SimulationCraft 1015-01

for World of Warcraft 10.2.0.52095 PTR (hotfix 2023-11-09/52095, git build e1ec9bc853)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
Adjust bear thrash periodic damage spell level requirement
Thrash spell_level 11.00 18.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-05-16 Base value of Frost aura's effect 191124 is truncated.
Frost Mage (effect#5) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191122 is truncated.
Frost Mage (effect#3) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191121 is truncated.
Frost Mage (effect#2) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 179703 is truncated.
Frost Mage (effect#1) base_value 9.00 9.20
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-01-08 Manually set secondary Malefic Rapture level requirement
Malefic Rapture spell_level 11.00 43.00

Table of Contents

Raid Summary

Created with Highcharts 4.2.3 Damage per Second(Click title for burst)941,930940,837939,023928,018buzzing_rune_3hissing_rune_3howling_rune_3Base
Created with Highcharts 4.2.3 Priority Target/Boss Damage 171,927171,751171,513169,352buzzing_rune_3hissing_rune_3howling_rune_3Base
Created with Highcharts 4.2.3 Damage Taken per Second(Click title for burst)4,9514,9304,9294,916howling_rune_3buzzing_rune_3Basehissing_rune_3

Additional Raid Information

Base : 928018 dps, 169352 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
928018.0 928018.0 461.5 / 0.050% 87692.9 / 9.4% 67337.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.8 13.9 Astral Power 0.00% 56.4 99.9% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Base 928018
Astral Smolder 140030 15.1% 387.5 0.83s 108030 0 Periodic 746.9 56037 0 56037 0.0% 83.0%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 387.46 0.00 746.93 746.93 303.01 0.0000 2.0000 41856851.08 41856851.08 0.00% 28019.22 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 746.93 533 945 56036.52 4650 267775 56116.36 48972 65645 41856851 41856851 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Fury of Elune 27878 3.0% 5.1 64.88s 1628114 1684784 Direct 763.7 6773 14444 10907 53.9%

Stats Details: Fury Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.12 763.73 0.00 0.00 0.00 0.9665 0.0000 8329573.21 8329573.21 0.00% 1684784.23 1684784.23
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 46.11% 352.15 202 515 6773.14 3258 21903 6781.87 5810 7863 2385150 2385150 0.00%
crit 53.89% 411.58 277 578 14443.79 6646 44683 14455.69 12874 16590 5944423 5944423 0.00%

Action Details: Fury Of Elune

  • id:202770
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:astral_power
  • energize_amount:3.0

Spelldata

  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r

Action Details: Fury Of Elune Tick

  • id:211545
  • school:astral
  • range:105.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.149000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:211545
  • name:Fury of Elune
  • school:astral
  • tooltip:
  • description:{$@spelldesc202770=Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r}

Action Priority List

    aoe
    [P]:5.12
  • if_expr:target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Hungering Shadowflame 3837 0.4% 17.1 17.00s 67369 0 Direct 17.1 51898 106100 67385 28.6%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.07 17.07 0.00 0.00 0.00 0.0000 0.0000 1149740.23 1149740.23 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.44% 12.19 2 26 51898.29 34936 202233 51655.55 34936 122319 632691 632691 0.00%
crit 28.56% 4.87 0 18 106099.81 71270 412555 104955.23 0 412555 517049 517049 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy5
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:31299.68
  • base_dd_max:31299.68
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 7086 0.8% 34.1 8.60s 62244 0 Direct 34.0 48090 98036 62423 28.7%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.08 33.99 0.00 0.00 0.00 0.0000 0.0000 2121495.97 2121495.97 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.30% 24.23 9 44 48090.10 47503 54996 48089.59 47503 50156 1165392 1165392 0.00%
crit 28.70% 9.75 1 23 98035.54 96907 112191 98037.63 96907 105277 956104 956104 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42559.30
  • base_dd_max:42559.30
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 76863 8.3% 3.0 1.07s 7665696 8326245 Direct 6.0 6969 14200 10593 50.1%
Periodic 1820.2 8703 17956 12600 42.1% 99.0%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.00 6.00 1820.16 1820.16 0.00 0.9209 0.9789 22997087.71 22997087.71 0.00% 12886.62 8326244.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.87% 2.99 0 6 6968.61 6880 8103 6858.73 0 8103 20851 20851 0.00%
crit 50.13% 3.01 0 6 14200.25 14034 16530 14017.67 0 16530 42712 42712 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 57.88% 1053.55 788 1340 8702.78 6630 14138 8702.74 8457 9001 9168598 9168598 0.00%
crit 42.12% 766.61 559 993 17955.74 13525 28841 17958.90 17443 18577 13764926 13764926 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    aoe
    [J]:3.00
  • if_expr:!fight_style.dungeonroute
  • target_if_expr:refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (80652) 0.0% (8.7%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 19938 2.1% 235.8 1.47s 25290 0 Direct 235.2 15897 34128 25354 51.9%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 235.83 235.23 0.00 0.00 0.00 0.0000 0.0000 5963977.68 5963977.68 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.12% 113.20 65 162 15897.00 10979 30135 15904.19 14662 17247 1799464 1799464 0.00%
crit 51.88% 122.03 78 175 34128.14 22398 61476 34156.31 32143 37258 4164514 4164514 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy5
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 20022 2.2% 237.5 1.46s 25213 0 Direct 236.9 15849 34017 25278 51.9%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 237.52 236.92 0.00 0.00 0.00 0.0000 0.0000 5988563.25 5988563.25 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.10% 113.96 68 174 15848.97 9912 30135 15855.43 14532 17288 1806040 1806040 0.00%
crit 51.90% 122.96 82 172 34016.55 20220 61476 34042.19 31701 36549 4182524 4182524 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 40692 4.4% 15.8 19.19s 771413 0 Direct 94.4 80844 174081 128935 51.6%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.78 94.41 0.00 0.00 0.00 0.0000 0.0000 12171360.67 12171360.67 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.43% 45.72 19 76 80844.28 40859 304293 80913.69 59403 100301 3695792 3695792 0.00%
crit 51.57% 48.69 22 80 174080.51 83352 620759 174185.46 135519 216805 8475568 8475568 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:enemy2
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfall 308381 33.2% 104.7 2.84s 880440 870337 Direct 1766.4 34183 73714 52186 45.5%

