SimulationCraft 1015-01

for World of Warcraft 10.2.0.52095 PTR (hotfix 2023-11-09/52095, git build e1ec9bc853)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
Adjust bear thrash periodic damage spell level requirement
Thrash spell_level 11.00 18.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-05-16 Base value of Frost aura's effect 191124 is truncated.
Frost Mage (effect#5) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191122 is truncated.
Frost Mage (effect#3) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191121 is truncated.
Frost Mage (effect#2) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 179703 is truncated.
Frost Mage (effect#1) base_value 9.00 9.20
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-01-08 Manually set secondary Malefic Rapture level requirement
Malefic Rapture spell_level 11.00 43.00

Table of Contents

Raid Summary

Created with Highcharts 4.2.3 Damage per Second(Click title for burst)249,073249,012248,897245,414hissing_rune_3howling_rune_3buzzing_rune_3Base
Created with Highcharts 4.2.3 Damage Taken per Second(Click title for burst)4,9994,9814,9744,959howling_rune_3buzzing_rune_3hissing_rune_3Base

Additional Raid Information

Base : 245414 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
245414.0 245414.0 122.4 / 0.050% 35968.7 / 14.7% 19387.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.2 12.2 Astral Power 0.00% 67.2 100.0% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Base 245414
Astral Smolder 17530 7.1% 66.9 4.46s 78510 0 Periodic 118.4 44344 0 44344 0.0% 78.9%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 66.88 0.00 118.41 118.41 51.54 0.0000 2.0000 5250875.75 5250875.75 0.00% 22171.78 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 118.41 71 163 44343.77 9435 154766 44360.54 32189 56743 5250876 5250876 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Denizen of the Dream 0 (7761) 0.0% (3.2%) 8.6 31.85s 269741 0

Stats Details: Denizen Of The Dream

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.63 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Denizen Of The Dream

  • id:394065
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394065
  • name:Denizen of the Dream
  • school:physical
  • tooltip:
  • description:Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.
    Fey Missile 19553  / 7761 3.2% 152.9 1.72s 15226 11870 Direct 151.9 11702 24303 15322 28.7%

Stats Details: Fey Missile

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 152.90 151.94 0.00 0.00 0.00 1.2827 0.0000 2327970.41 2327970.41 0.00% 11870.25 11870.25
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.27% 108.30 22 277 11701.51 7708 20414 11693.13 10445 13829 1267209 1267209 0.00%
crit 28.73% 43.65 7 119 24303.44 16370 41821 24290.51 21391 30099 1060761 1060761 0.00%

Action Details: Fey Missile

  • id:188046
  • school:astral
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.129
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.236000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:188046
  • name:Fey Missile
  • school:astral
  • tooltip:
  • description:{$@spelldesc187875=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$188083d=30 seconds}.}

Action Priority List

    default
    [ ]:16500.47
Hungering Shadowflame 3892 1.6% 17.4 16.61s 67211 0 Direct 17.4 51660 105557 67209 28.9%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.38 17.38 0.00 0.00 0.00 0.0000 0.0000 1168072.78 1168072.78 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.15% 12.37 3 28 51660.10 34936 202233 51477.75 34936 134718 638776 638776 0.00%
crit 28.85% 5.01 0 18 105557.39 71270 412555 104682.44 0 412555 529297 529297 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:31299.68
  • base_dd_max:31299.68
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 7125 2.9% 34.4 8.58s 62198 0 Direct 34.3 48090 98013 62372 28.6%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.35 34.25 0.00 0.00 0.00 0.0000 0.0000 2136529.77 2136529.77 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.39% 24.45 4 45 48090.15 47503 54996 48089.32 47503 50428 1176010 1176010 0.00%
crit 28.61% 9.80 0 22 98012.85 96907 112191 98008.39 0 107096 960519 960519 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42559.30
  • base_dd_max:42559.30
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 12865 5.2% 14.3 21.60s 268613 278445 Direct 14.3 9209 19255 12811 35.9%
Periodic 312.2 8334 17744 11752 36.3% 99.5%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.35 14.35 312.24 312.24 13.34 0.9647 0.9561 3853400.28 3853400.28 0.00% 12335.54 278444.99
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 64.15% 9.20 1 17 9209.41 5982 17694 9211.21 7437 12454 84748 84748 0.00%
crit 35.85% 5.14 0 13 19254.67 12364 35518 19214.89 0 29726 99031 99031 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 63.67% 198.80 135 269 8333.77 886 15394 8338.07 7860 8986 1656760 1656760 0.00%
crit 36.33% 113.44 68 160 17743.72 1514 31404 17754.37 16381 19357 2012860 2012860 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    st
    [K]:1.25
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [S]:13.09
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
New Moon (Talent) 0 (23044) 0.0% (9.4%) 17.0 17.94s 406008 342646

Stats Details: Moons Talent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.01 0.00 0.00 0.00 0.00 1.1850 0.0000 0.00 0.00 0.00% 342646.27 342646.27

Action Details: Moons Talent

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
    Full Moon 8421 3.4% 5.3 62.66s 477088 259607 Direct 5.3 325208 650109 480041 47.6%

Stats Details: Full Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.31 5.27 0.00 0.00 0.00 1.8378 0.0000 2531169.44 2531169.44 0.00% 259607.12 259607.12
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.36% 2.76 0 6 325208.31 196532 540326 318779.67 0 531708 897925 897925 0.00%
crit 47.64% 2.51 0 6 650108.59 391797 1120189 625175.51 0 1061055 1633245 1633245 0.00%

Action Details: Full Moon

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:50.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Action Priority List

    st
    [V]:5.36
  • if_expr:astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    New Moon 6271 2.5% 6.0 53.51s 311673 413161 Direct 6.0 200548 428680 313432 49.5%

Stats Details: New Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.01 5.98 0.00 0.00 0.00 0.7545 0.0000 1874512.56 1874512.56 0.00% 413161.24 413161.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 50.51% 3.02 0 7 200548.23 98655 314340 197663.31 0 293186 605732 605732 0.00%
crit 49.49% 2.96 0 7 428680.48 201257 641254 424966.45 0 617520 1268780 1268780 0.00%

Action Details: New Moon

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Action Priority List

    st
    [T]:6.03
  • if_expr:astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Half Moon 8351 3.4% 5.7 57.79s 439431 361733 Direct 5.7 282179 571901 441974 55.2%

Stats Details: Half Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.69 5.66 0.00 0.00 0.00 1.2149 0.0000 2501381.60 2501381.60 0.00% 361732.70 361732.70
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 44.84% 2.54 0 7 282178.99 139980 457594 271366.88 0 429594 716155 716155 0.00%
crit 55.16% 3.12 0 7 571901.47 285559 913993 564343.57 0 874508 1785227 1785227 0.00%

Action Details: Half Moon

  • id:274282
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:24.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.875000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274282
  • name:Half Moon
  • school:astral
  • tooltip:
  • description:Deals {$s1=0} Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates {$=}{{$m3=240}/10} Astral Power.|r

Action Priority List

    st
    [U]:5.72
  • if_expr:astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (21421) 0.0% (8.7%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 7992 3.3% 95.5 3.12s 25083 0 Direct 95.2 16619 35534 25152 45.1%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 95.49 95.23 0.00 0.00 0.00 0.0000 0.0000 2395267.57 2395267.57 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.89% 52.27 23 88 16618.73 9981 33149 16623.96 14815 18990 868644 868644 0.00%
crit 45.11% 42.96 20 75 35533.78 20362 67624 35549.83 30047 41195 1526624 1526624 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 8006 3.3% 95.8 3.12s 25054 0 Direct 95.5 16587 35502 25124 45.1%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 95.78 95.51 0.00 0.00 0.00 0.0000 0.0000 2399597.08 2399597.08 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.87% 52.41 24 91 16587.34 9912 33149 16591.91 14444 19101 869304 869304 0.00%
crit 45.13% 43.10 18 73 35502.15 20220 67624 35515.15 30371 41681 1530293 1530293 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 5422 2.2% 6.4 47.54s 255023 0 Direct 6.4 168094 359889 255758 45.7%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.37 6.36 0.00 0.00 0.00 0.0000 0.0000 1625374.57 1625374.57 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.29% 3.45 0 8 168094.21 100083 329467 166614.67 0 313372 579981 579981 0.00%
crit 45.71% 2.90 0 8 359889.37 204170 682835 351429.86 0 613670 1045394 1045394 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 5899 2.4% 26.0 11.45s 68044 75571 Direct 27.0 45686 93101 65529 41.8%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.05 27.05 0.00 0.00 0.00 0.9004 0.0000 1772302.10 1772302.10 0.00% 75571.47 75571.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.15% 15.73 6 29 45685.65 20476 90430 45687.96 35973 53472 718548 718548 0.00%
crit 41.85% 11.32 1 23 93100.85 41772 185584 93089.15 64762 112179 1053754 1053754 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    st
    [L]:1.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
    st
    [P]:25.10
  • if_expr:variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Warrior of Elune2024251-1.000Spell DataNo-stacks
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Starsurge 78377 (105855) 31.9% (43.1%) 116.4 2.56s 272308 277615 Direct 116.1 (154.3) 136603 288385 202056 43.1% (43.7%)

Stats Details: Starsurge

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 116.37 116.11 0.00 0.00 0.00 0.9809 0.0000 23461390.32 23461390.32 0.00% 277615.06 277615.06
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.88% 66.04 39 96 136602.98 91245 263509 136672.78 124725 150754 9021323 9021323 0.00%
crit 43.12% 50.07 26 78 288385.23 186139 537559 288595.22 259326 329487 14440067 14440067 0.00%

Action Details: Starsurge

  • id:78674
  • school:astral
  • range:45.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:36.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.455000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.18

Spelldata

  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$s1=0} Astral damage.

Action Priority List

    st
    [Q]:83.36
  • if_expr:variable.starsurge_condition1
    st
    [X]:33.01
  • if_expr:variable.starsurge_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Flat Cost Incarnation: Chosen of Elune1025603-8.000Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Goldrinn's Fang 27478 11.2% 38.4 7.64s 214119 0 Direct 38.2 143694 301370 215142 45.3%

Stats Details: Goldrinns Fang

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.42 38.24 0.00 0.00 0.00 0.0000 0.0000 8226148.20 8226148.20 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.69% 20.91 5 40 143694.31 95410 275540 143773.28 120890 177817 3004714 3004714 0.00%
crit 45.31% 17.33 3 35 301370.38 194637 562101 301575.56 246355 380271 5221435 5221435 0.00%

Action Details: Goldrinns Fang

  • id:394047
  • school:astral
  • range:60.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.852000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10

Spelldata

  • id:394047
  • name:Goldrinn's Fang
  • school:astral
  • tooltip:Deals {$m1=0} Arcane damage.
  • description:Deals {$m1=0} Arcane damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountPower of Goldrinn3940462PCT1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Friend of the Fae39408310.100Spell Data
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Incarnation: Chosen of Elune10256020.100Spell Data
Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Dot / Debuff on Target Moonfire16481250.283Mastery
Sunfire16481550.283Mastery
Waning Twilight39395710.100
Sunfire 12897 5.3% 17.4 18.05s 222261 230449 Direct 17.4 9216 19023 13084 39.4%
Periodic 313.2 8220 16997 11616 38.7% 99.8%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.39 17.39 313.21 313.21 16.39 0.9645 0.9561 3865789.99 3865789.99 0.00% 12224.00 230449.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 60.57% 10.53 3 19 9216.48 5438 16767 9208.20 7479 11152 97096 97096 0.00%
crit 39.43% 6.86 0 15 19023.21 11094 33428 19017.43 0 27178 130467 130467 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 61.31% 192.02 131 268 8220.03 1808 14587 8219.32 7767 8777 1578396 1578396 0.00%
crit 38.69% 121.19 74 173 16996.94 439 29758 16998.47 15995 18381 2059831 2059831 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    st
    [J]:1.44
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [R]:15.95
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (4123) 0.0% (1.7%) 8.6 32.24s 144237 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.57 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 2147 0.9% 8.6 32.24s 75111 0 Direct 8.6 57826 117851 75117 28.8%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.57 8.57 0.00 0.00 0.00 0.0000 0.0000 644013.23 644013.23 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.20% 6.11 0 18 57825.79 57075 66076 57782.15 0 66076 353029 353029 0.00%
crit 28.80% 2.47 0 11 117851.18 116432 134796 108954.78 0 134796 290984 290984 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:51134.41
  • base_dd_max:51134.41
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 1976 0.8% 16.6 15.63s 35696 0 Direct 16.6 27497 56057 35696 28.7%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.60 16.60 0.00 0.00 0.00 0.0000 0.0000 592696.64 592696.64 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.29% 11.84 1 31 27497.05 27158 31441 27496.45 27158 30064 325500 325500 0.00%
crit 28.71% 4.77 0 20 56056.91 55402 64140 55447.54 0 64140 267196 267196 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24330.91
  • base_dd_max:24330.91
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 23002 9.4% 117.3 2.51s 58750 62445 Direct 116.8 38700 81323 58971 47.6%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.28 116.84 0.00 0.00 0.00 0.9408 0.0000 6890258.63 6890258.63 0.00% 62444.57 62444.57
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.44% 61.27 34 98 38700.20 15081 126908 38704.80 33680 44614 2371326 2371326 0.00%
crit 47.56% 55.57 29 85 81323.31 30766 253637 81353.51 70179 94042 4518933 4518933 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    st
    [M]:0.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
    st
    [Y]:115.59

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.400Spell Data
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
Base
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Base
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Base
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Base
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 190.53s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    st
    [N]:2.00
  • if_expr:variable.cd_condition_st

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.7 64.85s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.66 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Base
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:70932.17
  • base_dd_max:70932.17
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.31s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Base
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.74
Elemental Potion of Ultimate Power 1.5 307.00s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.47
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
Warrior of Elune 6.1 49.05s

Stats Details: Warrior Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.09 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Warrior Of Elune

  • id:202425
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202425
  • name:Warrior of Elune
  • school:arcane
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.

