Q starfall Fluffy_Pillow 60.0/100: 60% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power
5:28.652 aoe R starfire Fluffy_Pillow 17.0/100: 17% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord, umbral_embrace, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power
5:30.389 aoe R starfire Fluffy_Pillow 40.2/100: 40% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power
5:32.126 aoe Q starfall Fluffy_Pillow 65.4/100: 65% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power
5:33.285 aoe R starfire Fluffy_Pillow 20.4/100: 20% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:34.957 aoe O wrath Fluffy_Pillow 41.6/100: 42% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:36.076 aoe O wrath Fluffy_Pillow 55.6/100: 56% astral_power primordial_arcanic_pulsar(40), starfall, starlord(2), umbral_embrace, dreamstate, best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:36.831 aoe Q starfall Fluffy_Pillow 65.6/100: 66% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(40), solstice, starfall, starlord(2), umbral_embrace, dreamstate, best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:37.950 aoe R starfire Fluffy_Pillow 24.6/100: 25% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_urctos(7), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
5:38.922 aoe L starfall Fluffy_Pillow 47.8/100: 48% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos(6), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
5:39.999 aoe R starfire Fluffy_Pillow 40.8/100: 41% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(5), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
5:41.613 aoe R starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(3), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power
5:43.113 aoe L starfall Fluffy_Pillow 95.2/100: 95% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(50), starfall(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power
5:44.233 aoe P fury_of_elune Fluffy_Pillow 52.2/100: 52% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(3), starlord, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power
5:45.309 aoe Q starfall Fluffy_Pillow 62.2/100: 62% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(2), starlord, balance_t31_4pc_buff_lunar(3), best_friends_with_pip(11), best_friends_with_pip_static, wafting_devotion, elemental_potion_of_ultimate_power
5:46.386 aoe R starfire Fluffy_Pillow 29.2/100: 29% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(4), best_friends_with_pip(10), best_friends_with_pip_static, wafting_devotion, elemental_potion_of_ultimate_power
5:47.797 aoe Q starfall Fluffy_Pillow 67.4/100: 67% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(4), best_friends_with_pip(9), best_friends_with_pip_static, wafting_devotion, elemental_potion_of_ultimate_power
5:48.740 aoe R starfire Fluffy_Pillow 44.4/100: 44% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(8), best_friends_with_pip_static, wafting_devotion, elemental_potion_of_ultimate_power
5:50.101 aoe L starfall Fluffy_Pillow 77.6/100: 78% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(7), best_friends_with_pip_static, wafting_devotion, elemental_potion_of_ultimate_power
5:51.011 aoe L starfall Fluffy_Pillow 84.6/100: 85% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(6), best_friends_with_pip_static, wafting_devotion, elemental_potion_of_ultimate_power
5:51.921 aoe R starfire Fluffy_Pillow 59.6/100: 60% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(5), best_friends_with_pip_static, wafting_devotion, elemental_potion_of_ultimate_power
5:53.282 aoe L starfall Fluffy_Pillow 85.8/100: 86% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:54.193 aoe R starfire Fluffy_Pillow 50.8/100: 51% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (tauren) Raid-Buffed Unbuffed Gear Amount
Strength 898 2 986 900 0
Agility 2089 -2 2173 2087 0
Stamina 3848 2 44833 42698 38825
Intellect 2089 -2 15807 14885 12090 (7538)
Spirit 0 0 0 0 0
Health 896660 896660 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 15807 14885 0
Crit 28.51% 22.30% 3114
Haste 24.78% 24.78% 4212
Versatility 6.30% 1.30% 267
Mana Regen 2560 2560 0
Attack Power 16439 15480 0
Mastery 30.74% 30.74% 8152
Armor 5324 5324 5324
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 489.00
Local Head Benevolent Embersage's Casque
ilevel: 489, stats: { 673 Armor, +3966 Sta, +704 Crit, +330 Haste, +938 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }, enchant: incandescent_essence
Local Neck Eye of the Rising Flame
ilevel: 489, stats: { +2231 Sta, +256 Haste, +1537 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Life-Bound Shoulderpads
ilevel: 486, stats: { 603 Armor, +2875 Sta, +383 Mastery, +383 Haste, +684 AgiInt }
item effects: { equip: Toxified }
Local Chest Benevolent Embersage's Robe
ilevel: 489, stats: { 897 Armor, +3966 Sta, +715 Crit, +318 Mastery, +938 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 489, stats: { 505 Armor, +2975 Sta, +535 Haste, +241 Mastery, +704 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 489, stats: { 785 Armor, +3966 Sta, +705 Haste, +328 Mastery, +938 AgiInt }, enchant: { +155 StrAgiInt, +41 Vers (lambent_armor_kit_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 486, stats: { 548 Armor, +2875 Sta, +274 Crit, +438 Haste, +684 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Thermal Bindings
ilevel: 489, stats: { 449 Armor, +2231 Sta, +191 Crit, +390 Mastery, +528 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Benevolent Embersage's Talons
ilevel: 489, stats: { 505 Armor, +2975 Sta, +226 Vers, +549 Mastery, +704 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 489, stats: { +2231 Sta, +512 Haste, +1281 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 489, stats: { +2231 Sta, +1230 Crit, +564 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 489, stats: { +892 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 489, stats: { +738 Mastery }
item effects: { use: Balefire Branch }
Local Back Drape of the Loyal Vassal
ilevel: 489, stats: { 359 Armor, +2231 Sta, +328 Haste, +253 Mastery, +528 StrAgiInt }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 489, weapon: { 606 - 781, 2.6 }, stats: { +469 Int, +2264 Int, +1983 Sta, +156 Haste, +361 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 489, stats: { +1439 Int, +1983 Sta, +174 Haste, +343 Mastery }

Profile

druid="hissing_rune_3"
source=default
spec=balance
level=70
race=tauren
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:hissing_rune_3

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=489,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=489,gem_id=192961/192961/192961
shoulders=lifebound_shoulderpads,id=193406,bonus_id=8836/1576/8797/8960,ilevel=486,crafted_stats=49/36
back=drape_of_the_loyal_vassal,id=158375,bonus_id=4795,ilevel=489
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=489,enchant_id=6625
wrists=thermal_bindings,id=134461,bonus_id=4795,ilevel=489,gem_id=192961
hands=benevolent_embersages_talons,id=207255,bonus_id=4795,ilevel=489
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=489,enchant_id=6830
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=486
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=489
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=489
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=489,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=489

# Gear Summary
# gear_ilvl=488.63
# gear_stamina=38825
# gear_intellect=12090
# gear_crit_rating=3114
# gear_haste_rating=4212
# gear_mastery_rating=8152
# gear_versatility_rating=267
# gear_armor=5324
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

howling_rune_3 : 939023 dps, 171513 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
939022.8 939022.8 467.6 / 0.050% 88164.6 / 9.4% 67388.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.9 14.1 Astral Power 0.00% 57.0 99.9% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
howling_rune_3 939023
Astral Smolder 141065 15.0% 393.2 0.82s 107297 0 Periodic 752.0 56093 0 56093 0.0% 83.6%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 393.16 0.00 752.03 752.03 309.80 0.0000 2.0000 42185251.51 42185251.51 0.00% 28047.70 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 752.03 566 954 56092.82 4650 282655 56172.12 48014 65355 42185252 42185252 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Fury of Elune 28598 3.0% 5.1 65.15s 1664093 1747937 Direct 777.9 6725 14407 10984 55.4%

Stats Details: Fury Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.13 777.89 0.00 0.00 0.00 0.9522 0.0000 8543914.28 8543914.28 0.00% 1747936.64 1747936.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 44.57% 346.70 198 501 6725.47 3258 21903 6732.37 5895 7873 2331567 2331567 0.00%
crit 55.43% 431.19 283 603 14407.33 6646 44683 14427.14 13018 16583 6212347 6212347 0.00%

Action Details: Fury Of Elune

  • id:202770
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:astral_power
  • energize_amount:3.0

Spelldata

  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r

Action Details: Fury Of Elune Tick

  • id:211545
  • school:astral
  • range:105.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.149000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:211545
  • name:Fury of Elune
  • school:astral
  • tooltip:
  • description:{$@spelldesc202770=Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r}

Action Priority List

    aoe
    [P]:5.13
  • if_expr:target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Hungering Shadowflame 3897 0.4% 17.3 16.78s 67556 0 Direct 17.3 51760 106469 67564 28.9%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.30 17.30 0.00 0.00 0.00 0.0000 0.0000 1168434.75 1168434.75 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.12% 12.30 2 25 51760.11 34936 202233 51534.43 34936 123008 636608 636608 0.00%
crit 28.88% 4.99 0 16 106469.16 71270 412555 105647.17 0 407878 531827 531827 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:31299.68
  • base_dd_max:31299.68
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 7200 0.8% 34.6 8.53s 62277 0 Direct 34.5 48097 98036 62436 28.7%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.62 34.53 0.00 0.00 0.00 0.0000 0.0000 2155879.41 2155879.41 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.28% 24.61 8 44 48096.77 47503 54996 48094.06 47503 50100 1183850 1183850 0.00%
crit 28.72% 9.91 1 23 98036.40 96907 112191 98036.81 96907 104549 972029 972029 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42559.30
  • base_dd_max:42559.30
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 77991 8.3% 3.0 1.07s 7781399 8576119 Direct 6.0 6975 14214 10523 49.0%
Periodic 1848.4 8699 17944 12595 42.1% 99.1%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.00 6.00 1848.44 1848.44 0.00 0.9077 0.9644 23344196.49 23344196.49 0.00% 13074.74 8576119.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 50.99% 3.06 0 6 6974.60 6880 8103 6861.77 0 8103 21337 21337 0.00%
crit 49.01% 2.94 0 6 14213.87 14034 16530 13987.60 0 16530 41799 41799 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 57.86% 1069.52 793 1349 8699.24 6630 13994 8699.31 8458 8990 9303989 9303989 0.00%
crit 42.14% 778.92 560 996 17944.34 13525 28549 17947.84 17461 18558 13977071 13977071 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    aoe
    [J]:3.00
  • if_expr:!fight_style.dungeonroute
  • target_if_expr:refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (81803) 0.0% (8.7%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 20227 2.2% 238.7 1.44s 25359 0 Direct 238.1 15933 34180 25424 52.0%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 238.70 238.08 0.00 0.00 0.00 0.0000 0.0000 6053109.46 6053109.46 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 47.98% 114.24 67 162 15932.56 10979 30135 15939.84 14842 17228 1820123 1820123 0.00%
crit 52.02% 123.84 78 176 34180.44 22398 61476 34211.22 32043 37457 4232987 4232987 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 20298 2.2% 240.2 1.45s 25284 0 Direct 239.6 15885 34076 25350 52.0%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 240.23 239.60 0.00 0.00 0.00 0.0000 0.0000 6073961.61 6073961.61 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 47.97% 114.94 68 174 15884.97 9912 30135 15891.88 14575 17145 1825771 1825771 0.00%
crit 52.03% 124.67 80 177 34076.22 20220 61476 34101.41 31833 37129 4248191 4248191 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 41278 4.4% 16.0 18.97s 774020 0 Direct 95.5 80980 174413 129390 51.8%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.96 95.46 0.00 0.00 0.00 0.0000 0.0000 12351077.98 12351077.98 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.18% 46.00 20 74 80979.93 40859 304293 81048.86 62427 105616 3724502 3724502 0.00%
crit 51.82% 49.46 23 83 174413.46 83352 610827 174577.90 132748 221075 8626576 8626576 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfall 312622 33.3% 106.1 2.81s 880806 883161 Direct 1767.5 34669 74657 52886 45.6%

Stats Details: Starfall

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 106.13 1767.54 0.00 0.00 0.00 0.9973 0.0000 93479007.33 93479007.33 0.00% 883160.51 883160.51
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.44% 962.29 688 1227 34668.96 7537 128122 34745.65 31038 38713 33362193 33362193 0.00%
crit 45.56% 805.24 591 1032 74656.62 15375 261369 74802.18 68670 82891 60116814 60116814 0.00%