Stats Details: Starfall

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 104.69 1766.35 0.00 0.00 0.00 1.0116 0.0000 92176564.32 92176564.32 0.00% 870337.41 870337.41
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.46% 961.89 684 1237 34182.77 7537 128122 34256.88 31163 38204 32879086 32879086 0.00%
crit 45.54% 804.46 586 1045 73714.09 15375 276138 73846.49 67745 81940 59297478 59297478 0.00%

Action Details: Starfall

  • id:191034
  • school:astral
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:45.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]

Action Details: Starfall Damage

  • id:191037
  • school:astral
  • range:200.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.114000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.41

Spelldata

  • id:191037
  • name:Starfall
  • school:astral
  • tooltip:
  • description:{$@spelldesc191034=Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]}

Action Priority List

    aoe
    [L]:70.48
  • if_expr:variable.starfall_condition1
    aoe
    [Q]:34.21
  • if_expr:variable.starfall_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountLunar Shrapnel4151691PCT0.200
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 207561 22.4% 117.7 2.51s 527087 377875 Direct 712.5 54011 116593 87106 52.9%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.74 712.46 0.00 0.00 0.00 1.3949 0.0000 62061078.43 62061078.43 0.00% 377875.13 377875.13
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 47.12% 335.68 230 447 54011.44 7433 240137 54034.15 47494 61979 18130694 18130694 0.00%
crit 52.88% 376.78 281 491 116592.97 15163 491633 116654.88 104457 135883 43930384 43930384 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    aoe
    [M]:1.26
  • if_expr:buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
    aoe
    [R]:117.00
  • if_expr:spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Solar)4851710.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Sunfire16481550.283Mastery
Sunfire 64413 6.9% 1.0 0.00s 19258026 20752183 Direct 1.0 5472 11161 7055 27.8%
Periodic 1833.1 7322 15623 10502 38.3% 99.7%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 1833.07 1833.07 0.00 0.9285 0.9786 19258026.29 19258026.29 0.00% 10730.37 20752183.50
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.22% 0.72 0 1 5472.45 5438 5510 3951.95 0 5510 3952 3952 0.00%
crit 27.78% 0.28 0 1 11161.36 11094 11240 3101.15 0 11240 3101 3101 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 61.69% 1130.76 845 1415 7321.50 5479 12722 7325.07 7104 7630 8278711 8278711 0.00%
crit 38.31% 702.31 520 911 15623.39 11178 25953 15632.93 15039 16257 10972262 10972262 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    aoe
    [I]:1.00
  • target_if_expr:refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (7057) 0.0% (0.8%) 8.4 31.96s 251393 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.40 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy3
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 3686 0.4% 8.4 31.96s 131288 0 Direct 50.4 16858 34363 21881 28.7%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.40 50.40 0.00 0.00 0.00 0.0000 0.0000 1102795.28 1102795.28 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.30% 35.94 7 87 16858.07 16647 19272 16858.21 16647 18278 605826 605826 0.00%
crit 28.70% 14.46 1 43 34363.46 33959 39316 34366.78 33959 39316 496969 496969 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:51134.41
  • base_dd_max:51134.41
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 3371 0.4% 16.1 15.69s 62511 0 Direct 96.8 8021 16349 10418 28.8%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.14 96.83 0.00 0.00 0.00 0.0000 0.0000 1008871.10 1008871.10 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.21% 68.96 15 166 8021.11 7921 9170 8020.74 7921 8634 553097 553097 0.00%
crit 28.79% 27.88 5 76 16348.67 16159 18707 16350.79 16159 17590 455774 455774 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24330.91
  • base_dd_max:24330.91
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 4259 0.5% 26.4 10.32s 48499 62998 Direct 26.3 34206 69928 48762 40.7%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.43 26.29 0.00 0.00 0.00 0.7699 0.0000 1281699.93 1281699.93 0.00% 62998.28 62998.28
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.26% 15.58 5 27 34205.94 15081 65635 34135.00 24904 43726 532783 532783 0.00%
crit 40.74% 10.71 1 23 69928.04 30766 133895 69754.72 37402 97618 748917 748917 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    aoe
    [O]:24.51
  • if_expr:!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.800Spell Data
Eclipse (Solar)4851710.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Lunar)4851810.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
Base
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Base
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Base
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Base
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 180.88s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    aoe
    [N]:2.00
  • if_expr:variable.cd_condition_aoe