Action Priority List

    st
    [O]:6.09
  • if_expr:variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 8.8 1.5 35.9s 33.6s 8.5s 25.03% 29.03% 1.5 (7.1) 8.6

Buff Details

  • buff initial source:Base
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 50.7s
  • trigger_min/max:2.9s / 50.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:22.04% / 27.79%

Stack Uptimes

  • balance_of_all_things_arcane_1:2.88%
  • balance_of_all_things_arcane_2:2.92%
  • balance_of_all_things_arcane_3:3.00%
  • balance_of_all_things_arcane_4:3.03%
  • balance_of_all_things_arcane_5:3.06%
  • balance_of_all_things_arcane_6:3.30%
  • balance_of_all_things_arcane_7:3.42%
  • balance_of_all_things_arcane_8:3.42%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 18.3 3.2 16.8s 14.2s 8.3s 50.62% 54.65% 3.2 (18.8) 17.7

Buff Details

  • buff initial source:Base
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.1s
  • trigger_min/max:0.0s / 40.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.2s
  • uptime_min/max:45.54% / 54.22%

Stack Uptimes

  • balance_of_all_things_nature_1:5.91%
  • balance_of_all_things_nature_2:5.99%
  • balance_of_all_things_nature_3:6.11%
  • balance_of_all_things_nature_4:6.21%
  • balance_of_all_things_nature_5:6.35%
  • balance_of_all_things_nature_6:6.50%
  • balance_of_all_things_nature_7:6.66%
  • balance_of_all_things_nature_8:6.90%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 7.2 62.7 44.4s 4.2s 20.2s 48.49% 0.00% 34.9 (34.9) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.3s
  • trigger_min/max:0.8s / 42.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:42.97% / 55.00%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:4.65%
  • balance_t31_4pc_buff_lunar_2:4.34%
  • balance_t31_4pc_buff_lunar_3:4.93%
  • balance_t31_4pc_buff_lunar_4:5.62%
  • balance_t31_4pc_buff_lunar_5:28.96%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 14.1 102.3 21.9s 2.6s 19.2s 90.46% 0.00% 48.5 (48.5) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 58.1s
  • trigger_min/max:0.8s / 11.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:87.11% / 93.28%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:7.61%
  • balance_t31_4pc_buff_solar_2:11.60%
  • balance_t31_4pc_buff_solar_3:16.03%
  • balance_t31_4pc_buff_solar_4:11.69%
  • balance_t31_4pc_buff_solar_5:43.53%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 70.4s 70.4s 10.8s 10.04% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 348.7s
  • trigger_min/max:12.0s / 348.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 41.11%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.90%
  • best_friends_with_aerwynn_2:0.90%
  • best_friends_with_aerwynn_3:0.90%
  • best_friends_with_aerwynn_4:0.91%
  • best_friends_with_aerwynn_5:0.91%
  • best_friends_with_aerwynn_6:0.91%
  • best_friends_with_aerwynn_7:0.92%
  • best_friends_with_aerwynn_8:0.92%
  • best_friends_with_aerwynn_9:0.92%
  • best_friends_with_aerwynn_10:0.92%
  • best_friends_with_aerwynn_11:0.93%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 114.1s 70.4s 45.7s 33.39% 0.00% 69.5 (69.5) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 352.3s
  • trigger_min/max:12.0s / 348.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 340.8s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.39%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.1s 70.1s 10.8s 9.99% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 340.7s
  • trigger_min/max:12.0s / 340.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 36.87%

Stack Uptimes

  • best_friends_with_pip_1:0.89%
  • best_friends_with_pip_2:0.90%
  • best_friends_with_pip_3:0.90%
  • best_friends_with_pip_4:0.90%
  • best_friends_with_pip_5:0.91%
  • best_friends_with_pip_6:0.91%
  • best_friends_with_pip_7:0.91%
  • best_friends_with_pip_8:0.91%
  • best_friends_with_pip_9:0.92%
  • best_friends_with_pip_10:0.92%
  • best_friends_with_pip_11:0.92%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 114.5s 70.1s 45.8s 33.25% 0.00% 69.3 (69.3) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 345.8s
  • trigger_min/max:12.0s / 340.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 308.4s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.25%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 70.8s 70.8s 10.8s 10.03% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 341.3s
  • trigger_min/max:12.0s / 341.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 37.36%

Stack Uptimes

  • best_friends_with_urctos_1:0.90%
  • best_friends_with_urctos_2:0.90%
  • best_friends_with_urctos_3:0.90%
  • best_friends_with_urctos_4:0.90%
  • best_friends_with_urctos_5:0.91%
  • best_friends_with_urctos_6:0.91%
  • best_friends_with_urctos_7:0.91%
  • best_friends_with_urctos_8:0.92%
  • best_friends_with_urctos_9:0.92%
  • best_friends_with_urctos_10:0.92%
  • best_friends_with_urctos_11:0.93%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 114.6s 70.8s 45.6s 33.36% 0.00% 69.7 (69.7) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.9s / 350.6s
  • trigger_min/max:12.0s / 341.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 321.9s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.36%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 62.0s 58.5s 50.1s 80.18% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 349.0s
  • trigger_min/max:15.0s / 315.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 359.4s
  • uptime_min/max:47.61% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.18%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Denizen of the Dream 8.6 0.0 44.9s 31.7s 41.4s 57.65% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:Base
  • cooldown name:buff_denizen_of_the_dream
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 277.8s
  • trigger_min/max:0.0s / 152.2s
  • trigger_pct:99.98%
  • duration_min/max:0.0s / 240.1s
  • uptime_min/max:21.15% / 96.77%

Stack Uptimes

  • denizen_of_the_dream_1:38.59%
  • denizen_of_the_dream_2:14.64%
  • denizen_of_the_dream_3:3.65%
  • denizen_of_the_dream_4:0.67%
  • denizen_of_the_dream_5:0.10%
  • denizen_of_the_dream_6:0.01%
  • denizen_of_the_dream_7:0.00%
  • denizen_of_the_dream_8:0.01%

Spelldata

  • id:394076
  • name:Denizen of the Dream
  • tooltip:
  • description:{$@spelldesc394065=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Dreamstate 15.3 0.6 20.2s 20.6s 3.0s 15.58% 20.82% 0.6 (1.2) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 56.3s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.7s
  • uptime_min/max:8.72% / 26.71%

Stack Uptimes

  • dreamstate_1:9.58%
  • dreamstate_2:6.00%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 7.2 1.0 44.9s 44.4s 20.6s 49.52% 52.69% 1.0 (1.0) 6.8

Buff Details

  • buff initial source:Base
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.3s
  • trigger_min/max:12.0s / 90.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:44.09% / 56.12%

Stack Uptimes

  • eclipse_lunar_1:49.52%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 13.9 5.5 22.3s 15.7s 20.1s 93.00% 96.19% 5.5 (5.5) 12.9

Buff Details

  • buff initial source:Base
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 70.4s
  • trigger_min/max:0.0s / 55.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.0s
  • uptime_min/max:90.48% / 95.09%

Stack Uptimes

  • eclipse_solar_1:93.00%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 307.0s 307.0s 27.4s 13.22% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.3s
  • trigger_min/max:300.0s / 328.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.87% / 18.02%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.22%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Friend of the Fae 5.3 3.4 55.3s 31.7s 25.0s 43.78% 43.73% 3.4 (3.4) 4.8

Buff Details

  • buff initial source:Base
  • cooldown name:buff_friend_of_the_fae
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 198.2s
  • trigger_min/max:0.0s / 152.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 138.6s
  • uptime_min/max:14.10% / 83.17%

Stack Uptimes

  • friend_of_the_fae_1:43.78%

Spelldata

  • id:394083
  • name:Friend of the Fae
  • tooltip:Arcane and Nature damage increased by {$=}w1%.
  • description:{$@spelldesc394081=When a Faerie Dragon is summoned, your spells deal {$394083m1=10}% increased damage for {$394083d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 7.2 0.0 44.4s 44.4s 20.3s 48.61% 51.43% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:Base
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.3s
  • trigger_min/max:12.0s / 90.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:43.34% / 55.00%

Stack Uptimes

  • incarnation_chosen_of_elune_1:48.61%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.6 0.0 99.3s 99.3s 19.5s 23.32% 0.00% 0.0 (0.0) 3.2

Buff Details

  • buff initial source:Base
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:65.76

Trigger Details

  • interval_min/max:90.0s / 124.4s
  • trigger_min/max:90.0s / 124.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.38% / 26.30%

Stack Uptimes

  • kindled_soul_5:1.11%
  • kindled_soul_10:1.14%
  • kindled_soul_15:1.15%
  • kindled_soul_20:1.15%
  • kindled_soul_25:1.15%
  • kindled_soul_30:1.15%
  • kindled_soul_35:1.16%
  • kindled_soul_40:1.16%
  • kindled_soul_45:1.16%
  • kindled_soul_50:1.17%
  • kindled_soul_55:1.17%
  • kindled_soul_60:1.17%
  • kindled_soul_65:1.17%
  • kindled_soul_70:1.18%
  • kindled_soul_75:1.18%
  • kindled_soul_80:1.18%
  • kindled_soul_85:1.19%
  • kindled_soul_90:1.19%
  • kindled_soul_95:1.19%
  • kindled_soul_100:1.19%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Grace 12.9 0.0 20.5s 20.5s 5.9s 25.49% 0.00% 0.0 (0.0) 12.6

Buff Details

  • buff initial source:Base
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.8s / 70.7s
  • trigger_min/max:12.8s / 70.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:21.24% / 30.97%

Stack Uptimes

  • natures_grace_1:25.49%

Spelldata

  • id:393959
  • name:Nature's Grace
  • tooltip:Haste increased by {$s1=10}%.
  • description:{$@spelldesc393958=After an Eclipse ends, you gain {$393959s1=10}% Haste for {$393959d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Vigil 3.7 0.0 90.3s 90.3s 14.7s 18.41% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:Base
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.9s
  • trigger_min/max:90.0s / 91.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.56% / 21.04%

Stack Uptimes

  • natures_vigil_1:18.41%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.1 74.1s 68.0s 7.7s 6.36% 7.02% 0.1 (0.1) 1.3

Buff Details

  • buff initial source:Base
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 335.0s
  • trigger_min/max:0.1s / 335.0s
  • trigger_pct:15.03%
  • duration_min/max:0.0s / 29.9s
  • uptime_min/max:0.00% / 26.19%

Stack Uptimes

  • owlkin_frenzy_1:6.36%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 8.2 109.1 38.5s 38.5s 34.5s 94.07% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:24.0s / 50.5s
  • trigger_min/max:24.0s / 50.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.4s
  • uptime_min/max:90.79% / 96.77%

Stack Uptimes

  • primordial_arcanic_pulsar_4:4.98%
  • primordial_arcanic_pulsar_8:5.32%
  • primordial_arcanic_pulsar_12:6.70%
  • primordial_arcanic_pulsar_16:6.78%
  • primordial_arcanic_pulsar_20:6.61%
  • primordial_arcanic_pulsar_24:6.09%
  • primordial_arcanic_pulsar_28:7.04%
  • primordial_arcanic_pulsar_32:8.33%
  • primordial_arcanic_pulsar_36:6.59%
  • primordial_arcanic_pulsar_40:7.19%
  • primordial_arcanic_pulsar_44:7.27%
  • primordial_arcanic_pulsar_48:6.85%
  • primordial_arcanic_pulsar_52:7.66%
  • primordial_arcanic_pulsar_56:6.65%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 18.6 3.8 16.6s 14.2s 6.4s 39.63% 39.83% 3.8 (3.8) 18.2