Action Details: Starfall

  • id:191034
  • school:astral
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:45.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]

Action Details: Starfall Damage

  • id:191037
  • school:astral
  • range:200.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.114000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.41

Spelldata

  • id:191037
  • name:Starfall
  • school:astral
  • tooltip:
  • description:{$@spelldesc191034=Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]}

Action Priority List

    aoe
    [L]:71.67
  • if_expr:variable.starfall_condition1
    aoe
    [Q]:34.46
  • if_expr:variable.starfall_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountLunar Shrapnel4151691PCT0.200
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 208884 22.2% 119.6 2.47s 522436 379210 Direct 723.6 53556 115588 86349 52.9%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 119.60 723.60 0.00 0.00 0.00 1.3777 0.0000 62483509.61 62483509.61 0.00% 379209.64 379209.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 47.13% 341.07 234 449 53555.88 7433 243760 53575.20 47112 60800 18266137 18266137 0.00%
crit 52.87% 382.54 277 495 115588.48 15163 489526 115646.14 103980 131991 44217373 44217373 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    aoe
    [M]:1.08
  • if_expr:buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
    aoe
    [R]:119.05
  • if_expr:spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Solar)4851710.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Sunfire16481550.283Mastery
Sunfire 65469 7.0% 1.0 0.00s 19581118 21400129 Direct 1.0 5473 11162 7135 29.2%
Periodic 1861.4 7329 15628 10516 38.4% 99.8%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 1861.39 1861.39 0.00 0.9155 0.9641 19581118.24 19581118.24 0.00% 10905.61 21400129.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 70.76% 0.71 0 1 5473.17 5438 5510 3872.82 0 5510 3873 3873 0.00%
crit 29.24% 0.29 0 1 11161.53 11094 11240 3263.67 0 11240 3264 3264 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 61.60% 1146.71 846 1471 7329.42 5479 12722 7333.08 7099 7639 8404631 8404631 0.00%
crit 38.40% 714.69 536 932 15628.22 11178 25953 15638.04 15024 16395 11169351 11169351 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    aoe
    [I]:1.00
  • target_if_expr:refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (7170) 0.0% (0.8%) 8.5 31.45s 251361 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.54 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 3749 0.4% 8.5 31.45s 131432 0 Direct 51.2 16856 34359 21905 28.8%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.54 51.24 0.00 0.00 0.00 0.0000 0.0000 1122399.26 1122399.26 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.15% 36.46 8 93 16856.29 16647 19272 16855.36 16647 18157 614553 614553 0.00%
crit 28.85% 14.78 0 41 34358.64 33959 39316 34360.60 0 39018 507846 507846 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:51134.41
  • base_dd_max:51134.41
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 3421 0.4% 16.4 15.46s 62457 0 Direct 98.4 8020 16344 10409 28.7%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.40 98.39 0.00 0.00 0.00 0.0000 0.0000 1024158.28 1024158.28 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.29% 70.14 15 168 8019.67 7921 9170 8018.98 7921 8720 562532 562532 0.00%
crit 28.71% 28.24 5 70 16344.07 16159 18707 16346.04 16159 17737 461626 461626 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24330.91
  • base_dd_max:24330.91
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 4324 0.5% 26.4 10.30s 49240 64750 Direct 26.3 34868 71028 49534 40.6%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.44 26.28 0.00 0.00 0.00 0.7605 0.0000 1301801.10 1301801.10 0.00% 64750.12 64750.12
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.44% 15.62 5 26 34867.87 15081 65926 34787.25 25176 43307 544664 544664 0.00%
crit 40.56% 10.66 2 21 71027.99 30766 136031 70873.11 41072 94980 757138 757138 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    aoe
    [O]:24.52
  • if_expr:!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.800Spell Data
Eclipse (Solar)4851710.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Lunar)4851810.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
howling_rune_3
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:howling_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:howling_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:howling_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 180.85s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    aoe
    [N]:2.00
  • if_expr:variable.cd_condition_aoe

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.2 89.60s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.20 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:howling_rune_3
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:70932.17
  • base_dd_max:70932.17
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.43s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.73 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:howling_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.73
Elemental Potion of Ultimate Power 1.4 306.50s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.44 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.44
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 17.2 6.4 18.0s 13.3s 9.7s 55.31% 57.59% 6.4 (22.9) 16.6

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.8s
  • trigger_min/max:0.0s / 38.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.8s
  • uptime_min/max:50.57% / 58.27%

Stack Uptimes

  • balance_of_all_things_arcane_1:5.65%
  • balance_of_all_things_arcane_2:6.01%
  • balance_of_all_things_arcane_3:6.51%
  • balance_of_all_things_arcane_4:6.94%
  • balance_of_all_things_arcane_5:7.26%
  • balance_of_all_things_arcane_6:7.51%
  • balance_of_all_things_arcane_7:7.67%
  • balance_of_all_things_arcane_8:7.76%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 10.2 0.1 29.8s 29.4s 8.0s 27.44% 31.02% 0.1 (0.2) 10.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 48.0s
  • trigger_min/max:2.8s / 45.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:25.11% / 30.00%

Stack Uptimes

  • balance_of_all_things_nature_1:3.37%
  • balance_of_all_things_nature_2:3.40%
  • balance_of_all_things_nature_3:3.42%
  • balance_of_all_things_nature_4:3.43%
  • balance_of_all_things_nature_5:3.44%
  • balance_of_all_things_nature_6:3.45%
  • balance_of_all_things_nature_7:3.46%
  • balance_of_all_things_nature_8:3.47%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 15.2 87.8 20.2s 2.9s 17.4s 88.09% 0.00% 36.0 (36.0) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 60.5s
  • trigger_min/max:0.8s / 13.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:82.17% / 92.90%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:13.27%
  • balance_t31_4pc_buff_lunar_2:13.47%
  • balance_t31_4pc_buff_lunar_3:13.90%
  • balance_t31_4pc_buff_lunar_4:11.81%
  • balance_t31_4pc_buff_lunar_5:35.64%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 8.1 58.8 38.3s 4.3s 19.2s 52.48% 0.00% 28.1 (28.1) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 84.0s
  • trigger_min/max:0.8s / 39.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:47.08% / 59.42%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:7.23%
  • balance_t31_4pc_buff_solar_2:6.25%
  • balance_t31_4pc_buff_solar_3:6.08%
  • balance_t31_4pc_buff_solar_4:6.23%
  • balance_t31_4pc_buff_solar_5:26.69%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 69.9s 69.9s 10.8s 10.11% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 316.9s
  • trigger_min/max:12.0s / 316.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 34.50%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.90%
  • best_friends_with_aerwynn_2:0.91%
  • best_friends_with_aerwynn_3:0.91%
  • best_friends_with_aerwynn_4:0.91%
  • best_friends_with_aerwynn_5:0.92%
  • best_friends_with_aerwynn_6:0.92%
  • best_friends_with_aerwynn_7:0.92%
  • best_friends_with_aerwynn_8:0.93%
  • best_friends_with_aerwynn_9:0.93%
  • best_friends_with_aerwynn_10:0.93%
  • best_friends_with_aerwynn_11:0.93%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 112.7s 69.9s 45.1s 33.23% 0.00% 69.4 (69.4) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 348.4s
  • trigger_min/max:12.0s / 316.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 317.8s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.23%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.9 0.0 69.6s 69.6s 10.8s 10.29% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 336.2s
  • trigger_min/max:12.0s / 336.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 36.82%

Stack Uptimes

  • best_friends_with_pip_1:0.92%
  • best_friends_with_pip_2:0.92%
  • best_friends_with_pip_3:0.93%
  • best_friends_with_pip_4:0.93%
  • best_friends_with_pip_5:0.93%
  • best_friends_with_pip_6:0.94%
  • best_friends_with_pip_7:0.94%
  • best_friends_with_pip_8:0.94%
  • best_friends_with_pip_9:0.95%
  • best_friends_with_pip_10:0.95%
  • best_friends_with_pip_11:0.95%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 1.0 112.8s 69.6s 45.3s 33.74% 0.00% 70.0 (70.0) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:13.0s / 346.9s
  • trigger_min/max:12.0s / 336.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 332.6s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.74%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 69.6s 69.6s 10.8s 10.06% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 320.9s
  • trigger_min/max:12.0s / 320.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 37.40%

Stack Uptimes

  • best_friends_with_urctos_1:0.90%
  • best_friends_with_urctos_2:0.90%
  • best_friends_with_urctos_3:0.91%
  • best_friends_with_urctos_4:0.91%
  • best_friends_with_urctos_5:0.91%
  • best_friends_with_urctos_6:0.91%
  • best_friends_with_urctos_7:0.92%
  • best_friends_with_urctos_8:0.92%
  • best_friends_with_urctos_9:0.92%
  • best_friends_with_urctos_10:0.93%
  • best_friends_with_urctos_11:0.93%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 112.8s 69.6s 44.9s 33.03% 0.00% 69.1 (69.1) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 349.4s
  • trigger_min/max:12.0s / 320.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 316.2s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.03%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.53% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.53%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 61.6s 58.0s 50.1s 80.16% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 353.0s
  • trigger_min/max:15.0s / 283.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 356.1s
  • uptime_min/max:44.57% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.16%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dreamstate 15.4 0.0 20.2s 21.2s 2.1s 10.84% 20.42% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.6s / 55.4s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.4s
  • uptime_min/max:7.07% / 15.39%

Stack Uptimes

  • dreamstate_1:7.27%
  • dreamstate_2:3.57%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 13.3 8.0 23.6s 14.9s 21.0s 92.88% 93.63% 8.0 (8.0) 12.4

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.6s / 72.1s
  • trigger_min/max:0.0s / 58.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.0s
  • uptime_min/max:89.94% / 95.96%

Stack Uptimes

  • eclipse_lunar_1:92.88%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 8.1 0.0 38.4s 38.4s 19.5s 53.21% 55.20% 0.0 (0.0) 7.8

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 84.7s
  • trigger_min/max:12.0s / 84.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:47.94% / 59.91%

Stack Uptimes

  • eclipse_solar_1:53.21%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 306.0s 306.0s 27.3s 12.94% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 325.9s
  • trigger_min/max:300.0s / 325.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.76% / 17.87%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.94%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Fury of Elune 5.1 0.0 65.0s 65.0s 7.9s 13.56% 0.00% 76.0 (76.0) 5.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:60.0s / 88.1s
  • trigger_min/max:60.0s / 88.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:10.84% / 15.69%

Stack Uptimes

  • fury_of_elune_1:13.56%

Spelldata

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 8.1 0.0 38.4s 38.4s 19.5s 53.21% 55.90% 0.0 (0.0) 7.8

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 84.7s
  • trigger_min/max:12.0s / 84.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:47.94% / 59.91%

Stack Uptimes

  • incarnation_chosen_of_elune_1:53.21%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.7 0.0 91.6s 91.6s 19.5s 24.00% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:65.76

Trigger Details

  • interval_min/max:90.0s / 122.1s
  • trigger_min/max:90.0s / 122.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.16% / 26.96%

Stack Uptimes

  • kindled_soul_5:1.16%
  • kindled_soul_10:1.18%
  • kindled_soul_15:1.18%
  • kindled_soul_20:1.18%
  • kindled_soul_25:1.18%
  • kindled_soul_30:1.19%
  • kindled_soul_35:1.19%
  • kindled_soul_40:1.19%
  • kindled_soul_45:1.20%
  • kindled_soul_50:1.20%
  • kindled_soul_55:1.20%
  • kindled_soul_60:1.20%
  • kindled_soul_65:1.21%
  • kindled_soul_70:1.21%
  • kindled_soul_75:1.21%
  • kindled_soul_80:1.22%
  • kindled_soul_85:1.22%
  • kindled_soul_90:1.22%
  • kindled_soul_95:1.23%
  • kindled_soul_100:1.23%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Vigil 3.7 0.0 90.4s 90.4s 14.8s 18.40% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.5s
  • trigger_min/max:90.0s / 91.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.49% / 21.01%