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.2 64.69s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.23 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Base
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:70932.17
  • base_dd_max:70932.17
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.38s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Base
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.74
Elemental Potion of Ultimate Power 1.4 305.47s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.44 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.44
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 17.4 6.0 17.7s 13.4s 9.6s 55.85% 57.87% 6.0 (20.5) 16.8

Buff Details

  • buff initial source:Base
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 50.9s
  • trigger_min/max:0.0s / 38.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.9s
  • uptime_min/max:51.35% / 59.68%

Stack Uptimes

  • balance_of_all_things_arcane_1:5.73%
  • balance_of_all_things_arcane_2:6.13%
  • balance_of_all_things_arcane_3:6.62%
  • balance_of_all_things_arcane_4:7.04%
  • balance_of_all_things_arcane_5:7.33%
  • balance_of_all_things_arcane_6:7.55%
  • balance_of_all_things_arcane_7:7.68%
  • balance_of_all_things_arcane_8:7.76%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 10.2 0.0 29.8s 29.7s 7.9s 27.19% 30.45% 0.0 (0.0) 10.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 47.3s
  • trigger_min/max:4.0s / 47.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:24.65% / 30.00%

Stack Uptimes

  • balance_of_all_things_nature_1:3.36%
  • balance_of_all_things_nature_2:3.38%
  • balance_of_all_things_nature_3:3.39%
  • balance_of_all_things_nature_4:3.40%
  • balance_of_all_things_nature_5:3.41%
  • balance_of_all_things_nature_6:3.41%
  • balance_of_all_things_nature_7:3.42%
  • balance_of_all_things_nature_8:3.43%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 15.1 86.4 20.3s 2.9s 17.5s 88.22% 0.00% 35.5 (35.5) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 59.1s
  • trigger_min/max:0.8s / 13.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:82.46% / 93.23%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:13.34%
  • balance_t31_4pc_buff_lunar_2:13.67%
  • balance_t31_4pc_buff_lunar_3:13.98%
  • balance_t31_4pc_buff_lunar_4:11.75%
  • balance_t31_4pc_buff_lunar_5:35.48%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 8.2 57.1 38.0s 4.4s 18.9s 52.00% 0.00% 26.4 (26.4) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.1s / 84.0s
  • trigger_min/max:0.8s / 39.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.22% / 59.41%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:7.42%
  • balance_t31_4pc_buff_solar_2:6.46%
  • balance_t31_4pc_buff_solar_3:6.29%
  • balance_t31_4pc_buff_solar_4:6.43%
  • balance_t31_4pc_buff_solar_5:25.39%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 70.2s 70.2s 10.8s 10.12% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 337.1s
  • trigger_min/max:12.0s / 337.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 36.70%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.90%
  • best_friends_with_aerwynn_2:0.91%
  • best_friends_with_aerwynn_3:0.91%
  • best_friends_with_aerwynn_4:0.91%
  • best_friends_with_aerwynn_5:0.92%
  • best_friends_with_aerwynn_6:0.92%
  • best_friends_with_aerwynn_7:0.92%
  • best_friends_with_aerwynn_8:0.93%
  • best_friends_with_aerwynn_9:0.93%
  • best_friends_with_aerwynn_10:0.93%
  • best_friends_with_aerwynn_11:0.94%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 113.7s 70.2s 45.3s 33.46% 0.00% 69.6 (69.6) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 342.5s
  • trigger_min/max:12.0s / 337.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 303.3s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.46%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 69.2s 69.2s 10.8s 10.17% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 329.2s
  • trigger_min/max:12.0s / 329.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 38.11%