Buff Details

  • buff initial source:Base
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 49.4s
  • trigger_min/max:0.0s / 40.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.9s
  • uptime_min/max:35.87% / 42.61%

Stack Uptimes

  • solstice_1:39.63%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 20.8 95.6 14.7s 2.6s 14.1s 97.29% 0.00% 54.5 (54.5) 7.6

Buff Details

  • buff initial source:Base
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 20.3s
  • trigger_min/max:0.8s / 11.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:94.00% / 99.07%

Stack Uptimes

  • starlord_1:9.24%
  • starlord_2:14.87%
  • starlord_3:73.18%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Wafting Devotion 4.3 1.2 61.0s 45.5s 16.5s 23.61% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 215.3s
  • trigger_min/max:0.0s / 206.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 71.7s
  • uptime_min/max:4.73% / 64.94%

Stack Uptimes

  • wafting_devotion_1:23.61%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Warrior of Elune 6.1 0.0 49.0s 49.0s 21.7s 43.99% 43.12% 0.0 (0.0) 2.3

Buff Details

  • buff initial source:Base
  • cooldown name:buff_warrior_of_elune
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:45.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 82.0s
  • trigger_min/max:45.0s / 82.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s
  • uptime_min/max:32.27% / 50.94%

Stack Uptimes

  • warrior_of_elune_1:20.60%
  • warrior_of_elune_2:5.15%
  • warrior_of_elune_3:18.24%

Spelldata

  • id:202425
  • name:Warrior of Elune
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.
  • max_stacks:0
  • duration:25.00
  • cooldown:45.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:Base
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:Base
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:Base
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:Base
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:Base
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:Base
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:Base
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Denizen of the Dream 8.6 2.0 22.0 31.7s 0.0s 152.2s
Primordial Arcanic Pulsar 7.2 6.0 9.0 40.2s 29.0s 50.2s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.08% 0.00% 1.47% 0.4s 0.0s 3.5s
Astral Smolder 79.17% 57.31% 94.25% 15.5s 0.0s 130.0s
Incarnation (Total) 48.61% 43.34% 55.00% 20.3s 0.0s 54.0s
Incarnation (Pulsar) 28.36% 26.29% 30.89% 11.7s 0.0s 12.0s
Lunar Eclipse Only 0.91% 0.72% 1.12% 2.7s 2.5s 2.7s
Solar Eclipse Only 44.39% 36.15% 50.66% 10.9s 0.0s 15.0s
No Eclipse 6.07% 3.76% 8.48% 1.4s 0.0s 3.6s
Friend of the Fae 43.78% 14.10% 83.17% 25.0s 0.0s 138.6s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Warrior of Elune7.5840.00036.99646.27125.86172.734
Full Moon
New Moon
Half Moon
0.3420.00025.4835.8215.29931.120

Eclipse Utilization

NoneSolarLunarBoth
Wrath5.144.5%57.4649.8%0.000.0%52.6945.7%
Starfire25.0492.6%0.000.0%2.007.4%0.010.0%
Starsurge0.000.0%46.5540.0%0.000.0%69.8260.0%
New Moon0.030.5%0.264.2%0.000.0%5.7395.3%
Half Moon0.000.0%0.356.1%0.000.0%5.3593.9%
Full Moon0.201.7%3.1226.7%0.080.7%8.2870.9%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Base
Nature's BalanceAstral Power99.49198.885.43%2.000.100.05%
Full MoonAstral Power5.30264.877.23%49.930.380.14%
Half MoonAstral Power5.69136.633.73%24.000.000.00%
MoonfireAstral Power14.3586.002.35%6.000.070.08%
New MoonAstral Power6.0172.171.97%12.000.000.00%
Orbit BreakerAstral Power6.37190.085.19%29.821.130.59%
Shooting Stars (Moonfire)Astral Power95.49190.785.21%2.000.200.11%
Shooting Stars (Sunfire)Astral Power95.78191.355.22%2.000.210.11%
StarfireAstral Power27.05396.6010.82%14.662.960.74%
SunfireAstral Power17.39104.342.85%6.000.010.01%
WrathAstral Power117.281833.6750.03%15.630.000.00%
Usage Type Count Total Tot% Avg RPE APR
Base
StarsurgeAstral Power 116.543677.42100.00%31.5531.608616.79
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 896660.0 4183.17 4959.07 1761793.8 663905.0 -606706.4 896660.0
Astral Power 70.0 12.22 12.24 5.1 23.5 0.0 100.0

Statistics & Data Analysis

Fight Length
Base Fight Length
Count 21168
Mean 299.98
Minimum 240.01
Maximum 360.00
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 34.7301
5th Percentile 246.06
95th Percentile 353.85
( 95th Percentile - 5th Percentile ) 107.79
Mean Distribution
Standard Deviation 0.2387
95.00% Confidence Interval ( 299.51 - 300.45 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 515
0.1% Error 51491
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1030
DPS
Base Damage Per Second
Count 21168
Mean 245413.96
Minimum 214708.90
Maximum 288517.21
Spread ( max - min ) 73808.31
Range [ ( max - min ) / 2 * 100% ] 15.04%
Standard Deviation 9087.1665
5th Percentile 231068.56
95th Percentile 260840.81
( 95th Percentile - 5th Percentile ) 29772.25
Mean Distribution
Standard Deviation 62.4581
95.00% Confidence Interval ( 245291.55 - 245536.38 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5267
0.1 Scale Factor Error with Delta=300 704922
0.05 Scale Factor Error with Delta=300 2819686
0.01 Scale Factor Error with Delta=300 70492132
Priority Target DPS
Base Priority Target Damage Per Second
Count 21168
Mean 245413.96
Minimum 214708.90
Maximum 288517.21
Spread ( max - min ) 73808.31
Range [ ( max - min ) / 2 * 100% ] 15.04%
Standard Deviation 9087.1665
5th Percentile 231068.56
95th Percentile 260840.81
( 95th Percentile - 5th Percentile ) 29772.25
Mean Distribution
Standard Deviation 62.4581
95.00% Confidence Interval ( 245291.55 - 245536.38 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5267
0.1 Scale Factor Error with Delta=300 704922
0.05 Scale Factor Error with Delta=300 2819686
0.01 Scale Factor Error with Delta=300 70492132
DPS(e)
Base Damage Per Second (Effective)
Count 21168
Mean 245413.96
Minimum 214708.90
Maximum 288517.21
Spread ( max - min ) 73808.31
Range [ ( max - min ) / 2 * 100% ] 15.04%
Damage
Base Damage
Count 21168
Mean 71188780.48
Minimum 53868754.24
Maximum 93198633.29
Spread ( max - min ) 39329879.06
Range [ ( max - min ) / 2 * 100% ] 27.62%
DTPS
Base Damage Taken Per Second
Count 21168
Mean 4958.50
Minimum 1186.30
Maximum 9568.03
Spread ( max - min ) 8381.73
Range [ ( max - min ) / 2 * 100% ] 84.52%
HPS
Base Healing Per Second
Count 21168
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Base Healing Per Second (Effective)
Count 21168
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Base Heal
Count 21168
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Base Healing Taken Per Second
Count 21168
Mean 4170.72
Minimum 914.61
Maximum 8341.75
Spread ( max - min ) 7427.14
Range [ ( max - min ) / 2 * 100% ] 89.04%
TMI
Base Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
BaseTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Base Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.47 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.59 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.74 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.st
# count action,conditions
J 1.44 sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
K 1.25 moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
0.00 starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
0.00 starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
L 1.00 starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
M 0.00 wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
0.00 celestial_alignment,if=variable.cd_condition_st
N 2.00 incarnation,if=variable.cd_condition_st
0.00 variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
0.00 variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
O 6.09 warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
P 25.10 starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
0.00 wrath,if=variable.enter_eclipse
0.00 variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
0.00 convoke_the_spirits,if=variable.convoke_condition
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+55
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 starfall,if=buff.starweavers_warp.up
0.00 variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
Q 83.36 starsurge,if=variable.starsurge_condition1
R 15.95 sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
S 13.09 moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
T 6.03 new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
U 5.72 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
V 5.36 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
W 12.19 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
X 33.01 starsurge,if=variable.starsurge_condition2
Y 115.59 wrath
Z 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFJKLNDEQQQTQUQQVYXYRXYXYSYQQQYYYYXYYOXTYXQYYRWQQYQYYYYXSYXYXYXPPYQQRYQYYYYXYXSPPQYQRUQYOQQVYXXYPPQQYSQYRYYYFXXYYPPQQYYQYYRSYXYXETUQQQQYOYYXYXPPQRYYSQQYYQYYXYPPRYWQQYQYYYSYXQYXYYQQQRYOYPPQQVXYSYQQRYQYPFPQYYYYWQQYQTUQRSQYYXWYEPNQQVQQQYYYRTYXSYWQQQYYYYYXYOXYYXRYQQQUYSYXYXXYYPPWQQRQYYXYYXYYPPQQKQRYYYFYOXQVTWQQYQYSYRPPQQYYYWQQYYQYYXPPQRSYYQYQYYQYYYPOPXEURWQQQVXSXXDYPPQYYWQQYRQYYYYXPPSWQQTYQUXYQRYQ