Stack Uptimes

  • natures_vigil_1:18.40%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.6 0.0 68.8s 68.2s 0.9s 0.76% 1.17% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 323.5s
  • trigger_min/max:0.1s / 323.5s
  • trigger_pct:15.06%
  • duration_min/max:0.0s / 5.4s
  • uptime_min/max:0.00% / 5.07%

Stack Uptimes

  • owlkin_frenzy_1:0.76%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 9.3 97.8 33.6s 33.6s 29.5s 91.35% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:21.4s / 45.5s
  • trigger_min/max:21.4s / 45.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.0s
  • uptime_min/max:87.32% / 94.75%

Stack Uptimes

  • primordial_arcanic_pulsar_5:7.21%
  • primordial_arcanic_pulsar_10:6.65%
  • primordial_arcanic_pulsar_15:7.33%
  • primordial_arcanic_pulsar_20:8.48%
  • primordial_arcanic_pulsar_25:8.67%
  • primordial_arcanic_pulsar_30:8.55%
  • primordial_arcanic_pulsar_35:8.81%
  • primordial_arcanic_pulsar_40:8.87%
  • primordial_arcanic_pulsar_45:9.07%
  • primordial_arcanic_pulsar_50:8.91%
  • primordial_arcanic_pulsar_55:8.81%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 19.4 4.1 15.9s 13.3s 6.7s 43.65% 42.89% 4.1 (4.1) 18.9

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 42.8s
  • trigger_min/max:0.0s / 38.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.7s
  • uptime_min/max:39.92% / 46.40%

Stack Uptimes

  • solstice_1:43.65%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starfall 106.1 0.0 143.1s 2.8s 295.7s 98.91% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_starfall
  • max_stacks:20
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:asynchronous
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.8s / 357.4s
  • trigger_min/max:0.7s / 8.2s
  • trigger_pct:99.99%
  • duration_min/max:15.6s / 358.0s
  • uptime_min/max:98.37% / 99.50%

Stack Uptimes

  • starfall_1:5.00%
  • starfall_2:31.34%
  • starfall_3:42.19%
  • starfall_4:16.28%
  • starfall_5:3.65%
  • starfall_6:0.43%
  • starfall_7:0.00%

Spelldata

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]
  • max_stacks:20
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Starlord 21.1 85.1 14.4s 2.8s 13.9s 97.64% 0.00% 43.6 (43.6) 6.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 18.9s
  • trigger_min/max:0.8s / 8.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:95.10% / 99.34%

Stack Uptimes

  • starlord_1:12.30%
  • starlord_2:17.65%
  • starlord_3:67.69%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Umbral Embrace 23.4 2.7 12.5s 11.2s 1.6s 12.54% 0.00% 2.7 (2.7) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_umbral_embrace
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 52.3s
  • trigger_min/max:0.0s / 52.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.9s
  • uptime_min/max:4.05% / 25.30%

Stack Uptimes

  • umbral_embrace_1:12.54%

Spelldata

  • id:393763
  • name:Umbral Embrace
  • tooltip:Your next Wrath or Starfire cast during an Eclipse deals Astral damage and deals {$=}w1% additional damage.
  • description:{$@spelldesc393760=Dealing Astral damage has a chance to cause your next Wrath or Starfire cast during an Eclipse to become Astral and deal {$s1=25}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Wafting Devotion 4.3 1.2 61.0s 45.4s 16.5s 23.62% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 208.2s
  • trigger_min/max:0.0s / 205.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 72.2s
  • uptime_min/max:5.02% / 58.77%

Stack Uptimes

  • wafting_devotion_1:23.62%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Primordial Arcanic Pulsar 8.4 7.0 10.0 34.7s 21.9s 45.2s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.06% 0.00% 0.59% 0.0s 0.0s 1.0s
Astral Smolder 75.75% 66.28% 86.45% 4.4s 0.0s 48.0s
Incarnation (Total) 53.21% 47.94% 59.91% 19.5s 0.0s 54.0s
Incarnation (Pulsar) 32.91% 30.09% 35.49% 11.8s 0.0s 12.0s
Lunar Eclipse Only 39.67% 32.11% 45.29% 9.1s 0.0s 15.0s
No Eclipse 7.07% 4.04% 9.87% 1.7s 0.0s 4.6s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Fury of Elune5.1770.00028.14826.5855.53771.300

Eclipse Utilization

NoneSolarLunarBoth
Wrath24.44100.0%0.000.0%0.000.0%0.000.0%
Starfire3.052.5%0.000.0%49.3941.0%68.1656.5%
Starfall21.547.3%0.000.0%115.7939.1%158.5653.6%
Fury of Elune14.881.9%0.000.0%141.7418.2%621.2779.9%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
howling_rune_3
Fury of EluneAstral Power80.97242.445.74%2.990.470.19%
MoonfireAstral Power3.0018.000.43%6.000.000.00%
Orbit BreakerAstral Power15.96476.3511.29%29.852.340.49%
Shooting Stars (Moonfire)Astral Power238.69477.0511.30%2.000.340.07%
Shooting Stars (Sunfire)Astral Power240.22480.1011.37%2.000.330.07%
StarfireAstral Power120.602256.7853.46%18.7136.791.60%
SunfireAstral Power1.006.000.14%6.000.000.00%
WrathAstral Power26.44264.396.26%10.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
howling_rune_3
StarfallAstral Power 106.504182.56100.00%39.2739.4122349.69
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 896660.0 4291.85 4951.58 3512546.3 698994.9 -115402.4 896660.0
Astral Power 20.0 14.09 13.91 40.2 53.3 0.0 100.0