Stack Uptimes

  • best_friends_with_pip_1:0.91%
  • best_friends_with_pip_2:0.91%
  • best_friends_with_pip_3:0.91%
  • best_friends_with_pip_4:0.92%
  • best_friends_with_pip_5:0.92%
  • best_friends_with_pip_6:0.92%
  • best_friends_with_pip_7:0.93%
  • best_friends_with_pip_8:0.93%
  • best_friends_with_pip_9:0.93%
  • best_friends_with_pip_10:0.94%
  • best_friends_with_pip_11:0.94%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 113.1s 69.2s 45.6s 33.53% 0.00% 69.2 (69.2) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 358.0s
  • trigger_min/max:12.0s / 329.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 305.7s
  • uptime_min/max:0.00% / 98.38%

Stack Uptimes

  • best_friends_with_pip_static_1:33.53%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 70.0s 70.0s 10.8s 10.09% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 350.0s
  • trigger_min/max:12.0s / 350.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 33.83%

Stack Uptimes

  • best_friends_with_urctos_1:0.90%
  • best_friends_with_urctos_2:0.90%
  • best_friends_with_urctos_3:0.91%
  • best_friends_with_urctos_4:0.91%
  • best_friends_with_urctos_5:0.91%
  • best_friends_with_urctos_6:0.92%
  • best_friends_with_urctos_7:0.92%
  • best_friends_with_urctos_8:0.92%
  • best_friends_with_urctos_9:0.93%
  • best_friends_with_urctos_10:0.93%
  • best_friends_with_urctos_11:0.93%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 113.0s 70.0s 44.7s 33.01% 0.00% 69.3 (69.3) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:13.3s / 350.0s
  • trigger_min/max:12.0s / 350.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 297.1s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.01%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.54% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.54%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 61.7s 58.1s 49.9s 80.11% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 335.0s
  • trigger_min/max:15.0s / 304.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 359.7s
  • uptime_min/max:44.29% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.11%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dreamstate 15.3 0.1 20.3s 21.3s 2.1s 10.81% 20.61% 0.1 (0.1) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.6s / 54.5s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.4s
  • uptime_min/max:6.94% / 15.61%

Stack Uptimes

  • dreamstate_1:7.36%
  • dreamstate_2:3.45%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 13.2 8.1 23.6s 14.8s 21.0s 93.11% 93.82% 8.1 (8.1) 12.3

Buff Details

  • buff initial source:Base
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.6s / 71.2s
  • trigger_min/max:0.0s / 57.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.0s
  • uptime_min/max:89.84% / 95.99%

Stack Uptimes

  • eclipse_lunar_1:93.11%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 8.2 0.0 38.1s 38.1s 19.1s 52.75% 54.68% 0.0 (0.0) 7.9

Buff Details

  • buff initial source:Base
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 84.4s
  • trigger_min/max:12.0s / 84.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:47.06% / 59.74%

Stack Uptimes

  • eclipse_solar_1:52.75%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 305.8s 305.8s 27.4s 12.91% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 325.7s
  • trigger_min/max:300.0s / 325.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.77% / 17.86%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.91%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Fury of Elune 5.1 0.0 65.1s 65.1s 7.9s 13.51% 0.00% 75.7 (75.7) 4.9

Buff Details

  • buff initial source:Base
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:60.0s / 88.7s
  • trigger_min/max:60.0s / 88.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:10.91% / 15.67%

Stack Uptimes

  • fury_of_elune_1:13.51%

Spelldata

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 8.2 0.0 38.1s 38.1s 19.1s 52.75% 55.39% 0.0 (0.0) 7.9

Buff Details

  • buff initial source:Base
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 84.4s
  • trigger_min/max:12.0s / 84.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:47.06% / 59.74%

Stack Uptimes

  • incarnation_chosen_of_elune_1:52.75%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.7 0.0 90.9s 90.9s 19.5s 24.01% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:Base
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:65.76

Trigger Details

  • interval_min/max:90.0s / 122.4s
  • trigger_min/max:90.0s / 122.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:21.18% / 26.98%