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask Base 50.0/100: 50% astral_power
Pre precombat 1 food Base 50.0/100: 50% astral_power corrupting_rage
Pre precombat 2 augmentation Base 50.0/100: 50% astral_power corrupting_rage
Pre precombat 4 no_cd_talent Base 50.0/100: 50% astral_power corrupting_rage
Pre precombat 5 on_use_trinket Base 50.0/100: 50% astral_power corrupting_rage
Pre precombat 6 on_use_trinket Base 50.0/100: 50% astral_power corrupting_rage
Pre precombat 7 on_use_trinket Base 50.0/100: 50% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 60.0/100: 60% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil Base 50.0/100: 50% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.000 st J sunfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.930 st K moonfire Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:01.859 st L starfire Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, corrupting_rage
0:02.695 st N incarnation_chosen_of_elune Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, corrupting_rage
0:02.695 default D potion Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), corrupting_rage
0:02.695 default E use_items Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power
0:02.695 st Q starsurge Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:03.541 st Q starsurge Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:04.353 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:05.135 st T new_moon Fluffy_Pillow 16.0/100: 16% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:05.889 st Q starsurge Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:06.643 st U half_moon Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:07.647 st Q starsurge Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
0:08.401 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:09.156 st V full_moon Fluffy_Pillow 14.0/100: 14% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
0:10.662 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:11.416 st X starsurge Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:12.170 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:12.924 st R sunfire Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:13.678 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:14.432 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:15.185 st X starsurge Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:15.941 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:16.695 st S moonfire Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.450 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:18.203 st Q starsurge Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:19.048 st Q starsurge Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:19.860 st Q starsurge Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:20.644 st Y wrath Fluffy_Pillow 4.0/100: 4% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:21.397 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:22.150 st Y wrath Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(5)
0:22.904 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:23.657 st X starsurge Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:24.412 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:25.165 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:25.920 st O warrior_of_elune Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:25.920 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:26.675 st T new_moon Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:27.431 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:28.184 st X starsurge Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:28.939 st Q starsurge Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:29.693 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:30.447 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:31.200 st R sunfire Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:31.955 st W cancel_buff Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:31.955 st Q starsurge Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:32.800 st Q starsurge Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5)
0:33.612 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5)
0:34.392 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static
0:35.174 st Y wrath Fluffy_Pillow 12.0/100: 12% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static
0:35.931 st Y wrath Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static
0:36.685 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static
0:37.439 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, corrupting_rage
0:38.194 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, corrupting_rage
0:38.946 st S moonfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, corrupting_rage
0:39.700 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, corrupting_rage
0:40.456 st X starsurge Fluffy_Pillow 74.0/100: 74% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, corrupting_rage
0:41.434 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, corrupting_rage
0:42.412 st X starsurge Fluffy_Pillow 64.0/100: 64% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, corrupting_rage
0:43.391 st Y wrath Fluffy_Pillow 38.0/100: 38% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, corrupting_rage
0:44.370 st X starsurge Fluffy_Pillow 56.0/100: 56% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn, best_friends_with_aerwynn_static, corrupting_rage
0:45.349 st P starfire Fluffy_Pillow 30.0/100: 30% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn_static, corrupting_rage
0:46.103 st P starfire Fluffy_Pillow 46.8/100: 47% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage
0:46.857 st Y wrath Fluffy_Pillow 65.6/100: 66% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune(2), best_friends_with_aerwynn_static, corrupting_rage
0:47.836 st Q starsurge Fluffy_Pillow 83.6/100: 84% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, warrior_of_elune(2), best_friends_with_aerwynn_static, corrupting_rage
0:48.932 st Q starsurge Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord, warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, corrupting_rage
0:49.987 st R sunfire Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, corrupting_rage
0:51.002 st Y wrath Fluffy_Pillow 25.6/100: 26% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, corrupting_rage
0:52.119 st Q starsurge Fluffy_Pillow 45.6/100: 46% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, corrupting_rage
0:53.236 st Y wrath Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, corrupting_rage
0:54.314 st Y wrath Fluffy_Pillow 29.6/100: 30% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, corrupting_rage
0:55.389 st Y wrath Fluffy_Pillow 45.6/100: 46% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, corrupting_rage
0:56.468 st Y wrath Fluffy_Pillow 61.6/100: 62% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, corrupting_rage
0:57.546 st X starsurge Fluffy_Pillow 79.6/100: 80% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, corrupting_rage
0:58.622 st Y wrath Fluffy_Pillow 45.6/100: 46% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, corrupting_rage
0:59.700 st X starsurge Fluffy_Pillow 61.6/100: 62% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, corrupting_rage
1:00.776 st S moonfire Fluffy_Pillow 27.6/100: 28% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, corrupting_rage
1:01.853 st P starfire Fluffy_Pillow 33.6/100: 34% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), dreamstate, best_friends_with_aerwynn_static, corrupting_rage
1:02.608 st P starfire Fluffy_Pillow 45.6/100: 46% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
1:03.489 st Q starsurge Fluffy_Pillow 59.6/100: 60% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, best_friends_with_aerwynn_static, corrupting_rage
1:04.586 st Y wrath Fluffy_Pillow 25.6/100: 26% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, corrupting_rage
1:05.640 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, corrupting_rage
1:06.695 st R sunfire Fluffy_Pillow 11.6/100: 12% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, corrupting_rage
1:07.619 st U half_moon Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, corrupting_rage
1:08.973 st Q starsurge Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
1:09.916 st Y wrath Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
1:10.826 st O warrior_of_elune Fluffy_Pillow 67.6/100: 68% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
1:10.920 st Q starsurge Fluffy_Pillow 67.6/100: 68% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
1:11.830 st Q starsurge Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
1:12.739 st V full_moon Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
1:14.552 st Y wrath Fluffy_Pillow 67.6/100: 68% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
1:15.462 st X starsurge Fluffy_Pillow 87.6/100: 88% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
1:16.373 st X starsurge Fluffy_Pillow 61.6/100: 62% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
1:17.282 st Y wrath Fluffy_Pillow 33.6/100: 34% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
1:18.189 st P starfire Fluffy_Pillow 45.6/100: 46% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
1:18.944 st P starfire Fluffy_Pillow 62.4/100: 62% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), warrior_of_elune(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
1:19.700 st Q starsurge Fluffy_Pillow 81.2/100: 81% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, warrior_of_elune, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
1:20.717 st Q starsurge Fluffy_Pillow 47.2/100: 47% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
1:21.696 st Y wrath Fluffy_Pillow 15.2/100: 15% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
1:22.638 st S moonfire Fluffy_Pillow 33.2/100: 33% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
1:23.581 st Q starsurge Fluffy_Pillow 39.2/100: 39% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
1:24.523 st Y wrath Fluffy_Pillow 7.2/100: 7% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, corrupting_rage
1:25.601 st R sunfire Fluffy_Pillow 23.2/100: 23% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, corrupting_rage
1:26.679 st Y wrath Fluffy_Pillow 29.2/100: 29% astral_power balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, corrupting_rage
1:27.758 st Y wrath Fluffy_Pillow 47.2/100: 47% astral_power denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, corrupting_rage
1:28.835 st Y wrath Fluffy_Pillow 65.2/100: 65% astral_power denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, corrupting_rage
1:29.911 default F natures_vigil Base 85.2/100: 85% astral_power denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, corrupting_rage
1:30.000 st X starsurge Fluffy_Pillow 87.2/100: 87% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, corrupting_rage
1:31.078 st X starsurge Fluffy_Pillow 51.2/100: 51% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, corrupting_rage
1:32.155 st Y wrath Fluffy_Pillow 15.2/100: 15% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, corrupting_rage
1:33.233 st Y wrath Fluffy_Pillow 35.2/100: 35% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, corrupting_rage
1:34.310 st P starfire Fluffy_Pillow 47.2/100: 47% astral_power natures_vigil, denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, dreamstate, best_friends_with_aerwynn_static, corrupting_rage
1:35.063 st P starfire Fluffy_Pillow 64.0/100: 64% astral_power natures_vigil, denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(40), best_friends_with_aerwynn_static, corrupting_rage
1:36.050 st Q starsurge Fluffy_Pillow 78.0/100: 78% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, best_friends_with_aerwynn_static, corrupting_rage
1:37.148 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power natures_vigil, balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, corrupting_rage
1:38.204 st Y wrath Fluffy_Pillow 8.0/100: 8% astral_power natures_vigil, balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, corrupting_rage
1:39.220 st Y wrath Fluffy_Pillow 28.0/100: 28% astral_power natures_vigil, balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, corrupting_rage
1:40.234 st Q starsurge Fluffy_Pillow 48.0/100: 48% astral_power natures_vigil, balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, corrupting_rage
1:41.351 st Y wrath Fluffy_Pillow 14.0/100: 14% astral_power natures_vigil, balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage
1:42.429 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power natures_vigil, balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage
1:43.507 st R sunfire Fluffy_Pillow 50.0/100: 50% astral_power natures_vigil, balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage
1:44.585 st S moonfire Fluffy_Pillow 58.0/100: 58% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage
1:45.660 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage
1:46.739 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage
1:47.816 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:48.816 st X starsurge Fluffy_Pillow 68.0/100: 68% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:49.819 default E use_items Fluffy_Pillow 32.0/100: 32% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_urctos(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
1:49.819 st T new_moon Fluffy_Pillow 32.0/100: 32% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_urctos(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(100)
1:50.572 st U half_moon Fluffy_Pillow 44.0/100: 44% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(100)
1:51.782 st Q starsurge Fluffy_Pillow 76.0/100: 76% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(95)
1:52.799 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(90)
1:53.777 st Q starsurge Fluffy_Pillow 56.0/100: 56% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(11), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(85)
1:54.721 st Q starsurge Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(10), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(80)
1:55.630 st Y wrath Fluffy_Pillow 6.0/100: 6% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(75)
1:56.539 st O warrior_of_elune Fluffy_Pillow 24.0/100: 24% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(70)
1:56.539 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(70)
1:57.448 st Y wrath Fluffy_Pillow 42.0/100: 42% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(8), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(65)
1:58.357 st X starsurge Fluffy_Pillow 58.0/100: 58% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(7), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(60)
1:59.268 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(6), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(55)
2:00.176 st X starsurge Fluffy_Pillow 48.0/100: 48% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(50)
2:01.085 st P starfire Fluffy_Pillow 22.0/100: 22% astral_power natures_grace, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(45)
2:01.839 st P starfire Fluffy_Pillow 40.8/100: 41% astral_power natures_grace, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(2), best_friends_with_pip(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(40)
2:02.592 st Q starsurge Fluffy_Pillow 59.6/100: 60% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_pip(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(40)
2:03.501 st R sunfire Fluffy_Pillow 29.6/100: 30% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(35)
2:04.480 st Y wrath Fluffy_Pillow 39.6/100: 40% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip, best_friends_with_pip_static, corrupting_rage, kindled_soul(30)
2:05.460 st Y wrath Fluffy_Pillow 57.6/100: 58% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip_static, corrupting_rage, kindled_soul(25)
2:06.439 st S moonfire Fluffy_Pillow 77.6/100: 78% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip_static, corrupting_rage, kindled_soul(20)
2:07.419 st Q starsurge Fluffy_Pillow 85.6/100: 86% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(28), solstice, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip_static, corrupting_rage, kindled_soul(15)
2:08.627 st Q starsurge Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(32), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(10)
2:09.786 st Y wrath Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(5)
2:10.903 st Y wrath Fluffy_Pillow 33.6/100: 34% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
2:12.021 st Q starsurge Fluffy_Pillow 53.6/100: 54% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
2:13.136 st Y wrath Fluffy_Pillow 17.6/100: 18% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
2:14.212 st Y wrath Fluffy_Pillow 33.6/100: 34% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
2:15.290 st X starsurge Fluffy_Pillow 51.6/100: 52% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
2:16.367 st Y wrath Fluffy_Pillow 17.6/100: 18% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
2:17.444 st P starfire Fluffy_Pillow 31.6/100: 32% astral_power natures_grace, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune, dreamstate, best_friends_with_pip_static, corrupting_rage
2:18.198 st P starfire Fluffy_Pillow 50.4/100: 50% astral_power natures_grace, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_pip_static, corrupting_rage
2:19.080 st R sunfire Fluffy_Pillow 62.4/100: 62% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_pip_static, corrupting_rage
2:20.058 st Y wrath Fluffy_Pillow 70.4/100: 70% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_pip_static, corrupting_rage
2:21.037 st W cancel_buff Fluffy_Pillow 90.4/100: 90% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_pip_static, corrupting_rage
2:21.037 st Q starsurge Fluffy_Pillow 90.4/100: 90% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, best_friends_with_pip_static, corrupting_rage
2:22.134 st Q starsurge Fluffy_Pillow 56.4/100: 56% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_pip_static, corrupting_rage
2:23.190 st Y wrath Fluffy_Pillow 22.4/100: 22% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, corrupting_rage
2:24.309 st Q starsurge Fluffy_Pillow 40.4/100: 40% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, corrupting_rage
2:25.427 st Y wrath Fluffy_Pillow 6.4/100: 6% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
2:26.505 st Y wrath Fluffy_Pillow 24.4/100: 24% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
2:27.583 st Y wrath Fluffy_Pillow 44.4/100: 44% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
2:28.660 st S moonfire Fluffy_Pillow 60.4/100: 60% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
2:29.738 st Y wrath Fluffy_Pillow 66.4/100: 66% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
2:30.814 st X starsurge Fluffy_Pillow 86.4/100: 86% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
2:31.891 st Q starsurge Fluffy_Pillow 54.4/100: 54% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
2:32.871 st Y wrath Fluffy_Pillow 26.4/100: 26% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
2:33.848 st X starsurge Fluffy_Pillow 78.4/100: 78% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
2:34.827 st Y wrath Fluffy_Pillow 50.4/100: 50% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
2:35.808 st Y wrath Fluffy_Pillow 66.4/100: 66% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
2:36.787 st Q starsurge Fluffy_Pillow 88.4/100: 88% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
2:37.883 st Q starsurge Fluffy_Pillow 62.4/100: 62% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
2:38.937 st Q starsurge Fluffy_Pillow 34.4/100: 34% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
2:39.953 st R sunfire Fluffy_Pillow 8.4/100: 8% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
2:40.933 st Y wrath Fluffy_Pillow 16.4/100: 16% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
2:41.913 st O warrior_of_elune Fluffy_Pillow 34.4/100: 34% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
2:41.913 st Y wrath Fluffy_Pillow 34.4/100: 34% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
2:42.891 st P starfire Fluffy_Pillow 48.4/100: 48% astral_power denizen_of_the_dream(3), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip_static, corrupting_rage
2:43.647 st P starfire Fluffy_Pillow 65.2/100: 65% astral_power denizen_of_the_dream(3), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_pip_static, corrupting_rage
2:44.401 st Q starsurge Fluffy_Pillow 82.0/100: 82% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, corrupting_rage
2:45.380 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip_static, corrupting_rage
2:46.360 st V full_moon Fluffy_Pillow 18.0/100: 18% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, corrupting_rage
2:48.316 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(3), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, corrupting_rage
2:49.296 st Y wrath Fluffy_Pillow 44.0/100: 44% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(3), eclipse_solar, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
2:50.375 st S moonfire Fluffy_Pillow 60.0/100: 60% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(3), eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
2:51.452 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power balance_of_all_things_nature, denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
2:52.530 st Q starsurge Fluffy_Pillow 84.0/100: 84% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
2:53.738 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
2:54.898 st R sunfire Fluffy_Pillow 16.0/100: 16% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
2:56.016 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
2:57.133 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
2:58.249 st Y wrath Fluffy_Pillow 6.0/100: 6% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
2:59.328 st P starfire Fluffy_Pillow 18.0/100: 18% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune, dreamstate, best_friends_with_pip_static, corrupting_rage
3:00.082 default F natures_vigil Base 36.8/100: 37% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage
3:00.082 st P starfire Fluffy_Pillow 36.8/100: 37% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_pip_static, corrupting_rage
3:00.964 st Q starsurge Fluffy_Pillow 48.8/100: 49% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_pip_static, corrupting_rage
3:01.944 st Y wrath Fluffy_Pillow 14.8/100: 15% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_pip_static, corrupting_rage
3:02.923 st Y wrath Fluffy_Pillow 32.8/100: 33% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_pip_static, corrupting_rage
3:03.902 st Y wrath Fluffy_Pillow 50.8/100: 51% astral_power natures_vigil, balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_pip_static, corrupting_rage
3:04.883 st Y wrath Fluffy_Pillow 66.8/100: 67% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_pip_static, corrupting_rage
3:05.960 st W cancel_buff Fluffy_Pillow 84.8/100: 85% astral_power natures_vigil, balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_pip_static, corrupting_rage
3:05.960 st Q starsurge Fluffy_Pillow 84.8/100: 85% astral_power natures_vigil, balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, balance_t31_4pc_buff_solar, best_friends_with_pip_static, corrupting_rage
3:07.166 st Q starsurge Fluffy_Pillow 54.8/100: 55% astral_power natures_vigil, balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, corrupting_rage
3:08.325 st Y wrath Fluffy_Pillow 18.8/100: 19% astral_power natures_vigil, balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
3:09.443 st Q starsurge Fluffy_Pillow 38.8/100: 39% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
3:10.561 st T new_moon Fluffy_Pillow 4.8/100: 5% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
3:11.315 st U half_moon Fluffy_Pillow 16.8/100: 17% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
3:12.621 st Q starsurge Fluffy_Pillow 46.8/100: 47% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
3:13.601 st R sunfire Fluffy_Pillow 20.8/100: 21% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
3:14.580 st S moonfire Fluffy_Pillow 26.8/100: 27% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
3:15.559 st Q starsurge Fluffy_Pillow 38.8/100: 39% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
3:16.540 st Y wrath Fluffy_Pillow 10.8/100: 11% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
3:17.520 st Y wrath Fluffy_Pillow 26.8/100: 27% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage
3:18.500 st X starsurge Fluffy_Pillow 44.8/100: 45% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage
3:19.479 st W cancel_buff Fluffy_Pillow 16.8/100: 17% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage
3:19.479 st Y wrath Fluffy_Pillow 16.8/100: 17% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage
3:20.575 default E use_items Fluffy_Pillow 32.8/100: 33% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage
3:20.575 st P starfire Fluffy_Pillow 32.8/100: 33% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage, kindled_soul(100)
3:22.218 st N incarnation_chosen_of_elune Fluffy_Pillow 46.8/100: 47% astral_power natures_grace, primordial_arcanic_pulsar(12), dreamstate(2), best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage, kindled_soul(95)
3:22.218 st Q starsurge Fluffy_Pillow 46.8/100: 47% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(12), solstice, dreamstate(2), best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage, kindled_soul(95)
3:23.216 st Q starsurge Fluffy_Pillow 52.8/100: 53% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage, kindled_soul(90)
3:24.175 st V full_moon Fluffy_Pillow 26.8/100: 27% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate(2), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(85)
3:26.018 st Q starsurge Fluffy_Pillow 82.8/100: 83% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate(2), best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(75)
3:26.940 st Q starsurge Fluffy_Pillow 56.8/100: 57% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage, kindled_soul(70)
3:27.831 st Q starsurge Fluffy_Pillow 32.8/100: 33% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage, kindled_soul(65)
3:28.810 st Y wrath Fluffy_Pillow 4.8/100: 5% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, best_friends_with_urctos_static, corrupting_rage, kindled_soul(60)
3:29.566 st Y wrath Fluffy_Pillow 20.8/100: 21% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(60)
3:30.321 st Y wrath Fluffy_Pillow 38.8/100: 39% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(55)
3:31.230 st R sunfire Fluffy_Pillow 54.8/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(50)
3:32.141 st T new_moon Fluffy_Pillow 60.8/100: 61% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(45)
3:32.894 st Y wrath Fluffy_Pillow 72.8/100: 73% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(40)
3:33.803 st X starsurge Fluffy_Pillow 92.8/100: 93% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(35)
3:34.713 st S moonfire Fluffy_Pillow 64.8/100: 65% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(30)
3:35.621 st Y wrath Fluffy_Pillow 70.8/100: 71% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(25)
3:36.530 st W cancel_buff Fluffy_Pillow 88.8/100: 89% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(25)
3:36.530 st Q starsurge Fluffy_Pillow 88.8/100: 89% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(25)
3:37.548 st Q starsurge Fluffy_Pillow 60.8/100: 61% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(20)
3:38.527 st Q starsurge Fluffy_Pillow 32.8/100: 33% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(15)
3:39.469 st Y wrath Fluffy_Pillow 6.8/100: 7% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(10)
3:40.378 st Y wrath Fluffy_Pillow 22.8/100: 23% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(5)
3:41.288 st Y wrath Fluffy_Pillow 38.8/100: 39% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
3:42.198 st Y wrath Fluffy_Pillow 56.8/100: 57% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
3:43.109 st Y wrath Fluffy_Pillow 72.8/100: 73% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
3:44.021 st X starsurge Fluffy_Pillow 88.8/100: 89% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
3:44.932 st Y wrath Fluffy_Pillow 62.8/100: 63% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
3:45.842 st O warrior_of_elune Fluffy_Pillow 80.8/100: 81% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:45.842 st X starsurge Fluffy_Pillow 80.8/100: 81% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:46.820 st Y wrath Fluffy_Pillow 52.8/100: 53% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:47.799 st Y wrath Fluffy_Pillow 68.8/100: 69% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:48.777 st X starsurge Fluffy_Pillow 88.8/100: 89% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:49.756 st R sunfire Fluffy_Pillow 62.8/100: 63% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:50.736 st Y wrath Fluffy_Pillow 72.8/100: 73% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:51.717 st Q starsurge Fluffy_Pillow 94.8/100: 95% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:52.813 st Q starsurge Fluffy_Pillow 68.8/100: 69% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:53.866 st Q starsurge Fluffy_Pillow 42.8/100: 43% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:54.883 st U half_moon Fluffy_Pillow 18.8/100: 19% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:56.189 st Y wrath Fluffy_Pillow 44.8/100: 45% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:57.169 st S moonfire Fluffy_Pillow 62.8/100: 63% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:58.149 st Y wrath Fluffy_Pillow 68.8/100: 69% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:59.127 st X starsurge Fluffy_Pillow 84.8/100: 85% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage
4:00.107 st Y wrath Fluffy_Pillow 58.8/100: 59% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage
4:01.089 st X starsurge Fluffy_Pillow 74.8/100: 75% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage
4:02.068 st X starsurge Fluffy_Pillow 48.8/100: 49% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage
4:03.047 st Y wrath Fluffy_Pillow 24.8/100: 25% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage
4:04.027 st Y wrath Fluffy_Pillow 40.8/100: 41% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage
4:05.006 st P starfire Fluffy_Pillow 50.8/100: 51% astral_power natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage
4:05.761 st P starfire Fluffy_Pillow 69.6/100: 70% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage
4:06.516 st W cancel_buff Fluffy_Pillow 88.4/100: 88% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune(2), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage
4:06.516 st Q starsurge Fluffy_Pillow 88.4/100: 88% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, warrior_of_elune(2), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage
4:07.612 st Q starsurge Fluffy_Pillow 54.4/100: 54% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord, warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage
4:08.666 st R sunfire Fluffy_Pillow 24.4/100: 24% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage
4:09.683 st Q starsurge Fluffy_Pillow 36.4/100: 36% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage
4:10.697 st Y wrath Fluffy_Pillow 2.4/100: 2% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage
4:11.774 st Y wrath Fluffy_Pillow 18.4/100: 18% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage
4:12.851 st X starsurge Fluffy_Pillow 36.4/100: 36% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage
4:13.930 st Y wrath Fluffy_Pillow 0.4/100: 0% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage
4:15.008 st Y wrath Fluffy_Pillow 20.4/100: 20% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip(8), best_friends_with_pip_static, corrupting_rage
4:16.085 st X starsurge Fluffy_Pillow 36.4/100: 36% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip(7), best_friends_with_pip_static, corrupting_rage
4:17.162 st Y wrath Fluffy_Pillow 0.4/100: 0% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage
4:18.239 st Y wrath Fluffy_Pillow 18.4/100: 18% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip(5), best_friends_with_pip_static, corrupting_rage
4:19.318 st P starfire Fluffy_Pillow 34.4/100: 34% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage
4:20.932 st P starfire Fluffy_Pillow 78.4/100: 78% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), starlord(3), dreamstate, best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage
4:21.812 st Q starsurge Fluffy_Pillow 92.4/100: 92% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, dreamstate, best_friends_with_pip, best_friends_with_pip_static, corrupting_rage
4:22.909 st Q starsurge Fluffy_Pillow 60.4/100: 60% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord, balance_t31_4pc_buff_solar, dreamstate, best_friends_with_pip_static, corrupting_rage
4:23.964 st K moonfire Fluffy_Pillow 26.4/100: 26% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(2), balance_t31_4pc_buff_solar(2), dreamstate, best_friends_with_pip_static, corrupting_rage
4:24.978 st Q starsurge Fluffy_Pillow 36.4/100: 36% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(2), balance_t31_4pc_buff_solar(2), dreamstate, best_friends_with_pip_static, corrupting_rage
4:25.993 st R sunfire Fluffy_Pillow 0.4/100: 0% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), balance_t31_4pc_buff_solar(3), dreamstate, best_friends_with_pip_static, corrupting_rage
4:26.972 st Y wrath Fluffy_Pillow 8.4/100: 8% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
4:27.725 st Y wrath Fluffy_Pillow 26.4/100: 26% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
4:28.802 st Y wrath Fluffy_Pillow 42.4/100: 42% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage
4:29.879 default F natures_vigil Base 58.4/100: 58% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage
4:30.082 st Y wrath Fluffy_Pillow 60.4/100: 60% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage
4:31.160 st O warrior_of_elune Fluffy_Pillow 76.4/100: 76% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage
4:31.160 st X starsurge Fluffy_Pillow 76.4/100: 76% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage
4:32.237 st Q starsurge Fluffy_Pillow 42.4/100: 42% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage
4:33.215 st V full_moon Fluffy_Pillow 16.4/100: 16% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage
4:35.171 st T new_moon Fluffy_Pillow 66.4/100: 66% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage
4:35.925 st W cancel_buff Fluffy_Pillow 78.4/100: 78% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage
4:35.925 st Q starsurge Fluffy_Pillow 78.4/100: 78% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage
4:37.021 st Q starsurge Fluffy_Pillow 54.4/100: 54% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage
4:38.075 st Y wrath Fluffy_Pillow 26.4/100: 26% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage
4:39.091 st Q starsurge Fluffy_Pillow 46.4/100: 46% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage
4:40.106 st Y wrath Fluffy_Pillow 20.4/100: 20% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
4:41.085 st S moonfire Fluffy_Pillow 36.4/100: 36% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
4:42.065 st Y wrath Fluffy_Pillow 44.4/100: 44% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
4:43.047 st R sunfire Fluffy_Pillow 60.4/100: 60% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
4:44.025 st P starfire Fluffy_Pillow 66.4/100: 66% astral_power natures_vigil, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, corrupting_rage
4:44.778 st P starfire Fluffy_Pillow 83.2/100: 83% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, corrupting_rage
4:45.531 st Q starsurge Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), warrior_of_elune(2), best_friends_with_urctos_static, corrupting_rage
4:46.511 st Q starsurge Fluffy_Pillow 66.0/100: 66% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, corrupting_rage
4:47.491 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, corrupting_rage
4:48.469 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, corrupting_rage
4:49.449 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, corrupting_rage
4:50.524 st W cancel_buff Fluffy_Pillow 86.0/100: 86% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage
4:50.524 st Q starsurge Fluffy_Pillow 86.0/100: 86% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(24), solstice, warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage
4:51.731 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(28), starlord, warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage
4:52.891 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_urctos(9), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:53.928 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_urctos(8), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:54.966 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_urctos(7), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:56.003 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_urctos(6), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:57.003 st Y wrath Fluffy_Pillow 34.0/100: 34% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:58.003 st X starsurge Fluffy_Pillow 52.0/100: 52% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:59.002 st P starfire Fluffy_Pillow 16.0/100: 16% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
5:00.500 st P starfire Fluffy_Pillow 30.0/100: 30% astral_power natures_grace, primordial_arcanic_pulsar(40), starlord(3), dreamstate, best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
5:01.318 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), dreamstate, best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
5:02.227 st R sunfire Fluffy_Pillow 8.0/100: 8% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
5:03.137 st S moonfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
5:04.047 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
5:04.801 st Y wrath Fluffy_Pillow 42.0/100: 42% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
5:05.710 st Q starsurge Fluffy_Pillow 60.0/100: 60% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, balance_t31_4pc_buff_solar, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
5:06.729 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
5:07.806 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(48), starlord, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
5:08.883 st Y wrath Fluffy_Pillow 8.0/100: 8% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(52), starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
5:09.919 st Y wrath Fluffy_Pillow 28.0/100: 28% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
5:10.955 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
5:11.992 st Y wrath Fluffy_Pillow 8.0/100: 8% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
5:12.991 st Y wrath Fluffy_Pillow 28.0/100: 28% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage
5:14.069 st Y wrath Fluffy_Pillow 44.0/100: 44% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage
5:15.147 st P starfire Fluffy_Pillow 62.0/100: 62% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage
5:16.761 st O warrior_of_elune Fluffy_Pillow 74.0/100: 74% astral_power natures_grace, primordial_arcanic_pulsar(56), starlord(3), dreamstate(2), best_friends_with_urctos_static, corrupting_rage
5:16.761 st P starfire Fluffy_Pillow 74.0/100: 74% astral_power natures_grace, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, corrupting_rage
5:17.518 st X starsurge Fluffy_Pillow 90.8/100: 91% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), warrior_of_elune(2), dreamstate, best_friends_with_urctos_static, corrupting_rage
5:18.497 default E use_items Fluffy_Pillow 58.8/100: 59% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_urctos_static, corrupting_rage
5:18.497 st U half_moon Fluffy_Pillow 58.8/100: 59% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_urctos_static, corrupting_rage, kindled_soul(100)
5:19.682 st R sunfire Fluffy_Pillow 84.8/100: 85% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage, kindled_soul(95)
5:20.574 st W cancel_buff Fluffy_Pillow 94.8/100: 95% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage, kindled_soul(90)
5:20.574 st Q starsurge Fluffy_Pillow 94.8/100: 95% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, warrior_of_elune(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage, kindled_soul(90)
5:21.571 st Q starsurge Fluffy_Pillow 68.8/100: 69% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord, warrior_of_elune(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage, kindled_soul(85)
5:22.530 st Q starsurge Fluffy_Pillow 42.8/100: 43% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate, best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage, kindled_soul(80)
5:23.545 st V full_moon Fluffy_Pillow 14.8/100: 15% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate, best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage, kindled_soul(75)
5:25.500 st X starsurge Fluffy_Pillow 68.8/100: 69% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate, best_friends_with_urctos(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(65)
5:26.408 st S moonfire Fluffy_Pillow 42.8/100: 43% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(65)
5:27.318 st X starsurge Fluffy_Pillow 50.8/100: 51% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(60)
5:28.229 st X starsurge Fluffy_Pillow 54.8/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, best_friends_with_urctos(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(55)
5:29.137 default D potion Fluffy_Pillow 26.8/100: 27% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(50)
5:29.137 st Y wrath Fluffy_Pillow 26.8/100: 27% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
5:29.893 st P starfire Fluffy_Pillow 38.8/100: 39% astral_power natures_grace, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(2), dreamstate, best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
5:30.648 st P starfire Fluffy_Pillow 59.6/100: 60% astral_power natures_grace, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
5:31.402 st Q starsurge Fluffy_Pillow 80.4/100: 80% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
5:32.313 st Y wrath Fluffy_Pillow 44.4/100: 44% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
5:33.222 st Y wrath Fluffy_Pillow 64.4/100: 64% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos(11), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
5:34.132 st W cancel_buff Fluffy_Pillow 82.4/100: 82% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos(10), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
5:34.132 st Q starsurge Fluffy_Pillow 82.4/100: 82% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, balance_t31_4pc_buff_solar, best_friends_with_urctos(10), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
5:35.147 st Q starsurge Fluffy_Pillow 50.4/100: 50% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord, balance_t31_4pc_buff_solar(2), best_friends_with_urctos(9), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
5:36.125 st Y wrath Fluffy_Pillow 16.4/100: 16% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(36), solstice, starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(8), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
5:37.160 st R sunfire Fluffy_Pillow 32.4/100: 32% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(7), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
5:38.197 st Q starsurge Fluffy_Pillow 38.4/100: 38% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(6), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
5:39.234 st Y wrath Fluffy_Pillow 4.4/100: 4% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:40.313 st Y wrath Fluffy_Pillow 22.4/100: 22% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:41.314 st Y wrath Fluffy_Pillow 40.4/100: 40% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:42.314 st Y wrath Fluffy_Pillow 60.4/100: 60% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:43.314 st X starsurge Fluffy_Pillow 76.4/100: 76% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:44.314 st P starfire Fluffy_Pillow 44.4/100: 44% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:45.812 st P starfire Fluffy_Pillow 58.4/100: 58% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), starlord(3), dreamstate, best_friends_with_urctos(11), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power
5:46.629 st S moonfire Fluffy_Pillow 70.4/100: 70% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), dreamstate, best_friends_with_urctos(11), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power
5:47.538 st W cancel_buff Fluffy_Pillow 76.4/100: 76% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), dreamstate, best_friends_with_urctos(10), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power
5:47.538 st Q starsurge Fluffy_Pillow 76.4/100: 76% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, dreamstate, best_friends_with_urctos(10), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power
5:48.557 st Q starsurge Fluffy_Pillow 46.4/100: 46% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord, balance_t31_4pc_buff_solar, dreamstate, best_friends_with_urctos(9), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power
5:49.535 st T new_moon Fluffy_Pillow 12.4/100: 12% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(2), balance_t31_4pc_buff_solar(2), dreamstate, best_friends_with_urctos(8), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power
5:50.289 st Y wrath Fluffy_Pillow 26.4/100: 26% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos(7), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power
5:51.044 st Q starsurge Fluffy_Pillow 46.4/100: 46% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos(6), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power
5:51.985 st U half_moon Fluffy_Pillow 12.4/100: 12% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(5), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power
5:53.316 st X starsurge Fluffy_Pillow 38.4/100: 38% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power
5:54.315 st Y wrath Fluffy_Pillow 8.4/100: 8% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_urctos(3), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power
5:55.225 st Q starsurge Fluffy_Pillow 28.4/100: 28% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power
5:56.134 st R sunfire Fluffy_Pillow 2.4/100: 2% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos, best_friends_with_urctos_static, elemental_potion_of_ultimate_power
5:57.114 st Y wrath Fluffy_Pillow 12.4/100: 12% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
5:58.092 st Q starsurge Fluffy_Pillow 30.4/100: 30% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (tauren) Raid-Buffed Unbuffed Gear Amount
Strength 898 2 986 900 0
Agility 2089 -2 2173 2087 0
Stamina 3848 2 44833 42698 38825
Intellect 2089 -2 15807 14885 12090 (7538)
Spirit 0 0 0 0 0
Health 896660 896660 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 15807 14885 0
Crit 28.51% 22.30% 3114
Haste 24.78% 24.78% 4212
Versatility 6.30% 1.30% 267
Mana Regen 2560 2560 0
Attack Power 16439 15480 0
Mastery 29.91% 29.91% 7842
Armor 5324 5324 5324
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 489.00
Local Head Benevolent Embersage's Casque
ilevel: 489, stats: { 673 Armor, +3966 Sta, +704 Crit, +330 Haste, +938 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }, enchant: incandescent_essence
Local Neck Eye of the Rising Flame
ilevel: 489, stats: { +2231 Sta, +256 Haste, +1537 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Life-Bound Shoulderpads
ilevel: 486, stats: { 603 Armor, +2875 Sta, +383 Mastery, +383 Haste, +684 AgiInt }
item effects: { equip: Toxified }
Local Chest Benevolent Embersage's Robe
ilevel: 489, stats: { 897 Armor, +3966 Sta, +715 Crit, +318 Mastery, +938 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 489, stats: { 505 Armor, +2975 Sta, +535 Haste, +241 Mastery, +704 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 489, stats: { 785 Armor, +3966 Sta, +705 Haste, +328 Mastery, +938 AgiInt }, enchant: { +155 StrAgiInt, +41 Vers (lambent_armor_kit_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 486, stats: { 548 Armor, +2875 Sta, +274 Crit, +438 Haste, +684 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Thermal Bindings
ilevel: 489, stats: { 449 Armor, +2231 Sta, +191 Crit, +390 Mastery, +528 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Benevolent Embersage's Talons
ilevel: 489, stats: { 505 Armor, +2975 Sta, +226 Vers, +549 Mastery, +704 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 489, stats: { +2231 Sta, +512 Haste, +1281 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 489, stats: { +2231 Sta, +1230 Crit, +564 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 489, stats: { +892 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 489, stats: { +738 Mastery }
item effects: { use: Balefire Branch }
Local Back Drape of the Loyal Vassal
ilevel: 489, stats: { 359 Armor, +2231 Sta, +328 Haste, +253 Mastery, +528 StrAgiInt }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 489, weapon: { 606 - 781, 2.6 }, stats: { +469 Int, +2264 Int, +1983 Sta, +156 Haste, +361 Mastery }, enchant: wafting_devotion_3
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 489, stats: { +1439 Int, +1983 Sta, +174 Haste, +343 Mastery }