Statistics & Data Analysis

Fight Length
howling_rune_3 Fight Length
Count 9056
Mean 299.62
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 34.7760
5th Percentile 245.95
95th Percentile 353.98
( 95th Percentile - 5th Percentile ) 108.03
Mean Distribution
Standard Deviation 0.3654
95.00% Confidence Interval ( 298.90 - 300.34 )
Normalized 95.00% Confidence Interval ( 99.76% - 100.24% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 518
0.1% Error 51751
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1033
DPS
howling_rune_3 Damage Per Second
Count 9056
Mean 939022.82
Minimum 868368.64
Maximum 1039457.57
Spread ( max - min ) 171088.92
Range [ ( max - min ) / 2 * 100% ] 9.11%
Standard Deviation 22705.5067
5th Percentile 903788.72
95th Percentile 978059.39
( 95th Percentile - 5th Percentile ) 74270.67
Mean Distribution
Standard Deviation 238.5959
95.00% Confidence Interval ( 938555.18 - 939490.46 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2246
0.1 Scale Factor Error with Delta=300 4400947
0.05 Scale Factor Error with Delta=300 17603786
0.01 Scale Factor Error with Delta=300 440094627
Priority Target DPS
howling_rune_3 Priority Target Damage Per Second
Count 9056
Mean 171512.68
Minimum 154583.19
Maximum 194102.40
Spread ( max - min ) 39519.21
Range [ ( max - min ) / 2 * 100% ] 11.52%
Standard Deviation 5321.4595
5th Percentile 163070.76
95th Percentile 180599.71
( 95th Percentile - 5th Percentile ) 17528.95
Mean Distribution
Standard Deviation 55.9194
95.00% Confidence Interval ( 171403.08 - 171622.28 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3698
0.1 Scale Factor Error with Delta=300 241739
0.05 Scale Factor Error with Delta=300 966953
0.01 Scale Factor Error with Delta=300 24173815
DPS(e)
howling_rune_3 Damage Per Second (Effective)
Count 9056
Mean 939022.82
Minimum 868368.64
Maximum 1039457.57
Spread ( max - min ) 171088.92
Range [ ( max - min ) / 2 * 100% ] 9.11%
Damage
howling_rune_3 Damage
Count 9056
Mean 280867819.31
Minimum 218991118.03
Maximum 347116049.27
Spread ( max - min ) 128124931.24
Range [ ( max - min ) / 2 * 100% ] 22.81%
DTPS
howling_rune_3 Damage Taken Per Second
Count 9056
Mean 4950.72
Minimum 1222.37
Maximum 9592.29
Spread ( max - min ) 8369.91
Range [ ( max - min ) / 2 * 100% ] 84.53%
HPS
howling_rune_3 Healing Per Second
Count 9056
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
howling_rune_3 Healing Per Second (Effective)
Count 9056
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
howling_rune_3 Heal
Count 9056
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
howling_rune_3 Healing Taken Per Second
Count 9056
Mean 4282.55
Minimum 704.37
Maximum 9201.60
Spread ( max - min ) 8497.23
Range [ ( max - min ) / 2 * 100% ] 99.21%
TMI
howling_rune_3 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
howling_rune_3Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
howling_rune_3 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.44 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.68 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.73 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.aoe
# count action,conditions
0.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
0.00 variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
I 1.00 sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
J 3.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
0.00 variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
K 14.05 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
L 71.67 starfall,if=variable.starfall_condition1
M 1.08 starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
0.00 celestial_alignment,if=variable.cd_condition_aoe
N 2.00 incarnation,if=variable.cd_condition_aoe
0.00 warrior_of_elune
0.00 variable,name=enter_solar,value=spell_targets.starfire<3
0.00 starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
O 24.52 wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
0.00 wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
P 5.13 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
Q 34.46 starfall,if=variable.starfall_condition2
0.00 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+50
0.00 convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 new_moon,if=astral_power.deficit>variable.passive_asp+10
0.00 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
R 119.05 starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
0.00 wrath
S 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFIJLJJMLNDEPQRRLRLLRLRKLQRQRRRRLRLRLRRKLLQRRRLRLRRLRRKLQRQOORRLLRRKLQQRRROLOPRLKLRLQRRRLOORKLRQRFQRRLRLERKLQROOQRRRLRRKLRLQOORRLRRKLQPRLRLRLLROKLORQRQRRLRLRRLOOQRQRRLRRKLQQROORRLRFLRRLQNRERQPRRLRLRKLQQRRLRLRRLRKLQRQRRRRLRLROLORLQRRRLRLRKLOOLRLRLRRLRRLROLORLRLPRFLRKLRL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask howling_rune_3 0.0/100: 0% astral_power
Pre precombat 1 food howling_rune_3 0.0/100: 0% astral_power corrupting_rage
Pre precombat 2 augmentation howling_rune_3 0.0/100: 0% astral_power corrupting_rage
Pre precombat 4 no_cd_talent howling_rune_3 0.0/100: 0% astral_power corrupting_rage
Pre precombat 5 on_use_trinket howling_rune_3 0.0/100: 0% astral_power corrupting_rage
Pre precombat 6 on_use_trinket howling_rune_3 0.0/100: 0% astral_power corrupting_rage
Pre precombat 7 on_use_trinket howling_rune_3 0.0/100: 0% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 10.0/100: 10% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil howling_rune_3 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.000 aoe I sunfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.915 aoe J moonfire Fluffy_Pillow 47.2/100: 47% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:01.831 aoe L starfall Fluffy_Pillow 57.2/100: 57% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:02.746 aoe J moonfire enemy2 14.2/100: 14% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, dreamstate, corrupting_rage
0:03.626 aoe J moonfire enemy3 54.2/100: 54% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, dreamstate, corrupting_rage
0:04.506 aoe M starfire Fluffy_Pillow 68.2/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, corrupting_rage
0:05.299 aoe L starfall Fluffy_Pillow 93.4/100: 93% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, corrupting_rage
0:06.181 aoe N incarnation_chosen_of_elune Fluffy_Pillow 54.4/100: 54% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(10), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), corrupting_rage
0:06.181 default D potion Fluffy_Pillow 54.4/100: 54% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), corrupting_rage
0:06.181 default E use_items Fluffy_Pillow 54.4/100: 54% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power
0:06.181 aoe P fury_of_elune Fluffy_Pillow 54.4/100: 54% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:06.954 aoe Q starfall Fluffy_Pillow 63.4/100: 63% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), umbral_embrace, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:07.728 aoe R starfire Fluffy_Pillow 38.4/100: 38% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:08.484 aoe R starfire Fluffy_Pillow 66.6/100: 67% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:09.237 aoe L starfall Fluffy_Pillow 95.8/100: 96% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:09.990 aoe R starfire Fluffy_Pillow 69.8/100: 70% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:11.104 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
0:11.859 aoe L starfall Fluffy_Pillow 75.0/100: 75% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:12.614 aoe R starfire Fluffy_Pillow 75.0/100: 75% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(5), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
0:13.727 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:14.483 aoe R starfire Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:15.594 aoe K cancel_buff Fluffy_Pillow 91.2/100: 91% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:15.594 aoe L starfall Fluffy_Pillow 91.2/100: 91% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:16.427 aoe Q starfall Fluffy_Pillow 56.2/100: 56% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(5), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:17.228 aoe R starfire Fluffy_Pillow 23.2/100: 23% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(6), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:18.382 aoe Q starfall Fluffy_Pillow 42.4/100: 42% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(5), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:19.155 aoe R starfire Fluffy_Pillow 9.4/100: 9% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:20.268 aoe R starfire Fluffy_Pillow 30.6/100: 31% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:21.382 aoe R starfire Fluffy_Pillow 51.8/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:22.496 aoe R starfire Fluffy_Pillow 73.0/100: 73% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:23.608 aoe L starfall Fluffy_Pillow 96.2/100: 96% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn, best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:24.363 aoe R starfire Fluffy_Pillow 61.2/100: 61% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:25.477 aoe L starfall Fluffy_Pillow 84.4/100: 84% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:26.232 aoe R starfire Fluffy_Pillow 53.4/100: 53% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power
0:27.347 aoe L starfall Fluffy_Pillow 82.6/100: 83% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power
0:28.103 aoe R starfire Fluffy_Pillow 53.6/100: 54% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:29.138 aoe R starfire Fluffy_Pillow 78.8/100: 79% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(8), best_friends_with_pip_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:30.174 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(7), best_friends_with_pip_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:30.174 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(7), best_friends_with_pip_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:30.947 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord, umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(6), best_friends_with_pip_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:31.702 aoe Q starfall Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(2), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:32.459 aoe R starfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(5), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:33.493 aoe R starfire Fluffy_Pillow 49.2/100: 49% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:34.528 aoe R starfire Fluffy_Pillow 72.4/100: 72% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:35.565 aoe L starfall Fluffy_Pillow 93.6/100: 94% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip, best_friends_with_pip_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:36.321 aoe R starfire Fluffy_Pillow 60.6/100: 61% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:37.358 aoe L starfall Fluffy_Pillow 83.8/100: 84% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:38.114 aoe R starfire Fluffy_Pillow 50.8/100: 51% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(30), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:38.868 aoe R starfire Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:39.902 aoe L starfall Fluffy_Pillow 93.2/100: 93% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:40.657 aoe R starfire Fluffy_Pillow 60.2/100: 60% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:42.002 aoe R starfire Fluffy_Pillow 79.4/100: 79% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:43.347 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
0:43.347 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
0:44.429 aoe Q starfall Fluffy_Pillow 67.0/100: 67% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord, umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
0:45.469 aoe R starfire Fluffy_Pillow 32.0/100: 32% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(2), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
0:46.969 aoe Q starfall Fluffy_Pillow 51.2/100: 51% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
0:47.971 aoe O wrath Fluffy_Pillow 18.2/100: 18% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
0:48.938 aoe O wrath Fluffy_Pillow 30.2/100: 30% astral_power primordial_arcanic_pulsar(50), starfall(3), starlord(3), umbral_embrace, dreamstate, best_friends_with_pip_static, corrupting_rage
0:49.692 aoe R starfire Fluffy_Pillow 42.2/100: 42% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), umbral_embrace, best_friends_with_pip_static, corrupting_rage
0:50.646 aoe R starfire Fluffy_Pillow 69.4/100: 69% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), best_friends_with_pip_static, corrupting_rage
0:52.235 aoe L starfall Fluffy_Pillow 96.6/100: 97% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
0:53.295 aoe L starfall Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
0:54.357 aoe R starfire Fluffy_Pillow 46.6/100: 47% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
0:55.803 aoe R starfire Fluffy_Pillow 69.8/100: 70% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
0:57.249 aoe K cancel_buff Fluffy_Pillow 97.0/100: 97% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
0:57.249 aoe L starfall Fluffy_Pillow 97.0/100: 97% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
0:58.331 aoe Q starfall Fluffy_Pillow 66.0/100: 66% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
0:59.371 aoe Q starfall Fluffy_Pillow 37.0/100: 37% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(4), starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
1:00.372 aoe R starfire Fluffy_Pillow 4.0/100: 4% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
1:01.819 aoe R starfire Fluffy_Pillow 23.2/100: 23% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
1:03.266 aoe R starfire Fluffy_Pillow 46.4/100: 46% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
1:04.712 aoe O wrath Fluffy_Pillow 67.6/100: 68% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
1:05.679 aoe L starfall Fluffy_Pillow 79.6/100: 80% astral_power primordial_arcanic_pulsar(15), starfall(2), starlord(3), dreamstate(2), best_friends_with_pip_static, corrupting_rage
1:06.741 aoe O wrath Fluffy_Pillow 36.6/100: 37% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage
1:07.495 aoe P fury_of_elune Fluffy_Pillow 50.6/100: 51% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall, starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage
1:08.556 aoe R starfire Fluffy_Pillow 60.6/100: 61% astral_power balance_of_all_things_arcane(7), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall, starlord(3), best_friends_with_pip_static, corrupting_rage
1:09.510 aoe L starfall Fluffy_Pillow 91.8/100: 92% astral_power balance_of_all_things_arcane(6), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall, starlord(3), best_friends_with_pip_static, corrupting_rage
1:10.572 aoe K cancel_buff Fluffy_Pillow 56.8/100: 57% astral_power balance_of_all_things_arcane(5), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
1:10.572 aoe L starfall Fluffy_Pillow 56.8/100: 57% astral_power balance_of_all_things_arcane(5), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(2), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
1:11.760 aoe R starfire Fluffy_Pillow 21.8/100: 22% astral_power balance_of_all_things_arcane(4), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
1:13.474 aoe L starfall Fluffy_Pillow 86.0/100: 86% astral_power balance_of_all_things_arcane(2), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(3), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
1:14.618 aoe Q starfall Fluffy_Pillow 54.0/100: 54% astral_power balance_of_all_things_arcane, eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(35), starfall(3), starlord(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
1:15.720 aoe R starfire Fluffy_Pillow 17.0/100: 17% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(4), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
1:17.311 aoe R starfire Fluffy_Pillow 38.2/100: 38% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(4), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
1:18.902 aoe R starfire Fluffy_Pillow 57.4/100: 57% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
1:20.493 aoe L starfall Fluffy_Pillow 76.6/100: 77% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
1:21.554 aoe O wrath Fluffy_Pillow 35.6/100: 36% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
1:22.617 aoe O wrath Fluffy_Pillow 45.6/100: 46% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage
1:23.371 aoe R starfire Fluffy_Pillow 57.6/100: 58% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), best_friends_with_pip_static, corrupting_rage
1:24.326 aoe K cancel_buff Fluffy_Pillow 80.8/100: 81% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), best_friends_with_pip_static, corrupting_rage
1:24.326 aoe L starfall Fluffy_Pillow 80.8/100: 81% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, best_friends_with_pip_static, corrupting_rage
1:25.515 aoe R starfire Fluffy_Pillow 41.8/100: 42% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
1:27.227 aoe Q starfall Fluffy_Pillow 67.0/100: 67% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
1:28.372 aoe R starfire Fluffy_Pillow 28.0/100: 28% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
1:30.023 default F natures_vigil howling_rune_3 53.2/100: 53% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:30.023 aoe Q starfall Fluffy_Pillow 53.2/100: 53% astral_power natures_vigil, balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:31.047 aoe R starfire Fluffy_Pillow 12.2/100: 12% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:32.392 aoe R starfire Fluffy_Pillow 35.4/100: 35% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:33.739 aoe L starfall Fluffy_Pillow 92.6/100: 93% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:34.637 aoe R starfire Fluffy_Pillow 61.6/100: 62% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:35.985 aoe L starfall Fluffy_Pillow 84.8/100: 85% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, wafting_devotion
1:36.883 default E use_items Fluffy_Pillow 51.8/100: 52% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion
1:36.883 aoe R starfire Fluffy_Pillow 51.8/100: 52% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, kindled_soul(100)
1:38.230 aoe K cancel_buff Fluffy_Pillow 79.0/100: 79% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, kindled_soul(95)
1:38.230 aoe L starfall Fluffy_Pillow 79.0/100: 79% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, kindled_soul(95)
1:39.236 aoe Q starfall Fluffy_Pillow 44.0/100: 44% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, kindled_soul(90)
1:40.204 aoe R starfire Fluffy_Pillow 9.0/100: 9% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, kindled_soul(85)
1:41.600 aoe O wrath Fluffy_Pillow 30.2/100: 30% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(80)
1:42.531 aoe O wrath Fluffy_Pillow 40.2/100: 40% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(3), starlord(2), dreamstate, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(75)
1:43.286 aoe Q starfall Fluffy_Pillow 50.2/100: 50% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(2), dreamstate, best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(70)
1:44.311 aoe R starfire Fluffy_Pillow 11.2/100: 11% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, kindled_soul(65)
1:45.268 aoe R starfire Fluffy_Pillow 34.4/100: 34% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, kindled_soul(60)
1:46.860 aoe R starfire Fluffy_Pillow 61.6/100: 62% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, kindled_soul(55)