Stack Uptimes

  • kindled_soul_5:1.17%
  • kindled_soul_10:1.18%
  • kindled_soul_15:1.18%
  • kindled_soul_20:1.18%
  • kindled_soul_25:1.18%
  • kindled_soul_30:1.19%
  • kindled_soul_35:1.19%
  • kindled_soul_40:1.19%
  • kindled_soul_45:1.20%
  • kindled_soul_50:1.20%
  • kindled_soul_55:1.20%
  • kindled_soul_60:1.20%
  • kindled_soul_65:1.21%
  • kindled_soul_70:1.21%
  • kindled_soul_75:1.21%
  • kindled_soul_80:1.22%
  • kindled_soul_85:1.22%
  • kindled_soul_90:1.22%
  • kindled_soul_95:1.23%
  • kindled_soul_100:1.23%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Vigil 3.7 0.0 90.4s 90.4s 14.7s 18.42% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:Base
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.5s
  • trigger_min/max:90.0s / 91.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.52% / 21.01%

Stack Uptimes

  • natures_vigil_1:18.42%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.0 69.6s 69.0s 0.9s 0.75% 1.16% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 342.1s
  • trigger_min/max:0.0s / 342.1s
  • trigger_pct:14.86%
  • duration_min/max:0.0s / 6.2s
  • uptime_min/max:0.00% / 4.89%

Stack Uptimes

  • owlkin_frenzy_1:0.75%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 9.2 96.4 34.0s 34.0s 29.8s 91.37% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:21.0s / 46.8s
  • trigger_min/max:21.0s / 46.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.7s
  • uptime_min/max:87.41% / 94.83%

Stack Uptimes

  • primordial_arcanic_pulsar_5:7.24%
  • primordial_arcanic_pulsar_10:6.73%
  • primordial_arcanic_pulsar_15:7.53%
  • primordial_arcanic_pulsar_20:8.34%
  • primordial_arcanic_pulsar_25:8.63%
  • primordial_arcanic_pulsar_30:8.40%
  • primordial_arcanic_pulsar_35:8.67%
  • primordial_arcanic_pulsar_40:9.03%
  • primordial_arcanic_pulsar_45:9.08%
  • primordial_arcanic_pulsar_50:8.81%
  • primordial_arcanic_pulsar_55:8.90%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 19.7 3.7 15.6s 13.4s 6.7s 43.99% 43.20% 3.7 (3.7) 19.3

Buff Details

  • buff initial source:Base
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 44.7s
  • trigger_min/max:0.0s / 38.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:39.87% / 47.10%

Stack Uptimes

  • solstice_1:43.99%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starfall 104.7 0.0 143.0s 2.8s 295.6s 98.88% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_starfall
  • max_stacks:20
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:asynchronous
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.8s / 357.3s
  • trigger_min/max:0.7s / 8.4s
  • trigger_pct:99.99%
  • duration_min/max:24.5s / 358.1s
  • uptime_min/max:98.32% / 99.49%

Stack Uptimes

  • starfall_1:5.25%
  • starfall_2:32.49%
  • starfall_3:42.26%
  • starfall_4:15.17%
  • starfall_5:3.36%
  • starfall_6:0.36%
  • starfall_7:0.00%

Spelldata

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]
  • max_stacks:20
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Starlord 21.0 83.7 14.5s 2.8s 13.9s 97.49% 0.00% 42.4 (42.4) 6.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 19.2s
  • trigger_min/max:0.8s / 8.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:94.53% / 99.39%

Stack Uptimes

  • starlord_1:12.60%
  • starlord_2:17.67%
  • starlord_3:67.21%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Umbral Embrace 23.1 2.7 12.7s 11.3s 1.6s 12.45% 0.00% 2.7 (2.7) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_umbral_embrace
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 55.5s
  • trigger_min/max:0.0s / 55.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.7s
  • uptime_min/max:4.52% / 23.21%

Stack Uptimes

  • umbral_embrace_1:12.45%

Spelldata

  • id:393763
  • name:Umbral Embrace
  • tooltip:Your next Wrath or Starfire cast during an Eclipse deals Astral damage and deals {$=}w1% additional damage.
  • description:{$@spelldesc393760=Dealing Astral damage has a chance to cause your next Wrath or Starfire cast during an Eclipse to become Astral and deal {$s1=25}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Wafting Devotion 4.3 1.2 61.1s 45.7s 16.5s 23.52% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 205.8s
  • trigger_min/max:0.0s / 201.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 71.3s
  • uptime_min/max:4.82% / 59.15%