Profile

druid="Base"
source=default
spec=balance
level=70
race=tauren
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=489,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=489,gem_id=192961/192961/192961
shoulders=lifebound_shoulderpads,id=193406,bonus_id=8836/1576/8797/8960,ilevel=486,crafted_stats=49/36
back=drape_of_the_loyal_vassal,id=158375,bonus_id=4795,ilevel=489
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=489,enchant_id=6625
wrists=thermal_bindings,id=134461,bonus_id=4795,ilevel=489,gem_id=192961
hands=benevolent_embersages_talons,id=207255,bonus_id=4795,ilevel=489
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=489,enchant_id=6830
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=486
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=489
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=489
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=489,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=489

# Gear Summary
# gear_ilvl=488.63
# gear_stamina=38825
# gear_intellect=12090
# gear_crit_rating=3114
# gear_haste_rating=4212
# gear_mastery_rating=7842
# gear_versatility_rating=267
# gear_armor=5324
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

buzzing_rune_3 : 248897 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
248896.9 248896.9 124.2 / 0.050% 35919.1 / 14.4% 19665.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.2 12.2 Astral Power 0.00% 67.2 100.0% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
buzzing_rune_3 248897
Astral Smolder 18174 7.3% 69.4 4.28s 78513 0 Periodic 120.3 45261 0 45261 0.0% 80.2%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 69.36 0.00 120.31 120.31 54.37 0.0000 2.0000 5445443.22 5445443.22 0.00% 22630.98 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 120.31 78 161 45260.74 9435 169052 45279.43 31592 57752 5445443 5445443 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Denizen of the Dream 0 (7838) 0.0% (3.2%) 8.6 31.90s 273483 0

Stats Details: Denizen Of The Dream

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.60 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Denizen Of The Dream

  • id:394065
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394065
  • name:Denizen of the Dream
  • school:physical
  • tooltip:
  • description:Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.
    Fey Missile 20990  / 7838 3.2% 152.3 1.72s 15434 12026 Direct 151.4 11694 24296 15530 30.4%

Stats Details: Fey Missile

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 152.32 151.38 0.00 0.00 0.00 1.2834 0.0000 2350872.30 2350872.30 0.00% 12025.60 12025.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.56% 105.30 22 262 11694.35 7837 20414 11684.22 10355 13755 1231410 1231410 0.00%
crit 30.44% 46.08 7 122 24295.72 16590 41979 24279.33 21462 29031 1119462 1119462 0.00%

Action Details: Fey Missile

  • id:188046
  • school:astral
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.337
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.236000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:188046
  • name:Fey Missile
  • school:astral
  • tooltip:
  • description:{$@spelldesc187875=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$188083d=30 seconds}.}

Action Priority List

    default
    [ ]:16454.19
Hungering Shadowflame 3941 1.6% 17.4 16.59s 67994 0 Direct 17.4 51753 105216 67991 30.4%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.39 17.39 0.00 0.00 0.00 0.0000 0.0000 1182701.17 1182701.17 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.63% 12.11 2 28 51753.19 34936 202233 51603.23 34936 123481 626847 626847 0.00%
crit 30.37% 5.28 0 17 105215.83 71270 412555 104402.86 0 407878 555854 555854 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:31299.68
  • base_dd_max:31299.68
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 7231 2.9% 34.4 8.53s 63086 0 Direct 34.3 48084 98018 63262 30.4%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.37 34.27 0.00 0.00 0.00 0.0000 0.0000 2168043.37 2168043.37 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.61% 23.85 8 44 48083.77 47503 54996 48082.48 47503 50299 1147015 1147015 0.00%
crit 30.39% 10.42 1 26 98017.66 96907 112191 98023.79 96907 105313 1021029 1021029 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42559.30
  • base_dd_max:42559.30
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 13039 5.2% 14.4 21.60s 272182 282193 Direct 14.4 9217 19250 13013 37.8%
Periodic 312.4 8334 17733 11909 38.0% 99.5%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.35 14.35 312.35 312.35 13.35 0.9645 0.9561 3906683.35 3906683.35 0.00% 12502.31 282193.25
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 62.16% 8.92 1 16 9217.05 5982 17694 9217.22 7628 11994 82241 82241 0.00%
crit 37.84% 5.43 0 13 19249.55 12204 36096 19228.35 0 29961 104537 104537 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 61.96% 193.53 128 262 8334.12 296 15394 8338.43 7861 8920 1612894 1612894 0.00%
crit 38.04% 118.82 73 171 17732.52 3006 31404 17742.97 16438 19273 2107010 2107010 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    st
    [K]:1.25
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [S]:13.10
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
New Moon (Talent) 0 (23315) 0.0% (9.4%) 17.0 17.92s 410826 346734