1:48.451 aoe L starfall Fluffy_Pillow 84.8/100: 85% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, kindled_soul(45)
1:49.512 aoe R starfire Fluffy_Pillow 45.8/100: 46% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, kindled_soul(40)
1:51.103 aoe R starfire Fluffy_Pillow 69.0/100: 69% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn, best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(30)
1:52.695 aoe K cancel_buff Fluffy_Pillow 88.2/100: 88% astral_power eclipse_lunar, primordial_arcanic_pulsar(30), starfall, starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(25)
1:52.695 aoe L starfall Fluffy_Pillow 88.2/100: 88% astral_power eclipse_lunar, primordial_arcanic_pulsar(30), starfall, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(25)
1:53.885 aoe R starfire Fluffy_Pillow 43.2/100: 43% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(15)
1:55.597 aoe L starfall Fluffy_Pillow 66.4/100: 66% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(10)
1:56.741 aoe Q starfall Fluffy_Pillow 53.4/100: 53% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(5)
1:57.843 aoe O wrath Fluffy_Pillow 10.4/100: 10% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
1:58.903 aoe O wrath Fluffy_Pillow 22.4/100: 22% astral_power primordial_arcanic_pulsar(45), starfall(3), starlord(3), dreamstate, best_friends_with_aerwynn_static, corrupting_rage
1:59.660 aoe R starfire Fluffy_Pillow 38.4/100: 38% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:00.616 aoe R starfire Fluffy_Pillow 57.6/100: 58% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:02.206 aoe L starfall Fluffy_Pillow 86.8/100: 87% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:03.269 aoe R starfire Fluffy_Pillow 45.8/100: 46% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, corrupting_rage
2:04.861 aoe R starfire Fluffy_Pillow 69.0/100: 69% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, corrupting_rage
2:06.452 aoe K cancel_buff Fluffy_Pillow 92.2/100: 92% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(50), starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, corrupting_rage
2:06.452 aoe L starfall Fluffy_Pillow 92.2/100: 92% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(50), starfall, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, corrupting_rage
2:07.640 aoe Q starfall Fluffy_Pillow 51.2/100: 51% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, corrupting_rage
2:08.782 aoe P fury_of_elune Fluffy_Pillow 14.2/100: 14% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:09.713 aoe R starfire Fluffy_Pillow 23.2/100: 23% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:11.108 aoe L starfall Fluffy_Pillow 91.4/100: 91% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:12.040 aoe R starfire Fluffy_Pillow 66.4/100: 66% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:13.386 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:14.286 aoe R starfire Fluffy_Pillow 73.0/100: 73% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:15.631 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:16.531 aoe L starfall Fluffy_Pillow 75.0/100: 75% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:17.429 aoe R starfire Fluffy_Pillow 45.0/100: 45% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:18.774 aoe O wrath Fluffy_Pillow 64.2/100: 64% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:19.672 aoe K cancel_buff Fluffy_Pillow 74.2/100: 74% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(3), dreamstate(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:19.672 aoe L starfall Fluffy_Pillow 74.2/100: 74% astral_power primordial_arcanic_pulsar(20), starfall(3), dreamstate(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:20.778 aoe O wrath Fluffy_Pillow 31.2/100: 31% astral_power primordial_arcanic_pulsar(25), starfall(4), starlord, dreamstate, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:21.532 aoe R starfire Fluffy_Pillow 43.2/100: 43% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:22.487 aoe Q starfall Fluffy_Pillow 66.4/100: 66% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:23.551 aoe R starfire Fluffy_Pillow 25.4/100: 25% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(4), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:25.085 aoe Q starfall Fluffy_Pillow 50.6/100: 51% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:26.108 aoe R starfire Fluffy_Pillow 11.6/100: 12% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:27.588 aoe R starfire Fluffy_Pillow 42.8/100: 43% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(10), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:29.066 aoe L starfall Fluffy_Pillow 64.0/100: 64% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(9), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:30.053 aoe R starfire Fluffy_Pillow 51.0/100: 51% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(8), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:31.533 aoe L starfall Fluffy_Pillow 76.2/100: 76% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(6), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:32.522 aoe R starfire Fluffy_Pillow 33.2/100: 33% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:34.000 aoe R starfire Fluffy_Pillow 54.4/100: 54% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:35.480 aoe L starfall Fluffy_Pillow 79.6/100: 80% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:36.586 aoe O wrath Fluffy_Pillow 38.6/100: 39% astral_power primordial_arcanic_pulsar(50), starfall(3), starlord, umbral_embrace, dreamstate, best_friends_with_pip, best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:37.341 aoe O wrath Fluffy_Pillow 48.6/100: 49% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord, umbral_embrace, best_friends_with_pip, best_friends_with_pip_static, corrupting_rage
2:38.094 aoe Q starfall Fluffy_Pillow 58.6/100: 59% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, umbral_embrace, best_friends_with_pip_static, corrupting_rage
2:39.237 aoe R starfire Fluffy_Pillow 19.6/100: 20% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage
2:40.887 aoe Q starfall Fluffy_Pillow 50.8/100: 51% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage
2:41.988 aoe R starfire Fluffy_Pillow 9.8/100: 10% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage
2:43.435 aoe R starfire Fluffy_Pillow 33.0/100: 33% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage
2:44.881 aoe L starfall Fluffy_Pillow 60.2/100: 60% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage
2:45.846 aoe R starfire Fluffy_Pillow 29.2/100: 29% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage
2:47.293 aoe R starfire Fluffy_Pillow 82.4/100: 82% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage
2:48.738 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage
2:48.738 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage
2:49.820 aoe Q starfall Fluffy_Pillow 67.0/100: 67% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord, umbral_embrace, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage
2:50.860 aoe Q starfall Fluffy_Pillow 36.0/100: 36% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(2), umbral_embrace, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
2:51.862 aoe R starfire Fluffy_Pillow 3.0/100: 3% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
2:53.308 aoe O wrath Fluffy_Pillow 15.0/100: 15% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(3), umbral_embrace, dreamstate, best_friends_with_urctos_static, corrupting_rage
2:54.064 aoe O wrath Fluffy_Pillow 25.0/100: 25% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(3), umbral_embrace, best_friends_with_urctos_static, corrupting_rage
2:54.818 aoe R starfire Fluffy_Pillow 39.0/100: 39% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), umbral_embrace, best_friends_with_urctos_static, corrupting_rage
2:56.410 aoe R starfire Fluffy_Pillow 70.2/100: 70% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), best_friends_with_pip(10), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:57.889 aoe L starfall Fluffy_Pillow 93.4/100: 93% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall, starlord(3), best_friends_with_pip(9), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:58.877 aoe R starfire Fluffy_Pillow 52.4/100: 52% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip(8), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:00.357 default F natures_vigil howling_rune_3 81.6/100: 82% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip(6), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:00.357 aoe L starfall Fluffy_Pillow 81.6/100: 82% astral_power natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip(6), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:01.346 aoe R starfire Fluffy_Pillow 38.6/100: 39% astral_power natures_vigil, balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:02.825 aoe R starfire Fluffy_Pillow 59.8/100: 60% astral_power natures_vigil, eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:04.304 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:05.408 aoe Q starfall Fluffy_Pillow 57.0/100: 57% astral_power natures_vigil, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord, balance_t31_4pc_buff_lunar(3), best_friends_with_pip, best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:06.471 aoe N incarnation_chosen_of_elune Fluffy_Pillow 14.0/100: 14% astral_power natures_vigil, eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:06.471 aoe R starfire Fluffy_Pillow 14.0/100: 14% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starfall(3), starlord(2), dreamstate, best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:07.308 default E use_items Fluffy_Pillow 33.2/100: 33% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starfall(3), starlord(2), dreamstate, best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:07.308 aoe R starfire Fluffy_Pillow 33.2/100: 33% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starfall(3), starlord(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(100)
3:08.148 aoe Q starfall Fluffy_Pillow 56.4/100: 56% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starfall(3), starlord(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(100)
3:09.080 aoe P fury_of_elune Fluffy_Pillow 25.4/100: 25% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(95)
3:09.977 aoe R starfire Fluffy_Pillow 34.4/100: 34% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(90)
3:11.322 aoe R starfire Fluffy_Pillow 70.6/100: 71% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(80)
3:12.667 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage, kindled_soul(75)
3:13.632 aoe R starfire Fluffy_Pillow 75.0/100: 75% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(2), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(70)
3:15.080 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(65)
3:16.046 aoe R starfire Fluffy_Pillow 68.0/100: 68% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(60)
3:17.493 aoe K cancel_buff Fluffy_Pillow 98.2/100: 98% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(50)
3:17.493 aoe L starfall Fluffy_Pillow 98.2/100: 98% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(50)
3:18.575 aoe Q starfall Fluffy_Pillow 67.2/100: 67% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(45)
3:19.616 aoe Q starfall Fluffy_Pillow 38.2/100: 38% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(40)
3:20.620 aoe R starfire Fluffy_Pillow 7.2/100: 7% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(35)
3:22.066 aoe R starfire Fluffy_Pillow 68.4/100: 68% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(30)
3:23.514 aoe L starfall Fluffy_Pillow 93.6/100: 94% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(20)
3:24.480 aoe R starfire Fluffy_Pillow 60.6/100: 61% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(15)
3:25.927 aoe L starfall Fluffy_Pillow 83.8/100: 84% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn, best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(10)
3:26.892 aoe R starfire Fluffy_Pillow 52.8/100: 53% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(5)
3:28.338 aoe R starfire Fluffy_Pillow 74.0/100: 74% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:29.784 aoe L starfall Fluffy_Pillow 99.2/100: 99% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:30.749 aoe R starfire Fluffy_Pillow 66.2/100: 66% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static
3:32.195 aoe K cancel_buff Fluffy_Pillow 85.4/100: 85% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static
3:32.195 aoe L starfall Fluffy_Pillow 85.4/100: 85% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static
3:33.275 aoe Q starfall Fluffy_Pillow 52.4/100: 52% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static
3:34.314 aoe R starfire Fluffy_Pillow 19.4/100: 19% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static
3:35.813 aoe Q starfall Fluffy_Pillow 38.6/100: 39% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static
3:36.814 aoe R starfire Fluffy_Pillow 5.6/100: 6% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static
3:38.261 aoe R starfire Fluffy_Pillow 24.8/100: 25% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static
3:39.707 aoe R starfire Fluffy_Pillow 46.0/100: 46% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static
3:41.153 aoe R starfire Fluffy_Pillow 69.2/100: 69% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static
3:42.599 aoe L starfall Fluffy_Pillow 88.4/100: 88% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static
3:43.565 aoe R starfire Fluffy_Pillow 55.4/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static
3:45.011 aoe L starfall Fluffy_Pillow 78.6/100: 79% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:45.977 aoe R starfire Fluffy_Pillow 43.6/100: 44% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:47.425 aoe O wrath Fluffy_Pillow 66.8/100: 67% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:48.504 aoe L starfall Fluffy_Pillow 76.8/100: 77% astral_power primordial_arcanic_pulsar(50), starfall(2), dreamstate(2), best_friends_with_aerwynn_static, corrupting_rage
3:49.692 aoe O wrath Fluffy_Pillow 31.8/100: 32% astral_power primordial_arcanic_pulsar(55), starfall(3), starlord, dreamstate, best_friends_with_aerwynn_static, corrupting_rage
3:50.446 aoe R starfire Fluffy_Pillow 41.8/100: 42% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord, best_friends_with_aerwynn_static, corrupting_rage
3:51.475 aoe L starfall Fluffy_Pillow 97.0/100: 97% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord, best_friends_with_aerwynn_static, corrupting_rage
3:52.620 aoe Q starfall Fluffy_Pillow 58.0/100: 58% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, corrupting_rage
3:53.623 aoe R starfire Fluffy_Pillow 27.0/100: 27% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, corrupting_rage
3:55.069 aoe R starfire Fluffy_Pillow 50.2/100: 50% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, corrupting_rage
3:56.515 aoe R starfire Fluffy_Pillow 77.4/100: 77% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, corrupting_rage
3:57.963 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage
3:58.929 aoe R starfire Fluffy_Pillow 67.0/100: 67% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage
4:00.376 aoe L starfall Fluffy_Pillow 90.2/100: 90% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(8), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:01.273 aoe R starfire Fluffy_Pillow 57.2/100: 57% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(7), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:02.618 aoe K cancel_buff Fluffy_Pillow 80.4/100: 80% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(6), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:02.618 aoe L starfall Fluffy_Pillow 80.4/100: 80% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(6), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:03.622 aoe O wrath Fluffy_Pillow 49.4/100: 49% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord, dreamstate, best_friends_with_pip(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:04.376 aoe O wrath Fluffy_Pillow 61.4/100: 61% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord, best_friends_with_pip(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:05.130 aoe L starfall Fluffy_Pillow 75.4/100: 75% astral_power balance_of_all_things_arcane(8), eclipse_lunar, owlkin_frenzy, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord, best_friends_with_pip(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:06.192 aoe R starfire Fluffy_Pillow 34.4/100: 34% astral_power balance_of_all_things_arcane(7), eclipse_lunar, owlkin_frenzy, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_pip(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:07.216 aoe L starfall Fluffy_Pillow 89.6/100: 90% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(2), umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_pip, best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:08.238 aoe R starfire Fluffy_Pillow 48.6/100: 49% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:09.718 aoe L starfall Fluffy_Pillow 73.8/100: 74% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:10.705 aoe R starfire Fluffy_Pillow 32.8/100: 33% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:12.184 aoe R starfire Fluffy_Pillow 60.0/100: 60% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:13.664 aoe L starfall Fluffy_Pillow 83.2/100: 83% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:14.651 aoe R starfire Fluffy_Pillow 40.2/100: 40% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:16.129 aoe R starfire Fluffy_Pillow 65.4/100: 65% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
4:17.720 aoe L starfall Fluffy_Pillow 84.6/100: 85% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:18.827 aoe R starfire Fluffy_Pillow 43.6/100: 44% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord, balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:20.421 aoe O wrath Fluffy_Pillow 61.6/100: 62% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord, dreamstate, best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:21.176 aoe L starfall Fluffy_Pillow 75.6/100: 76% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord, dreamstate, best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:22.238 aoe O wrath Fluffy_Pillow 32.6/100: 33% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:22.991 aoe R starfire Fluffy_Pillow 42.6/100: 43% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:24.524 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:25.548 aoe R starfire Fluffy_Pillow 63.0/100: 63% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:27.027 aoe L starfall Fluffy_Pillow 86.2/100: 86% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:28.014 aoe P fury_of_elune Fluffy_Pillow 51.2/100: 51% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:28.913 aoe R starfire Fluffy_Pillow 58.2/100: 58% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:30.259 default F natures_vigil howling_rune_3 90.4/100: 90% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:30.357 aoe L starfall Fluffy_Pillow 90.4/100: 90% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:31.255 aoe R starfire Fluffy_Pillow 67.4/100: 67% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:32.603 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:32.603 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:33.608 aoe R starfire Fluffy_Pillow 73.0/100: 73% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(3), starlord, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:35.058 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(3), starlord, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage

Stats

Level Bonus (70) Race Bonus (tauren) Raid-Buffed Unbuffed Gear Amount
Strength 898 2 986 900 0
Agility 2089 -2 2173 2087 0
Stamina 3848 2 44833 42698 38825
Intellect 2089 -2 15807 14885 12090 (7538)
Spirit 0 0 0 0 0
Health 896660 853960 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 15807 14885 0
Crit 28.51% 22.30% 3114
Haste 26.60% 26.60% 4522
Versatility 6.30% 1.30% 267
Mana Regen 2560 2560 0
Attack Power 16439 15480 0
Mastery 29.91% 29.91% 7842
Armor 5324 5324 5324
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 489.00
Local Head Benevolent Embersage's Casque
ilevel: 489, stats: { 673 Armor, +3966 Sta, +704 Crit, +330 Haste, +938 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }, enchant: incandescent_essence
Local Neck Eye of the Rising Flame
ilevel: 489, stats: { +2231 Sta, +256 Haste, +1537 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Life-Bound Shoulderpads
ilevel: 486, stats: { 603 Armor, +2875 Sta, +383 Mastery, +383 Haste, +684 AgiInt }
item effects: { equip: Toxified }
Local Chest Benevolent Embersage's Robe
ilevel: 489, stats: { 897 Armor, +3966 Sta, +715 Crit, +318 Mastery, +938 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 489, stats: { 505 Armor, +2975 Sta, +535 Haste, +241 Mastery, +704 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 489, stats: { 785 Armor, +3966 Sta, +705 Haste, +328 Mastery, +938 AgiInt }, enchant: { +155 StrAgiInt, +41 Vers (lambent_armor_kit_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 486, stats: { 548 Armor, +2875 Sta, +274 Crit, +438 Haste, +684 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Thermal Bindings
ilevel: 489, stats: { 449 Armor, +2231 Sta, +191 Crit, +390 Mastery, +528 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Benevolent Embersage's Talons
ilevel: 489, stats: { 505 Armor, +2975 Sta, +226 Vers, +549 Mastery, +704 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 489, stats: { +2231 Sta, +512 Haste, +1281 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 489, stats: { +2231 Sta, +1230 Crit, +564 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 489, stats: { +892 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 489, stats: { +738 Mastery }
item effects: { use: Balefire Branch }
Local Back Drape of the Loyal Vassal
ilevel: 489, stats: { 359 Armor, +2231 Sta, +328 Haste, +253 Mastery, +528 StrAgiInt }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 489, weapon: { 606 - 781, 2.6 }, stats: { +469 Int, +2264 Int, +1983 Sta, +156 Haste, +361 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Howling Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 489, stats: { +1439 Int, +1983 Sta, +174 Haste, +343 Mastery }

Profile

druid="howling_rune_3"
source=default
spec=balance
level=70
race=tauren
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:howling_rune_3

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=489,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=489,gem_id=192961/192961/192961
shoulders=lifebound_shoulderpads,id=193406,bonus_id=8836/1576/8797/8960,ilevel=486,crafted_stats=49/36
back=drape_of_the_loyal_vassal,id=158375,bonus_id=4795,ilevel=489
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=489,enchant_id=6625
wrists=thermal_bindings,id=134461,bonus_id=4795,ilevel=489,gem_id=192961
hands=benevolent_embersages_talons,id=207255,bonus_id=4795,ilevel=489
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=489,enchant_id=6830
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=486
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=489
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=489
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=489,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=489

# Gear Summary
# gear_ilvl=488.63
# gear_stamina=38825
# gear_intellect=12090
# gear_crit_rating=3114
# gear_haste_rating=4522
# gear_mastery_rating=7842
# gear_versatility_rating=267
# gear_armor=5324
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

Simulation & Raid Information

Iterations: 9088
Threads: 32
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 299.8 )

Performance:

Total Events Processed: 578601334
Max Event Queue: 107
Sim Seconds: 2724831
CPU Seconds: 508.9511
Physical Seconds: 19.3762
Speed Up: 5354