Stack Uptimes

  • wafting_devotion_1:23.52%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:Base
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:Base
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:Base
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:Base
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:Base
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:Base
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:Base
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Primordial Arcanic Pulsar 8.3 6.0 10.0 35.2s 22.7s 47.3s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.05% 0.00% 0.63% 0.0s 0.0s 1.0s
Astral Smolder 75.00% 63.07% 84.45% 4.3s 0.0s 49.4s
Incarnation (Total) 52.75% 47.06% 59.74% 19.1s 0.0s 54.0s
Incarnation (Pulsar) 32.44% 29.66% 35.04% 11.8s 0.0s 12.0s
Lunar Eclipse Only 40.36% 32.57% 46.46% 9.2s 0.0s 15.0s
No Eclipse 6.86% 4.01% 9.94% 1.7s 0.0s 4.6s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Fury of Elune5.2460.00028.71026.8476.31074.709

Eclipse Utilization

NoneSolarLunarBoth
Wrath24.43100.0%0.000.0%0.000.0%0.000.0%
Starfire2.472.1%0.000.0%49.8041.9%66.4856.0%
Starfall20.787.0%0.000.0%117.8239.8%157.0953.1%
Fury of Elune15.642.0%0.000.0%142.7818.7%605.3179.3%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Base
Fury of EluneAstral Power80.67241.625.79%3.000.380.16%
MoonfireAstral Power3.0018.000.43%6.000.000.00%
Orbit BreakerAstral Power15.78471.1911.29%29.862.150.45%
Shooting Stars (Moonfire)Astral Power235.82471.3511.29%2.000.300.06%
Shooting Stars (Sunfire)Astral Power237.53474.7611.37%2.000.300.06%
StarfireAstral Power118.742226.9453.35%18.7535.191.56%
SunfireAstral Power1.006.000.14%6.000.000.00%
WrathAstral Power26.43264.296.33%10.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
Base
StarfallAstral Power 105.064135.05100.00%39.3639.5022291.52
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 896660.0 4277.84 4927.50 3505675.0 702094.0 -146904.8 896660.0
Astral Power 20.0 13.94 13.76 38.3 53.6 0.8 100.0

Statistics & Data Analysis

Fight Length
Base Fight Length
Count 9131
Mean 299.49
Minimum 240.01
Maximum 359.95
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 34.4322
5th Percentile 245.77
95th Percentile 353.55
( 95th Percentile - 5th Percentile ) 107.78
Mean Distribution
Standard Deviation 0.3603
95.00% Confidence Interval ( 298.78 - 300.20 )
Normalized 95.00% Confidence Interval ( 99.76% - 100.24% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 508
0.1% Error 50777
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1013
DPS
Base Damage Per Second
Count 9131
Mean 928017.98
Minimum 858030.54
Maximum 1031569.60
Spread ( max - min ) 173539.06
Range [ ( max - min ) / 2 * 100% ] 9.35%
Standard Deviation 22501.0909
5th Percentile 892815.06
95th Percentile 966542.02
( 95th Percentile - 5th Percentile ) 73726.96
Mean Distribution
Standard Deviation 235.4748
95.00% Confidence Interval ( 927556.45 - 928479.50 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2259
0.1 Scale Factor Error with Delta=300 4322061
0.05 Scale Factor Error with Delta=300 17288241
0.01 Scale Factor Error with Delta=300 432206024
Priority Target DPS
Base Priority Target Damage Per Second
Count 9131
Mean 169351.98
Minimum 151373.62
Maximum 191066.38
Spread ( max - min ) 39692.76
Range [ ( max - min ) / 2 * 100% ] 11.72%
Standard Deviation 5346.6655
5th Percentile 160740.79
95th Percentile 178368.37
( 95th Percentile - 5th Percentile ) 17627.59
Mean Distribution
Standard Deviation 55.9531
95.00% Confidence Interval ( 169242.31 - 169461.64 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3829
0.1 Scale Factor Error with Delta=300 244034
0.05 Scale Factor Error with Delta=300 976135
0.01 Scale Factor Error with Delta=300 24403365
DPS(e)
Base Damage Per Second (Effective)
Count 9131
Mean 928017.98
Minimum 858030.54
Maximum 1031569.60
Spread ( max - min ) 173539.06
Range [ ( max - min ) / 2 * 100% ] 9.35%
Damage
Base Damage
Count 9131
Mean 277467685.15
Minimum 217171510.26
Maximum 339011895.14
Spread ( max - min ) 121840384.88
Range [ ( max - min ) / 2 * 100% ] 21.96%
DTPS
Base Damage Taken Per Second
Count 9131
Mean 4928.72
Minimum 1340.99
Maximum 10484.61
Spread ( max - min ) 9143.62
Range [ ( max - min ) / 2 * 100% ] 92.76%
HPS
Base Healing Per Second
Count 9131
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Base Healing Per Second (Effective)
Count 9131
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Base Heal
Count 9131
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Base Healing Taken Per Second
Count 9131
Mean 4270.01
Minimum 922.26
Maximum 8931.01
Spread ( max - min ) 8008.75
Range [ ( max - min ) / 2 * 100% ] 93.78%
TMI
Base Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
BaseTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Base Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.44 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.68 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.74 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.aoe
# count action,conditions
0.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
0.00 variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
I 1.00 sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
J 3.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
0.00 variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
K 13.97 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
L 70.48 starfall,if=variable.starfall_condition1
M 1.26 starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
0.00 celestial_alignment,if=variable.cd_condition_aoe
N 2.00 incarnation,if=variable.cd_condition_aoe
0.00 warrior_of_elune
0.00 variable,name=enter_solar,value=spell_targets.starfire<3
0.00 starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
O 24.51 wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
0.00 wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
P 5.12 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
Q 34.21 starfall,if=variable.starfall_condition2
0.00 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+50
0.00 convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 new_moon,if=astral_power.deficit>variable.passive_asp+10
0.00 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
R 117.00 starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
0.00 wrath
S 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFIJJJLMNDEPLLRRLRLRLRLRKLQRRQRRRLRLRLRKLQRQRRRLRLLRRKLQROOQRRRLRKLQRRLRLPRLOLORLQRRQRRLRLOOQRFRQRQERRLRKLQOOQRRRLRRKLRQROOQRLRRKLQPRQRLRLRLOOKLRQRQRRRLROOLRLQRRRLRRLRLLRLOOFMLRLNRERLRLLPQRRLRLRLRKLQQRRRLRLRRKLQRQRRRLOORLRLQRQRRLRLOORKLQRRLRPLRLOOLRR