Stats Details: Moons Talent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.01 0.00 0.00 0.00 0.00 1.1849 0.0000 0.00 0.00 0.00% 346733.60 346733.60

Action Details: Moons Talent

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
    Full Moon 8526 3.4% 5.3 62.86s 483151 262906 Direct 5.3 325261 651424 485876 49.2%

Stats Details: Full Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.31 5.28 0.00 0.00 0.00 1.8379 0.0000 2563329.48 2563329.48 0.00% 262905.59 262905.59
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 50.75% 2.68 0 6 325260.56 184774 542237 317038.94 0 520125 870929 870929 0.00%
crit 49.25% 2.60 0 6 651423.90 400925 1120189 629462.54 0 1084683 1692400 1692400 0.00%

Action Details: Full Moon

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:50.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Action Priority List

    st
    [V]:5.36
  • if_expr:astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    New Moon 6344 2.5% 6.0 53.47s 315165 417749 Direct 6.0 200521 427806 316886 51.2%

Stats Details: New Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.02 5.98 0.00 0.00 0.00 0.7545 0.0000 1896580.81 1896580.81 0.00% 417749.08 417749.08
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.80% 2.92 0 7 200520.78 97377 318326 196683.97 0 302526 585599 585599 0.00%
crit 51.20% 3.06 0 7 427806.11 202176 631025 424952.13 0 624979 1310982 1310982 0.00%

Action Details: New Moon

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Action Priority List

    st
    [T]:6.03
  • if_expr:astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Half Moon 8444 3.4% 5.7 57.66s 444556 365909 Direct 5.7 282126 572839 446952 56.7%

Stats Details: Half Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.69 5.66 0.00 0.00 0.00 1.2150 0.0000 2529892.36 2529892.36 0.00% 365908.64 365908.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 43.30% 2.45 0 7 282126.11 139980 448036 269799.48 0 448036 691432 691432 0.00%
crit 56.70% 3.21 0 7 572838.91 289307 913993 567301.45 0 913993 1838460 1838460 0.00%

Action Details: Half Moon

  • id:274282
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:24.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.875000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274282
  • name:Half Moon
  • school:astral
  • tooltip:
  • description:Deals {$s1=0} Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates {$=}{{$m3=240}/10} Astral Power.|r

Action Priority List

    st
    [U]:5.72
  • if_expr:astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (21682) 0.0% (8.7%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 8101 3.3% 95.6 3.12s 25409 0 Direct 95.3 16615 35521 25478 46.9%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 95.59 95.33 0.00 0.00 0.00 0.0000 0.0000 2428812.01 2428812.01 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.12% 50.64 22 89 16615.27 9981 33149 16621.54 14690 19569 841468 841468 0.00%
crit 46.88% 44.69 19 76 35521.38 20362 67624 35536.92 31310 41273 1587344 1587344 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 8107 3.3% 95.8 3.11s 25359 0 Direct 95.6 16590 35464 25430 46.8%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 95.85 95.58 0.00 0.00 0.00 0.0000 0.0000 2430598.28 2430598.28 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.17% 50.82 23 87 16590.06 9912 33149 16595.84 14438 19521 843044 843044 0.00%
crit 46.83% 44.76 18 74 35464.25 20220 67624 35478.57 31250 40960 1587554 1587554 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 5474 2.2% 6.4 47.50s 257325 0 Direct 6.4 167891 359832 258109 47.0%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.38 6.36 0.00 0.00 0.00 0.0000 0.0000 1641453.40 1641453.40 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.00% 3.37 0 9 167891.03 100083 326139 166149.49 0 297761 565931 565931 0.00%
crit 47.00% 2.99 0 8 359831.85 204170 665324 353205.71 0 612966 1075522 1075522 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 5968 2.4% 26.1 11.47s 68817 76401 Direct 27.1 45697 93131 66273 43.4%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.07 27.07 0.00 0.00 0.00 0.9008 0.0000 1793808.49 1793808.49 0.00% 76400.55 76400.55
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.62% 15.32 4 28 45696.57 20476 90973 45694.10 35427 54271 700273 700273 0.00%
crit 43.38% 11.74 2 25 93130.94 41772 184873 93094.36 58145 112654 1093535 1093535 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    st
    [L]:1.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
    st
    [P]:25.12
  • if_expr:variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Warrior of Elune2024251-1.000Spell DataNo-stacks
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Starsurge 79362 (107167) 31.9% (43.0%) 116.4 2.56s 275713 281099 Direct 116.1 (154.4) 136564 288306 204607 44.8% (45.4%)

Stats Details: Starsurge

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 116.40 116.15 0.00 0.00 0.00 0.9808 0.0000 23764319.75 23764319.75 0.00% 281098.95 281098.95
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 55.16% 64.07 34 97 136564.29 81531 263509 136637.61 123433 154192 8749291 8749291 0.00%
crit 44.84% 52.08 26 78 288306.50 179880 537559 288510.71 259267 330008 15015029 15015029 0.00%

Action Details: Starsurge

  • id:78674
  • school:astral
  • range:45.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:36.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.455000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.18

Spelldata

  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$s1=0} Astral damage.

Action Priority List

    st
    [Q]:83.40
  • if_expr:variable.starsurge_condition1
    st
    [X]:33.00
  • if_expr:variable.starsurge_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Flat Cost Incarnation: Chosen of Elune1025603-8.000Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Goldrinn's Fang 27806 11.2% 38.4 7.72s 216812 0 Direct 38.2 143674 301450 217858 47.0%

Stats Details: Goldrinns Fang

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.41 38.23 0.00 0.00 0.00 0.0000 0.0000 8327904.05 8327904.05 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.98% 20.25 5 42 143674.18 95410 275540 143769.85 121239 184605 2909949 2909949 0.00%
crit 47.02% 17.97 3 37 301450.21 194637 562101 301711.56 244559 400077 5417955 5417955 0.00%

Action Details: Goldrinns Fang

  • id:394047
  • school:astral
  • range:60.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.852000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10

Spelldata

  • id:394047
  • name:Goldrinn's Fang
  • school:astral
  • tooltip:Deals {$m1=0} Arcane damage.
  • description:Deals {$m1=0} Arcane damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountPower of Goldrinn3940462PCT1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Friend of the Fae39408310.100Spell Data
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Incarnation: Chosen of Elune10256020.100Spell Data
Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Dot / Debuff on Target Moonfire16481250.283Mastery
Sunfire16481550.283Mastery
Waning Twilight39395710.100
Sunfire 13069 5.3% 17.4 18.05s 225196 233461 Direct 17.4 9215 19036 13248 41.1%
Periodic 313.3 8223 16999 11770 40.4% 99.9%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.40 17.40 313.32 313.32 16.40 0.9646 0.9561 3918179.85 3918179.85 0.00% 12385.86 233461.23
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.94% 10.25 1 20 9214.54 5438 16086 9206.17 7049 11485 94493 94493 0.00%
crit 41.06% 7.14 0 16 19036.30 11094 33175 19035.72 0 27013 136003 136003 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 59.59% 186.70 126 256 8223.41 577 14587 8222.80 7775 8871 1535311 1535311 0.00%
crit 40.41% 126.62 79 184 16999.21 765 29758 17000.79 15848 18392 2152373 2152373 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    st
    [J]:1.45
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [R]:15.95
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (4180) 0.0% (1.7%) 8.6 31.56s 146280 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.57 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 2178 0.9% 8.6 31.56s 76208 0 Direct 8.6 57827 117848 76212 30.6%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.57 8.57 0.00 0.00 0.00 0.0000 0.0000 653071.39 653071.39 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.38% 5.95 0 18 57827.09 57075 66076 57765.95 0 65327 343790 343790 0.00%
crit 30.62% 2.62 0 12 117848.07 116432 134796 110449.89 0 134796 309281 309281 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:51134.41
  • base_dd_max:51134.41
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 2002 0.8% 16.6 15.28s 36178 0 Direct 16.6 27500 56052 36178 30.4%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.60 16.60 0.00 0.00 0.00 0.0000 0.0000 600483.19 600483.19 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.61% 11.55 1 30 27499.58 27158 31441 27498.25 27158 29860 317712 317712 0.00%
crit 30.39% 5.04 0 18 56051.99 55402 64140 55608.42 0 64140 282772 282772 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24330.91
  • base_dd_max:24330.91
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 23294 9.4% 117.3 2.50s 59498 63243 Direct 116.9 38698 81342 59723 49.3%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.31 116.86 0.00 0.00 0.00 0.9408 0.0000 6979521.05 6979521.05 0.00% 63243.21 63243.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 50.70% 59.25 34 91 38697.91 15081 127380 38704.10 33699 44270 2292674 2292674 0.00%
crit 49.30% 57.62 33 89 81342.29 30766 246662 81368.63 69984 93609 4686848 4686848 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    st
    [M]:0.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
    st
    [Y]:115.62

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.400Spell Data
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
buzzing_rune_3
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:buzzing_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:buzzing_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:buzzing_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 190.38s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    st
    [N]:2.00
  • if_expr:variable.cd_condition_st

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.7 64.70s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.65 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:buzzing_rune_3
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:70932.17
  • base_dd_max:70932.17
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.30s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.75 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:buzzing_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.75
Elemental Potion of Ultimate Power 1.5 306.98s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.47
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
Warrior of Elune 6.1 49.03s

Stats Details: Warrior Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.09 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Warrior Of Elune

  • id:202425
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202425
  • name:Warrior of Elune
  • school:arcane
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.

Action Priority List

    st
    [O]:6.09
  • if_expr:variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 8.8 1.5 35.9s 33.6s 8.5s 25.04% 29.04% 1.5 (7.1) 8.6

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 50.3s
  • trigger_min/max:2.9s / 50.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:22.17% / 27.85%

Stack Uptimes

  • balance_of_all_things_arcane_1:2.88%
  • balance_of_all_things_arcane_2:2.93%
  • balance_of_all_things_arcane_3:3.00%
  • balance_of_all_things_arcane_4:3.03%
  • balance_of_all_things_arcane_5:3.06%
  • balance_of_all_things_arcane_6:3.30%
  • balance_of_all_things_arcane_7:3.42%
  • balance_of_all_things_arcane_8:3.43%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 18.3 3.2 16.8s 14.2s 8.3s 50.64% 54.67% 3.2 (18.8) 17.7

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.2s
  • trigger_min/max:0.0s / 40.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.2s
  • uptime_min/max:45.96% / 54.50%

Stack Uptimes

  • balance_of_all_things_nature_1:5.92%
  • balance_of_all_things_nature_2:5.99%
  • balance_of_all_things_nature_3:6.11%
  • balance_of_all_things_nature_4:6.21%
  • balance_of_all_things_nature_5:6.35%
  • balance_of_all_things_nature_6:6.50%
  • balance_of_all_things_nature_7:6.66%
  • balance_of_all_things_nature_8:6.90%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 7.2 62.7 44.4s 4.2s 20.2s 48.50% 0.00% 34.9 (34.9) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.5s
  • trigger_min/max:0.8s / 42.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:42.84% / 55.00%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:4.65%
  • balance_t31_4pc_buff_lunar_2:4.35%
  • balance_t31_4pc_buff_lunar_3:4.94%
  • balance_t31_4pc_buff_lunar_4:5.61%
  • balance_t31_4pc_buff_lunar_5:28.95%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 14.1 102.3 21.8s 2.6s 19.2s 90.46% 0.00% 48.4 (48.4) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 58.0s
  • trigger_min/max:0.8s / 10.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:87.28% / 93.17%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:7.61%
  • balance_t31_4pc_buff_solar_2:11.59%
  • balance_t31_4pc_buff_solar_3:16.06%
  • balance_t31_4pc_buff_solar_4:11.69%
  • balance_t31_4pc_buff_solar_5:43.52%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 70.4s 70.4s 10.8s 10.02% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 340.8s
  • trigger_min/max:12.0s / 340.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 39.05%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.90%
  • best_friends_with_aerwynn_2:0.90%
  • best_friends_with_aerwynn_3:0.90%
  • best_friends_with_aerwynn_4:0.91%
  • best_friends_with_aerwynn_5:0.91%
  • best_friends_with_aerwynn_6:0.91%
  • best_friends_with_aerwynn_7:0.91%
  • best_friends_with_aerwynn_8:0.92%
  • best_friends_with_aerwynn_9:0.92%
  • best_friends_with_aerwynn_10:0.92%
  • best_friends_with_aerwynn_11:0.93%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 114.8s 70.4s 45.7s 33.34% 0.00% 69.4 (69.4) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 347.5s
  • trigger_min/max:12.0s / 340.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 317.1s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.34%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.5s 70.5s 10.8s 10.02% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 341.0s
  • trigger_min/max:12.0s / 341.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 36.47%