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Base Base astral_smolder ticks -394061 41856851 139523 149.39 56037 0 387.5 746.9 0.0% 0.0% 0.0% 0.0% 0.83sec 41856851 299.49sec
Base Base augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.49sec
Base Base flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.49sec
Base Base food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.49sec
Base Base fury_of_elune 202770 8329573 27812 153.01 6773 14444 5.1 763.7 53.9% 0.0% 0.0% 0.0% 64.88sec 8329573 299.49sec
Base Base hungering_shadowflame 424324 1149740 3839 3.42 51898 106100 17.1 17.1 28.6% 0.0% 0.0% 0.0% 17.00sec 1149740 299.49sec
Base Base hungering_shadowflame_self 424324 674799 2253 3.42 30445 62081 17.1 17.1 28.7% 0.0% 0.0% 0.0% 17.00sec 746572 299.49sec
Base Base incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.88sec 0 299.49sec
Base Base launched_thorns 379403 2121496 7084 6.81 48090 98036 34.1 34.0 28.7% 0.0% 0.0% 0.0% 8.60sec 2121496 299.49sec
Base Base launched_thorns_heal 379407 0 0 0.00 0 0 0.2 0.0 0.0% 0.0% 0.0% 0.0% 64.69sec 0 299.49sec
Base Base moonfire 8921 63563 212 1.20 6969 14200 3.0 6.0 50.1% 0.0% 0.0% 0.0% 1.07sec 22997088 299.49sec
Base Base moonfire ticks -8921 22933525 76445 364.03 8703 17956 3.0 1820.2 42.1% 0.0% 0.0% 0.0% 1.07sec 22997088 299.49sec
Base Base moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.49sec
Base Base natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.38sec 0 299.49sec
Base Base overwhelming_rage ticks -374037 800940 2670 3.95 40536 0 4.1 19.8 0.0% 0.0% 0.0% 0.0% 57.92sec 885853 299.49sec
Base Base potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 305.47sec 0 299.49sec
Base Base shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.49sec
Base Base shooting_stars_moonfire 202497 5963978 19914 47.13 15897 34128 235.8 235.2 51.9% 0.0% 0.0% 0.0% 1.47sec 5963978 299.49sec
Base Base shooting_stars_sunfire 202497 5988563 19996 47.46 15849 34017 237.5 236.9 51.9% 0.0% 0.0% 0.0% 1.46sec 5988563 299.49sec
Base Base orbit_breaker 274283 12171361 40640 18.91 80844 174081 15.8 94.4 51.6% 0.0% 0.0% 0.0% 19.19sec 12171361 299.49sec
Base Base starfall 191034 92176564 307778 353.87 34183 73714 104.7 1766.4 45.5% 0.0% 0.0% 0.0% 2.84sec 92176564 299.49sec
Base Base starfire 194153 62061078 207222 142.73 54011 116593 117.7 712.5 52.9% 0.0% 0.0% 0.0% 2.51sec 62061078 299.49sec
Base Base sunfire 93402 7053 24 0.20 5472 11161 1.0 1.0 27.8% 0.0% 0.0% 0.0% 0.00sec 19258026 299.49sec
Base Base sunfire ticks -93402 19250973 64170 366.61 7322 15623 1.0 1833.1 38.3% 0.0% 0.0% 0.0% 0.00sec 19258026 299.49sec
Base Base tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.4 0.0 0.0% 0.0% 0.0% 0.0% 31.96sec 0 299.49sec
Base Base denizen_of_the_flame 426486 1102795 3682 10.10 16858 34363 8.4 50.4 28.7% 0.0% 0.0% 0.0% 31.96sec 1102795 299.49sec
Base Base denizen_of_the_flame_secondary 426431 1008871 3369 19.40 8021 16349 16.1 96.8 28.8% 0.0% 0.0% 0.0% 15.69sec 1008871 299.49sec
Base Base wrath 190984 1281700 4280 5.27 34206 69928 26.4 26.3 40.7% 0.0% 0.0% 0.0% 10.32sec 1281700 299.49sec
buzzing_rune_3 buzzing_rune_3 astral_smolder ticks -394061 43326009 144420 152.34 56878 0 401.4 761.7 0.0% 0.0% 0.0% 0.0% 0.81sec 43326009 300.52sec
buzzing_rune_3 buzzing_rune_3 augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.52sec
buzzing_rune_3 buzzing_rune_3 flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.52sec
buzzing_rune_3 buzzing_rune_3 food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.52sec
buzzing_rune_3 buzzing_rune_3 fury_of_elune 202770 8454091 28132 152.91 6773 14435 5.1 765.9 55.7% 0.0% 0.0% 0.0% 65.03sec 8454091 300.52sec
buzzing_rune_3 buzzing_rune_3 hungering_shadowflame 424324 1174170 3907 3.41 52081 106331 17.1 17.1 30.6% 0.0% 0.0% 0.0% 16.84sec 1174170 300.52sec
buzzing_rune_3 buzzing_rune_3 hungering_shadowflame_self 424324 685271 2280 3.41 30448 62093 17.1 17.1 30.5% 0.0% 0.0% 0.0% 16.84sec 758316 300.52sec
buzzing_rune_3 buzzing_rune_3 incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.89sec 0 300.52sec
buzzing_rune_3 buzzing_rune_3 launched_thorns 379403 2169954 7221 6.84 48099 98059 34.4 34.3 30.5% 0.0% 0.0% 0.0% 8.63sec 2169954 300.52sec
buzzing_rune_3 buzzing_rune_3 launched_thorns_heal 379407 0 0 0.00 0 0 0.2 0.0 0.0% 0.0% 0.0% 0.0% 59.26sec 0 300.52sec
buzzing_rune_3 buzzing_rune_3 moonfire 8921 64164 214 1.20 6977 14215 3.0 6.0 51.4% 0.0% 0.0% 0.0% 1.07sec 23361240 300.52sec
buzzing_rune_3 buzzing_rune_3 moonfire ticks -8921 23297076 77657 365.27 8701 17954 3.0 1826.4 43.8% 0.0% 0.0% 0.0% 1.07sec 23361240 300.52sec
buzzing_rune_3 buzzing_rune_3 moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.52sec
buzzing_rune_3 buzzing_rune_3 natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.42sec 0 300.52sec
buzzing_rune_3 buzzing_rune_3 overwhelming_rage ticks -374037 796191 2654 3.93 40538 0 4.1 19.6 0.0% 0.0% 0.0% 0.0% 60.20sec 880550 300.52sec
buzzing_rune_3 buzzing_rune_3 potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.22sec 0 300.52sec
buzzing_rune_3 buzzing_rune_3 shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.52sec
buzzing_rune_3 buzzing_rune_3 shooting_stars_moonfire 202497 6055530 20150 47.13 15882 34094 236.7 236.1 53.7% 0.0% 0.0% 0.0% 1.47sec 6055530 300.52sec
buzzing_rune_3 buzzing_rune_3 shooting_stars_sunfire 202497 6076945 20221 47.46 15836 33988 238.3 237.7 53.6% 0.0% 0.0% 0.0% 1.46sec 6076945 300.52sec
buzzing_rune_3 buzzing_rune_3 orbit_breaker 274283 12364687 41144 18.92 80730 173946 15.8 94.7 53.4% 0.0% 0.0% 0.0% 19.17sec 12364687 300.52sec
buzzing_rune_3 buzzing_rune_3 starfall 191034 93610062 311495 353.90 34139 73642 105.1 1772.5 47.3% 0.0% 0.0% 0.0% 2.84sec 93610062 300.52sec
buzzing_rune_3 buzzing_rune_3 starfire 194153 62976589 209559 142.71 53956 116499 118.1 714.8 54.6% 0.0% 0.0% 0.0% 2.50sec 62976589 300.52sec
buzzing_rune_3 buzzing_rune_3 sunfire 93402 7278 24 0.20 5473 11164 1.0 1.0 31.7% 0.0% 0.0% 0.0% 0.00sec 19566812 300.52sec
buzzing_rune_3 buzzing_rune_3 sunfire ticks -93402 19559535 65198 367.86 7316 15605 1.0 1839.3 40.0% 0.0% 0.0% 0.0% 0.00sec 19566812 300.52sec
buzzing_rune_3 buzzing_rune_3 tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.5 0.0 0.0% 0.0% 0.0% 0.0% 32.30sec 0 300.52sec
buzzing_rune_3 buzzing_rune_3 denizen_of_the_flame 426486 1126626 3749 10.14 16860 34365 8.5 50.8 30.5% 0.0% 0.0% 0.0% 32.30sec 1126626 300.52sec
buzzing_rune_3 buzzing_rune_3 denizen_of_the_flame_secondary 426431 1028858 3424 19.46 8021 16349 16.2 97.5 30.4% 0.0% 0.0% 0.0% 15.76sec 1028858 300.52sec
buzzing_rune_3 buzzing_rune_3 wrath 190984 1302286 4333 5.27 34202 69773 26.6 26.4 42.5% 0.0% 0.0% 0.0% 10.33sec 1302286 300.52sec
hissing_rune_3 hissing_rune_3 astral_smolder ticks -394061 42313918 141046 149.58 56577 0 387.9 747.9 0.0% 0.0% 0.0% 0.0% 0.84sec 42313918 299.70sec
hissing_rune_3 hissing_rune_3 augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.70sec
hissing_rune_3 hissing_rune_3 flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.70sec
hissing_rune_3 hissing_rune_3 food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.70sec
hissing_rune_3 hissing_rune_3 fury_of_elune 202770 8484419 28310 152.83 6905 14721 5.1 763.4 53.9% 0.0% 0.0% 0.0% 65.18sec 8484419 299.70sec
hissing_rune_3 hissing_rune_3 hungering_shadowflame 424324 1149176 3834 3.41 51914 105977 17.0 17.0 28.7% 0.0% 0.0% 0.0% 16.87sec 1149176 299.70sec
hissing_rune_3 hissing_rune_3 hungering_shadowflame_self 424324 674352 2250 3.41 30446 62090 17.0 17.0 28.8% 0.0% 0.0% 0.0% 16.87sec 746191 299.70sec
hissing_rune_3 hissing_rune_3 incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.90sec 0 299.70sec
hissing_rune_3 hissing_rune_3 launched_thorns 379403 2131701 7113 6.83 48096 98050 34.2 34.1 28.8% 0.0% 0.0% 0.0% 8.69sec 2131701 299.70sec
hissing_rune_3 hissing_rune_3 launched_thorns_heal 379407 0 0 0.00 0 0 0.2 0.0 0.0% 0.0% 0.0% 0.0% 95.42sec 0 299.70sec
hissing_rune_3 hissing_rune_3 moonfire 8921 63722 213 1.20 7015 14295 3.0 6.0 49.5% 0.0% 0.0% 0.0% 1.06sec 23231892 299.70sec
hissing_rune_3 hissing_rune_3 moonfire ticks -8921 23168170 77227 364.31 8784 18129 3.0 1821.5 42.1% 0.0% 0.0% 0.0% 1.06sec 23231892 299.70sec
hissing_rune_3 hissing_rune_3 moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.70sec
hissing_rune_3 hissing_rune_3 natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.40sec 0 299.70sec
hissing_rune_3 hissing_rune_3 overwhelming_rage ticks -374037 798448 2661 3.94 40531 0 4.1 19.7 0.0% 0.0% 0.0% 0.0% 60.31sec 883196 299.70sec
hissing_rune_3 hissing_rune_3 potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 305.70sec 0 299.70sec
hissing_rune_3 hissing_rune_3 shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.70sec
hissing_rune_3 hissing_rune_3 shooting_stars_moonfire 202497 6081429 20292 47.10 16198 34775 235.9 235.3 51.9% 0.0% 0.0% 0.0% 1.46sec 6081429 299.70sec
hissing_rune_3 hissing_rune_3 shooting_stars_sunfire 202497 6105694 20373 47.45 16148 34661 237.6 237.0 51.9% 0.0% 0.0% 0.0% 1.46sec 6105694 299.70sec
hissing_rune_3 hissing_rune_3 orbit_breaker 274283 12421359 41446 18.90 82463 177356 15.8 94.4 51.8% 0.0% 0.0% 0.0% 19.14sec 12421359 299.70sec
hissing_rune_3 hissing_rune_3 starfall 191034 93966136 313538 353.86 34819 75111 104.8 1767.5 45.5% 0.0% 0.0% 0.0% 2.84sec 93966136 299.70sec
hissing_rune_3 hissing_rune_3 starfire 194153 62720256 209279 142.73 54553 117728 117.8 712.9 52.9% 0.0% 0.0% 0.0% 2.51sec 62720256 299.70sec
hissing_rune_3 hissing_rune_3 sunfire 93402 7139 24 0.20 5507 11234 1.0 1.0 28.5% 0.0% 0.0% 0.0% 0.00sec 19455889 299.70sec
hissing_rune_3 hissing_rune_3 sunfire ticks -93402 19448750 64829 366.88 7390 15773 1.0 1834.4 38.3% 0.0% 0.0% 0.0% 0.00sec 19455889 299.70sec
hissing_rune_3 hissing_rune_3 tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.4 0.0 0.0% 0.0% 0.0% 0.0% 32.60sec 0 299.70sec
hissing_rune_3 hissing_rune_3 denizen_of_the_flame 426486 1105288 3688 10.11 16858 34361 8.4 50.5 28.8% 0.0% 0.0% 0.0% 32.60sec 1105288 299.70sec
hissing_rune_3 hissing_rune_3 denizen_of_the_flame_secondary 426431 1010182 3371 19.42 8021 16349 16.2 97.0 28.7% 0.0% 0.0% 0.0% 15.83sec 1010182 299.70sec
hissing_rune_3 hissing_rune_3 wrath 190984 1295714 4323 5.27 34551 70523 26.5 26.3 40.8% 0.0% 0.0% 0.0% 10.34sec 1295714 299.70sec
howling_rune_3 howling_rune_3 astral_smolder ticks -394061 42185252 140618 150.41 56093 0 393.2 752.0 0.0% 0.0% 0.0% 0.0% 0.82sec 42185252 299.62sec
howling_rune_3 howling_rune_3 augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.62sec
howling_rune_3 howling_rune_3 flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.62sec
howling_rune_3 howling_rune_3 food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.62sec
howling_rune_3 howling_rune_3 fury_of_elune 202770 8543914 28516 155.78 6725 14407 5.1 777.9 55.4% 0.0% 0.0% 0.0% 65.15sec 8543914 299.62sec
howling_rune_3 howling_rune_3 hungering_shadowflame 424324 1168435 3900 3.46 51760 106469 17.3 17.3 28.9% 0.0% 0.0% 0.0% 16.78sec 1168435 299.62sec
howling_rune_3 howling_rune_3 hungering_shadowflame_self 424324 683821 2282 3.46 30446 62089 17.3 17.3 28.7% 0.0% 0.0% 0.0% 16.78sec 756649 299.62sec
howling_rune_3 howling_rune_3 incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.85sec 0 299.62sec
howling_rune_3 howling_rune_3 launched_thorns 379403 2155879 7195 6.91 48097 98036 34.6 34.5 28.7% 0.0% 0.0% 0.0% 8.53sec 2155879 299.62sec
howling_rune_3 howling_rune_3 launched_thorns_heal 379407 0 0 0.00 0 0 0.2 0.0 0.0% 0.0% 0.0% 0.0% 89.60sec 0 299.62sec
howling_rune_3 howling_rune_3 moonfire 8921 63136 211 1.20 6975 14214 3.0 6.0 49.0% 0.0% 0.0% 0.0% 1.07sec 23344196 299.62sec
howling_rune_3 howling_rune_3 moonfire ticks -8921 23281060 77604 369.69 8699 17944 3.0 1848.4 42.1% 0.0% 0.0% 0.0% 1.07sec 23344196 299.62sec
howling_rune_3 howling_rune_3 moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.62sec
howling_rune_3 howling_rune_3 natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.43sec 0 299.62sec
howling_rune_3 howling_rune_3 overwhelming_rage ticks -374037 799764 2666 3.95 40535 0 4.1 19.7 0.0% 0.0% 0.0% 0.0% 62.48sec 884571 299.62sec
howling_rune_3 howling_rune_3 potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 306.50sec 0 299.62sec
howling_rune_3 howling_rune_3 shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.62sec
howling_rune_3 howling_rune_3 shooting_stars_moonfire 202497 6053109 20203 47.68 15933 34180 238.7 238.1 52.0% 0.0% 0.0% 0.0% 1.44sec 6053109 299.62sec
howling_rune_3 howling_rune_3 shooting_stars_sunfire 202497 6073962 20272 47.98 15885 34076 240.2 239.6 52.0% 0.0% 0.0% 0.0% 1.45sec 6073962 299.62sec
howling_rune_3 howling_rune_3 orbit_breaker 274283 12351078 41223 19.12 80980 174413 16.0 95.5 51.8% 0.0% 0.0% 0.0% 18.97sec 12351078 299.62sec
howling_rune_3 howling_rune_3 starfall 191034 93479007 311993 353.96 34669 74657 106.1 1767.5 45.6% 0.0% 0.0% 0.0% 2.81sec 93479007 299.62sec
howling_rune_3 howling_rune_3 starfire 194153 62483510 208543 144.90 53556 115588 119.6 723.6 52.9% 0.0% 0.0% 0.0% 2.47sec 62483510 299.62sec
howling_rune_3 howling_rune_3 sunfire 93402 7136 24 0.20 5473 11162 1.0 1.0 29.2% 0.0% 0.0% 0.0% 0.00sec 19581118 299.62sec
howling_rune_3 howling_rune_3 sunfire ticks -93402 19573982 65247 372.28 7329 15628 1.0 1861.4 38.4% 0.0% 0.0% 0.0% 0.00sec 19581118 299.62sec
howling_rune_3 howling_rune_3 tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.5 0.0 0.0% 0.0% 0.0% 0.0% 31.45sec 0 299.62sec
howling_rune_3 howling_rune_3 denizen_of_the_flame 426486 1122399 3746 10.26 16856 34359 8.5 51.2 28.8% 0.0% 0.0% 0.0% 31.45sec 1122399 299.62sec
howling_rune_3 howling_rune_3 denizen_of_the_flame_secondary 426431 1024158 3418 19.70 8020 16344 16.4 98.4 28.7% 0.0% 0.0% 0.0% 15.46sec 1024158 299.62sec
howling_rune_3 howling_rune_3 wrath 190984 1301801 4345 5.26 34868 71028 26.4 26.3 40.6% 0.0% 0.0% 0.0% 10.30sec 1301801 299.62sec

Fluffy_Pillow : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
159749.1 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Waning Twilight 1.0 0.0 1.7s 0.0s 297.7s 99.39% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 8.6s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:229.1s / 359.0s
  • uptime_min/max:91.23% / 99.74%

Stack Uptimes

  • waning_twilight_1:99.39%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 2.3s 0.0s 298.8s 99.44% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 15.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:225.3s / 359.1s
  • uptime_min/max:92.38% / 99.74%

Stack Uptimes

  • waning_twilight_1:99.44%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 1.7s 0.0s 297.9s 99.40% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 12.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:227.7s / 359.0s
  • uptime_min/max:93.09% / 99.74%

Stack Uptimes

  • waning_twilight_1:99.40%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 1.7s 0.0s 297.9s 99.42% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 9.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:230.7s / 359.1s
  • uptime_min/max:93.95% / 99.75%