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask Base 0.0/100: 0% astral_power
Pre precombat 1 food Base 0.0/100: 0% astral_power corrupting_rage
Pre precombat 2 augmentation Base 0.0/100: 0% astral_power corrupting_rage
Pre precombat 4 no_cd_talent Base 0.0/100: 0% astral_power corrupting_rage
Pre precombat 5 on_use_trinket Base 0.0/100: 0% astral_power corrupting_rage
Pre precombat 6 on_use_trinket Base 0.0/100: 0% astral_power corrupting_rage
Pre precombat 7 on_use_trinket Base 0.0/100: 0% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 10.0/100: 10% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil Base 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.000 aoe I sunfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.927 aoe J moonfire Fluffy_Pillow 47.2/100: 47% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:01.855 aoe J moonfire enemy2 59.2/100: 59% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, owlkin_frenzy, solstice, dreamstate, corrupting_rage
0:02.783 aoe J moonfire enemy5 69.2/100: 69% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, owlkin_frenzy, solstice, dreamstate, corrupting_rage
0:03.712 aoe L starfall Fluffy_Pillow 81.2/100: 81% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, owlkin_frenzy, solstice, dreamstate, corrupting_rage
0:04.641 aoe M starfire Fluffy_Pillow 40.2/100: 40% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, owlkin_frenzy, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, corrupting_rage
0:05.396 aoe N incarnation_chosen_of_elune Fluffy_Pillow 63.4/100: 63% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, corrupting_rage
0:05.396 default D potion Fluffy_Pillow 63.4/100: 63% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), corrupting_rage
0:05.396 default E use_items Fluffy_Pillow 63.4/100: 63% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power
0:05.396 aoe P fury_of_elune Fluffy_Pillow 63.4/100: 63% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:06.208 aoe L starfall Fluffy_Pillow 70.4/100: 70% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:07.019 aoe L starfall Fluffy_Pillow 45.4/100: 45% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:07.802 aoe R starfire Fluffy_Pillow 49.4/100: 49% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:08.558 aoe R starfire Fluffy_Pillow 78.6/100: 79% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:09.313 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:10.068 aoe R starfire Fluffy_Pillow 77.0/100: 77% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
0:11.199 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:11.953 aoe R starfire Fluffy_Pillow 73.0/100: 73% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
0:13.084 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:13.839 aoe R starfire Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:14.969 aoe L starfall Fluffy_Pillow 91.2/100: 91% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:15.722 aoe R starfire Fluffy_Pillow 58.2/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:16.852 aoe K cancel_buff Fluffy_Pillow 81.4/100: 81% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:16.852 aoe L starfall Fluffy_Pillow 81.4/100: 81% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:17.697 aoe Q starfall Fluffy_Pillow 50.4/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:18.510 aoe R starfire Fluffy_Pillow 15.4/100: 15% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(5), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:19.682 aoe R starfire Fluffy_Pillow 34.6/100: 35% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:20.853 aoe Q starfall Fluffy_Pillow 53.8/100: 54% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:21.636 aoe R starfire Fluffy_Pillow 18.8/100: 19% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:22.766 aoe R starfire Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:23.895 aoe R starfire Fluffy_Pillow 63.2/100: 63% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:25.024 aoe L starfall Fluffy_Pillow 84.4/100: 84% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:25.779 aoe R starfire Fluffy_Pillow 49.4/100: 49% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:26.909 aoe L starfall Fluffy_Pillow 72.6/100: 73% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:27.664 aoe R starfire Fluffy_Pillow 71.6/100: 72% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:28.794 aoe L starfall Fluffy_Pillow 96.8/100: 97% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:29.546 aoe R starfire Fluffy_Pillow 65.8/100: 66% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:30.676 aoe K cancel_buff Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:30.676 aoe L starfall Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:31.520 aoe Q starfall Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:32.332 aoe R starfire Fluffy_Pillow 33.0/100: 33% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), solstice, starfall(5), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:33.504 aoe Q starfall Fluffy_Pillow 56.2/100: 56% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:34.285 aoe R starfire Fluffy_Pillow 23.2/100: 23% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:35.416 aoe R starfire Fluffy_Pillow 46.4/100: 46% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:36.544 aoe R starfire Fluffy_Pillow 69.6/100: 70% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:37.675 aoe L starfall Fluffy_Pillow 94.8/100: 95% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:38.429 aoe R starfire Fluffy_Pillow 63.8/100: 64% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:39.559 aoe L starfall Fluffy_Pillow 85.0/100: 85% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:40.314 aoe L starfall Fluffy_Pillow 52.0/100: 52% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:41.293 aoe R starfire Fluffy_Pillow 17.0/100: 17% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:42.760 aoe R starfire Fluffy_Pillow 70.2/100: 70% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:44.227 aoe K cancel_buff Fluffy_Pillow 91.4/100: 91% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:44.227 aoe L starfall Fluffy_Pillow 91.4/100: 91% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:45.324 aoe Q starfall Fluffy_Pillow 58.4/100: 58% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:46.379 aoe R starfire Fluffy_Pillow 25.4/100: 25% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:47.902 aoe O wrath Fluffy_Pillow 37.4/100: 37% astral_power primordial_arcanic_pulsar(45), starfall(3), starlord(2), dreamstate, corrupting_rage
0:48.658 aoe O wrath Fluffy_Pillow 47.4/100: 47% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(2), corrupting_rage
0:49.413 aoe Q starfall Fluffy_Pillow 57.4/100: 57% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), wafting_devotion, corrupting_rage
0:50.449 aoe R starfire Fluffy_Pillow 16.4/100: 16% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, wafting_devotion, corrupting_rage
0:51.947 aoe R starfire Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos(11), wafting_devotion, corrupting_rage
0:53.445 aoe R starfire Fluffy_Pillow 68.8/100: 69% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos(10), wafting_devotion, corrupting_rage
0:54.941 aoe L starfall Fluffy_Pillow 98.0/100: 98% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos(8), wafting_devotion, corrupting_rage
0:55.940 aoe R starfire Fluffy_Pillow 57.0/100: 57% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(7), wafting_devotion, corrupting_rage
0:57.435 aoe K cancel_buff Fluffy_Pillow 78.2/100: 78% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(6), wafting_devotion
0:57.435 aoe L starfall Fluffy_Pillow 78.2/100: 78% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(6), wafting_devotion
0:58.556 aoe Q starfall Fluffy_Pillow 39.2/100: 39% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(5), wafting_devotion
0:59.533 aoe R starfire Fluffy_Pillow 10.2/100: 10% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(4), wafting_devotion
1:00.947 aoe R starfire Fluffy_Pillow 33.4/100: 33% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(2), wafting_devotion
1:02.358 aoe L starfall Fluffy_Pillow 92.6/100: 93% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos, wafting_devotion
1:03.301 aoe R starfire Fluffy_Pillow 61.6/100: 62% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), wafting_devotion
1:04.661 aoe L starfall Fluffy_Pillow 84.8/100: 85% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5)
1:05.641 aoe P fury_of_elune Fluffy_Pillow 51.8/100: 52% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5)
1:06.619 aoe R starfire Fluffy_Pillow 56.8/100: 57% astral_power