Stack Uptimes

  • waning_twilight_1:99.42%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 36191
Mean 299.83
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 34.6842
5th Percentile 245.79
95th Percentile 353.94
( 95th Percentile - 5th Percentile ) 108.15
Mean Distribution
Standard Deviation 0.1823
95.00% Confidence Interval ( 299.47 - 300.18 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 515
0.1% Error 51407
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1027
DPS
Fluffy_Pillow Damage Per Second
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 36191
Mean 171129.26
Minimum 151373.62
Maximum 194739.96
Spread ( max - min ) 43366.35
Range [ ( max - min ) / 2 * 100% ] 12.67%
Standard Deviation 5477.6250
5th Percentile 162411.49
95th Percentile 180468.15
( 95th Percentile - 5th Percentile ) 18056.66
Mean Distribution
Standard Deviation 28.7933
95.00% Confidence Interval ( 171072.83 - 171185.70 )
Normalized 95.00% Confidence Interval ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3936
0.1 Scale Factor Error with Delta=300 256135
0.05 Scale Factor Error with Delta=300 1024539
0.01 Scale Factor Error with Delta=300 25613461
HPS
Fluffy_Pillow Healing Per Second
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 1204
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 50905032 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy2 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
143460.0 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Waning Twilight 1.0 0.0 3.9s 0.0s 295.7s 98.73% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.9s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:226.7s / 359.0s
  • uptime_min/max:93.09% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.73%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.3s 0.0s 296.8s 98.76% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 12.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:229.1s / 359.1s
  • uptime_min/max:91.62% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.76%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 2.9s 0.0s 295.9s 98.70% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 8.6s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:217.9s / 359.0s
  • uptime_min/max:90.12% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.70%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 3.3s 0.0s 295.9s 98.74% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:227.4s / 359.1s
  • uptime_min/max:92.25% / 99.75%

Stack Uptimes

  • waning_twilight_1:98.74%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy2 Fight Length
Count 36191
Mean 299.83
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 34.6842
5th Percentile 245.79
95th Percentile 353.94
( 95th Percentile - 5th Percentile ) 108.15
Mean Distribution
Standard Deviation 0.1823
95.00% Confidence Interval ( 299.47 - 300.18 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 515
0.1% Error 51407
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1027
DPS
enemy2 Damage Per Second
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy2 Priority Target Damage Per Second
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy2 Damage Per Second (Effective)
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy2 Damage
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy2 Damage Taken Per Second
Count 36191
Mean 153335.32
Minimum 133715.04
Maximum 178845.81
Spread ( max - min ) 45130.77
Range [ ( max - min ) / 2 * 100% ] 14.72%
Standard Deviation 5214.4601
5th Percentile 145065.40
95th Percentile 162197.43
( 95th Percentile - 5th Percentile ) 17132.03
Mean Distribution
Standard Deviation 27.4100
95.00% Confidence Interval ( 153281.60 - 153389.04 )
Normalized 95.00% Confidence Interval ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4443
0.1 Scale Factor Error with Delta=300 232115
0.05 Scale Factor Error with Delta=300 928459
0.01 Scale Factor Error with Delta=300 23211455
HPS
enemy2 Healing Per Second
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy2 Healing Per Second (Effective)
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy2 Heal
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy2 Healing Taken Per Second
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy2 Theck-Meloree Index
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy2Theck-Meloree Index (Effective)
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy2 Max Spike Value
Count 1204
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 38475982 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="enemy2"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy3 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
143099.1 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Waning Twilight 1.0 0.0 4.4s 0.0s 295.4s 98.61% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 11.9s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:227.2s / 358.9s
  • uptime_min/max:91.60% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.61%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.0s 0.0s 296.6s 98.68% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 8.6s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:216.9s / 359.1s
  • uptime_min/max:88.54% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.68%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.0s 0.0s 295.7s 98.65% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 11.3s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:223.6s / 359.0s
  • uptime_min/max:90.64% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.65%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 3.8s 0.0s 295.6s 98.65% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 11.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:225.2s / 358.9s
  • uptime_min/max:91.59% / 99.75%

Stack Uptimes

  • waning_twilight_1:98.65%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy3 Fight Length
Count 36191
Mean 299.83
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 34.6842
5th Percentile 245.79
95th Percentile 353.94
( 95th Percentile - 5th Percentile ) 108.15
Mean Distribution
Standard Deviation 0.1823
95.00% Confidence Interval ( 299.47 - 300.18 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 515
0.1% Error 51407
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1027
DPS
enemy3 Damage Per Second
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy3 Priority Target Damage Per Second
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy3 Damage Per Second (Effective)
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy3 Damage
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy3 Damage Taken Per Second
Count 36191
Mean 153156.72
Minimum 133498.57
Maximum 175177.41
Spread ( max - min ) 41678.84
Range [ ( max - min ) / 2 * 100% ] 13.61%
Standard Deviation 5209.4423
5th Percentile 144877.54
95th Percentile 162044.58
( 95th Percentile - 5th Percentile ) 17167.05
Mean Distribution
Standard Deviation 27.3836
95.00% Confidence Interval ( 153103.05 - 153210.39 )
Normalized 95.00% Confidence Interval ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4445
0.1 Scale Factor Error with Delta=300 231669
0.05 Scale Factor Error with Delta=300 926673
0.01 Scale Factor Error with Delta=300 23166805
HPS
enemy3 Healing Per Second
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy3 Healing Per Second (Effective)
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy3 Heal
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy3 Healing Taken Per Second
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy3 Theck-Meloree Index
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy3Theck-Meloree Index (Effective)
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy3 Max Spike Value
Count 1204
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 48808295 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="enemy3"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy4 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
143094.9 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Waning Twilight 1.0 0.0 3.4s 0.0s 295.4s 98.60% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 8.6s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:225.0s / 359.0s
  • uptime_min/max:92.54% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.60%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 3.0s 0.0s 296.5s 98.64% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 8.5s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:225.6s / 359.1s
  • uptime_min/max:91.49% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.64%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 5.0s 0.0s 295.6s 98.62% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.8s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:224.8s / 359.0s
  • uptime_min/max:91.39% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.62%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 3.1s 0.0s 295.6s 98.62% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 9.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:225.2s / 358.8s
  • uptime_min/max:91.32% / 99.75%

Stack Uptimes

  • waning_twilight_1:98.62%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy4 Fight Length
Count 36191
Mean 299.83
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 34.6842
5th Percentile 245.79
95th Percentile 353.94
( 95th Percentile - 5th Percentile ) 108.15
Mean Distribution
Standard Deviation 0.1823
95.00% Confidence Interval ( 299.47 - 300.18 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 515
0.1% Error 51407
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1027
DPS
enemy4 Damage Per Second
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy4 Priority Target Damage Per Second
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy4 Damage Per Second (Effective)
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy4 Damage
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy4 Damage Taken Per Second
Count 36191
Mean 153015.27
Minimum 135128.29
Maximum 178117.04
Spread ( max - min ) 42988.75
Range [ ( max - min ) / 2 * 100% ] 14.05%
Standard Deviation 5174.0884
5th Percentile 144855.27
95th Percentile 161858.67
( 95th Percentile - 5th Percentile ) 17003.40
Mean Distribution
Standard Deviation 27.1978
95.00% Confidence Interval ( 152961.96 - 153068.58 )
Normalized 95.00% Confidence Interval ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4393
0.1 Scale Factor Error with Delta=300 228535
0.05 Scale Factor Error with Delta=300 914138
0.01 Scale Factor Error with Delta=300 22853429
HPS
enemy4 Healing Per Second
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy4 Healing Per Second (Effective)
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy4 Heal
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy4 Healing Taken Per Second
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy4 Theck-Meloree Index
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy4Theck-Meloree Index (Effective)
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy4 Max Spike Value
Count 1204
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 38566767 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="enemy4"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy5 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
142749.3 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Waning Twilight 1.0 0.0 4.3s 0.0s 295.4s 98.60% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 9.3s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:226.7s / 359.0s
  • uptime_min/max:90.32% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.60%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 3.7s 0.0s 296.5s 98.65% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 8.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:225.5s / 358.8s
  • uptime_min/max:91.44% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.65%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 3.4s 0.0s 295.6s 98.61% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 8.6s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:221.4s / 358.9s
  • uptime_min/max:91.09% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.61%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 3.6s 0.0s 295.6s 98.63% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 9.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:227.8s / 359.1s
  • uptime_min/max:91.63% / 99.75%

Stack Uptimes

  • waning_twilight_1:98.63%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy5 Fight Length
Count 36191
Mean 299.83
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 34.6842
5th Percentile 245.79
95th Percentile 353.94
( 95th Percentile - 5th Percentile ) 108.15
Mean Distribution
Standard Deviation 0.1823
95.00% Confidence Interval ( 299.47 - 300.18 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 515
0.1% Error 51407
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1027
DPS
enemy5 Damage Per Second
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy5 Priority Target Damage Per Second
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy5 Damage Per Second (Effective)
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy5 Damage
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy5 Damage Taken Per Second
Count 36191
Mean 152956.31
Minimum 132825.61
Maximum 176648.40
Spread ( max - min ) 43822.79
Range [ ( max - min ) / 2 * 100% ] 14.33%
Standard Deviation 5177.7574
5th Percentile 144810.89
95th Percentile 161832.17
( 95th Percentile - 5th Percentile ) 17021.29
Mean Distribution
Standard Deviation 27.2171
95.00% Confidence Interval ( 152902.97 - 153009.66 )
Normalized 95.00% Confidence Interval ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4402
0.1 Scale Factor Error with Delta=300 228859
0.05 Scale Factor Error with Delta=300 915435
0.01 Scale Factor Error with Delta=300 22885851
HPS
enemy5 Healing Per Second
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy5 Healing Per Second (Effective)
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy5 Heal
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy5 Healing Taken Per Second
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy5 Theck-Meloree Index
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy5Theck-Meloree Index (Effective)
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy5 Max Spike Value
Count 1204
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 48340097 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="enemy5"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy6 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
143690.1 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Waning Twilight 1.0 0.0 4.1s 0.0s 295.3s 98.60% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 11.3s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:226.4s / 359.0s
  • uptime_min/max:92.34% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.60%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 3.8s 0.0s 296.5s 98.64% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 9.3s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:226.9s / 358.9s
  • uptime_min/max:91.15% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.64%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.5s 0.0s 295.6s 98.61% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 16.9s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:216.8s / 359.0s
  • uptime_min/max:90.06% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.61%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.0s 0.0s 295.6s 98.62% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 11.6s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:215.3s / 359.0s
  • uptime_min/max:89.40% / 99.75%

Stack Uptimes

  • waning_twilight_1:98.62%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy6
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy6
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy6
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy6
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy6 Fight Length
Count 36191
Mean 299.83
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 34.6842
5th Percentile 245.79
95th Percentile 353.94
( 95th Percentile - 5th Percentile ) 108.15
Mean Distribution
Standard Deviation 0.1823
95.00% Confidence Interval ( 299.47 - 300.18 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 515
0.1% Error 51407
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1027
DPS
enemy6 Damage Per Second
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy6 Priority Target Damage Per Second
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy6 Damage Per Second (Effective)
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy6 Damage
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy6 Damage Taken Per Second
Count 36191
Mean 153824.58
Minimum 134238.77
Maximum 176291.82
Spread ( max - min ) 42053.04
Range [ ( max - min ) / 2 * 100% ] 13.67%
Standard Deviation 5218.9948
5th Percentile 145525.48
95th Percentile 162697.90
( 95th Percentile - 5th Percentile ) 17172.42
Mean Distribution
Standard Deviation 27.4338
95.00% Confidence Interval ( 153770.81 - 153878.35 )
Normalized 95.00% Confidence Interval ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4422
0.1 Scale Factor Error with Delta=300 232519
0.05 Scale Factor Error with Delta=300 930074
0.01 Scale Factor Error with Delta=300 23251844
HPS
enemy6 Healing Per Second
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy6 Healing Per Second (Effective)
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy6 Heal
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy6 Healing Taken Per Second
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy6 Theck-Meloree Index
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy6Theck-Meloree Index (Effective)
Count 36191
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy6 Max Spike Value
Count 1204
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 53608866 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="enemy6"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.