Stack Uptimes

  • best_friends_with_pip_1:0.90%
  • best_friends_with_pip_2:0.90%
  • best_friends_with_pip_3:0.90%
  • best_friends_with_pip_4:0.90%
  • best_friends_with_pip_5:0.91%
  • best_friends_with_pip_6:0.91%
  • best_friends_with_pip_7:0.91%
  • best_friends_with_pip_8:0.92%
  • best_friends_with_pip_9:0.92%
  • best_friends_with_pip_10:0.92%
  • best_friends_with_pip_11:0.93%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 114.4s 70.5s 45.8s 33.40% 0.00% 69.8 (69.8) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 354.2s
  • trigger_min/max:12.0s / 341.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 343.2s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.40%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 70.7s 70.7s 10.8s 10.01% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 344.7s
  • trigger_min/max:12.0s / 344.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 37.05%

Stack Uptimes

  • best_friends_with_urctos_1:0.89%
  • best_friends_with_urctos_2:0.90%
  • best_friends_with_urctos_3:0.90%
  • best_friends_with_urctos_4:0.90%
  • best_friends_with_urctos_5:0.91%
  • best_friends_with_urctos_6:0.91%
  • best_friends_with_urctos_7:0.91%
  • best_friends_with_urctos_8:0.92%
  • best_friends_with_urctos_9:0.92%
  • best_friends_with_urctos_10:0.92%
  • best_friends_with_urctos_11:0.93%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 113.8s 70.7s 45.5s 33.25% 0.00% 69.5 (69.5) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.6s / 349.3s
  • trigger_min/max:12.0s / 344.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 317.2s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.25%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.51% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.51%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.8 0.0 62.0s 58.4s 50.3s 80.26% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 345.0s
  • trigger_min/max:15.0s / 307.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 355.3s
  • uptime_min/max:47.81% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.26%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Denizen of the Dream 8.6 0.0 45.0s 31.8s 41.3s 57.61% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_denizen_of_the_dream
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 297.8s
  • trigger_min/max:0.0s / 146.6s
  • trigger_pct:99.98%
  • duration_min/max:0.0s / 254.8s
  • uptime_min/max:21.82% / 98.78%

Stack Uptimes

  • denizen_of_the_dream_1:38.71%
  • denizen_of_the_dream_2:14.53%
  • denizen_of_the_dream_3:3.60%
  • denizen_of_the_dream_4:0.66%
  • denizen_of_the_dream_5:0.09%
  • denizen_of_the_dream_6:0.02%
  • denizen_of_the_dream_7:0.01%
  • denizen_of_the_dream_8:0.00%

Spelldata

  • id:394076
  • name:Denizen of the Dream
  • tooltip:
  • description:{$@spelldesc394065=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Dreamstate 15.3 0.6 20.2s 20.6s 3.0s 15.58% 20.83% 0.6 (1.2) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 56.2s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.9s
  • uptime_min/max:8.70% / 26.21%

Stack Uptimes

  • dreamstate_1:9.59%
  • dreamstate_2:6.00%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 7.2 1.0 44.9s 44.4s 20.6s 49.52% 52.69% 1.0 (1.0) 6.8

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.1s
  • trigger_min/max:12.0s / 90.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:44.10% / 56.12%

Stack Uptimes

  • eclipse_lunar_1:49.52%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 13.9 5.5 22.3s 15.7s 20.1s 93.00% 96.18% 5.5 (5.5) 12.9

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 70.6s
  • trigger_min/max:0.0s / 55.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.0s
  • uptime_min/max:90.48% / 95.38%

Stack Uptimes

  • eclipse_solar_1:93.00%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 307.0s 307.0s 27.4s 13.20% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.5s
  • trigger_min/max:300.0s / 328.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.87% / 18.02%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.20%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Friend of the Fae 5.3 3.3 55.3s 31.8s 25.0s 43.72% 43.65% 3.3 (3.3) 4.8

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_friend_of_the_fae
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 190.4s
  • trigger_min/max:0.0s / 146.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 135.8s
  • uptime_min/max:14.55% / 89.95%

Stack Uptimes

  • friend_of_the_fae_1:43.72%

Spelldata

  • id:394083
  • name:Friend of the Fae
  • tooltip:Arcane and Nature damage increased by {$=}w1%.
  • description:{$@spelldesc394081=When a Faerie Dragon is summoned, your spells deal {$394083m1=10}% increased damage for {$394083d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 7.2 0.0 44.4s 44.4s 20.3s 48.62% 51.43% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.1s
  • trigger_min/max:12.0s / 90.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:43.35% / 55.00%

Stack Uptimes

  • incarnation_chosen_of_elune_1:48.62%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.6 0.0 99.2s 99.2s 19.5s 23.32% 0.00% 0.0 (0.0) 3.2

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:65.76

Trigger Details

  • interval_min/max:90.0s / 125.9s
  • trigger_min/max:90.0s / 125.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.36% / 26.35%

Stack Uptimes

  • kindled_soul_5:1.11%
  • kindled_soul_10:1.14%
  • kindled_soul_15:1.15%
  • kindled_soul_20:1.15%
  • kindled_soul_25:1.15%
  • kindled_soul_30:1.15%
  • kindled_soul_35:1.16%
  • kindled_soul_40:1.16%
  • kindled_soul_45:1.16%
  • kindled_soul_50:1.17%
  • kindled_soul_55:1.17%
  • kindled_soul_60:1.17%
  • kindled_soul_65:1.17%
  • kindled_soul_70:1.18%
  • kindled_soul_75:1.18%
  • kindled_soul_80:1.18%
  • kindled_soul_85:1.19%
  • kindled_soul_90:1.19%
  • kindled_soul_95:1.19%
  • kindled_soul_100:1.19%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Grace 12.9 0.0 20.5s 20.5s 5.9s 25.50% 0.00% 0.0 (0.0) 12.6

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.8s / 70.7s
  • trigger_min/max:12.8s / 70.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:19.85% / 30.45%

Stack Uptimes

  • natures_grace_1:25.50%

Spelldata

  • id:393959
  • name:Nature's Grace
  • tooltip:Haste increased by {$s1=10}%.
  • description:{$@spelldesc393958=After an Eclipse ends, you gain {$393959s1=10}% Haste for {$393959d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Vigil 3.7 0.0 90.3s 90.3s 14.7s 18.43% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.8s
  • trigger_min/max:90.0s / 91.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.54% / 21.03%

Stack Uptimes

  • natures_vigil_1:18.43%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.1 74.5s 68.4s 7.7s 6.39% 7.08% 0.1 (0.1) 1.3

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.6s / 351.4s
  • trigger_min/max:0.0s / 351.4s
  • trigger_pct:15.08%
  • duration_min/max:0.0s / 32.3s
  • uptime_min/max:0.00% / 30.69%

Stack Uptimes

  • owlkin_frenzy_1:6.39%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 8.2 109.1 38.5s 38.5s 34.4s 94.06% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:24.3s / 49.8s
  • trigger_min/max:24.3s / 49.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.4s
  • uptime_min/max:90.38% / 96.82%

Stack Uptimes

  • primordial_arcanic_pulsar_4:4.99%
  • primordial_arcanic_pulsar_8:5.33%
  • primordial_arcanic_pulsar_12:6.71%
  • primordial_arcanic_pulsar_16:6.77%
  • primordial_arcanic_pulsar_20:6.61%
  • primordial_arcanic_pulsar_24:6.10%
  • primordial_arcanic_pulsar_28:7.03%
  • primordial_arcanic_pulsar_32:8.34%
  • primordial_arcanic_pulsar_36:6.58%
  • primordial_arcanic_pulsar_40:7.17%
  • primordial_arcanic_pulsar_44:7.28%
  • primordial_arcanic_pulsar_48:6.86%
  • primordial_arcanic_pulsar_52:7.65%
  • primordial_arcanic_pulsar_56:6.66%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 18.7 3.8 16.6s 14.2s 6.4s 39.64% 39.83% 3.8 (3.8) 18.2

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 49.5s
  • trigger_min/max:0.0s / 40.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.9s
  • uptime_min/max:36.19% / 42.89%

Stack Uptimes

  • solstice_1:39.64%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 20.8 95.6 14.7s 2.6s 14.1s 97.28% 0.00% 54.5 (54.5) 7.6

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 20.3s
  • trigger_min/max:0.8s / 10.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:93.95% / 99.19%

Stack Uptimes

  • starlord_1:9.24%
  • starlord_2:14.87%
  • starlord_3:73.16%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Wafting Devotion 4.3 1.2 61.1s 45.7s 16.5s 23.69% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 232.7s
  • trigger_min/max:0.0s / 232.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 77.3s
  • uptime_min/max:4.82% / 58.07%

Stack Uptimes

  • wafting_devotion_1:23.69%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Warrior of Elune 6.1 0.0 49.0s 49.0s 21.7s 43.99% 43.13% 0.0 (0.0) 2.3

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_warrior_of_elune
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:45.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 82.1s
  • trigger_min/max:45.0s / 82.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s
  • uptime_min/max:32.63% / 50.66%

Stack Uptimes

  • warrior_of_elune_1:20.48%
  • warrior_of_elune_2:5.25%
  • warrior_of_elune_3:18.25%

Spelldata

  • id:202425
  • name:Warrior of Elune
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.
  • max_stacks:0
  • duration:25.00
  • cooldown:45.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Denizen of the Dream 8.6 2.0 21.0 31.8s 0.0s 146.6s
Primordial Arcanic Pulsar 7.3 6.0 9.0 40.2s 29.5s 50.3s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.08% 0.00% 1.95% 0.5s 0.0s 2.8s
Astral Smolder 80.42% 62.43% 93.70% 16.1s 0.0s 158.0s
Incarnation (Total) 48.62% 43.35% 55.00% 20.3s 0.0s 54.0s
Incarnation (Pulsar) 28.37% 25.94% 30.89% 11.7s 0.0s 12.0s
Lunar Eclipse Only 0.91% 0.71% 1.12% 2.7s 2.5s 2.7s
Solar Eclipse Only 44.39% 36.34% 50.56% 10.9s 0.0s 15.0s
No Eclipse 6.07% 3.56% 8.42% 1.4s 0.0s 3.7s
Friend of the Fae 43.72% 14.55% 89.95% 25.0s 0.0s 135.8s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Warrior of Elune7.5750.00037.11946.25925.96070.656
Full Moon
New Moon
Half Moon
0.3420.00025.9995.8265.29531.629

Eclipse Utilization

NoneSolarLunarBoth
Wrath5.144.5%57.4849.8%0.000.0%52.6945.7%
Starfire25.0692.6%0.000.0%2.007.4%0.010.0%
Starsurge0.000.0%46.5840.0%0.000.0%69.8260.0%
New Moon0.030.5%0.264.2%0.000.0%5.7395.3%
Half Moon0.000.0%0.346.0%0.000.0%5.3594.0%
Full Moon0.211.8%3.1226.7%0.080.6%8.2870.8%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
buzzing_rune_3
Nature's BalanceAstral Power99.52198.945.43%2.000.100.05%
Full MoonAstral Power5.30264.897.22%49.930.360.14%
Half MoonAstral Power5.69136.593.73%24.000.000.00%
MoonfireAstral Power14.3586.052.35%6.000.060.07%
New MoonAstral Power6.0272.211.97%12.000.000.00%
Orbit BreakerAstral Power6.38190.295.19%29.831.080.56%
Shooting Stars (Moonfire)Astral Power95.59190.975.21%2.000.200.11%
Shooting Stars (Sunfire)Astral Power95.85191.495.22%2.000.200.11%
StarfireAstral Power27.07396.8410.82%14.662.980.74%
SunfireAstral Power17.40104.382.85%6.000.010.01%
WrathAstral Power117.311834.0750.02%15.630.000.00%
Usage Type Count Total Tot% Avg RPE APR
buzzing_rune_3
StarsurgeAstral Power 116.583678.70100.00%31.5631.608723.81
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 896660.0 4207.77 4980.29 1794496.8 664852.7 -576450.4 896660.0
Astral Power 70.0 12.22 12.24 5.0 23.7 0.0 100.0

Statistics & Data Analysis

Fight Length
buzzing_rune_3 Fight Length
Count 20691
Mean 300.07
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 19.99%
Standard Deviation 34.5516
5th Percentile 245.74
95th Percentile 353.90
( 95th Percentile - 5th Percentile ) 108.16
Mean Distribution
Standard Deviation 0.2402
95.00% Confidence Interval ( 299.60 - 300.54 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 510
0.1% Error 50933
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1020
DPS
buzzing_rune_3 Damage Per Second
Count 20691
Mean 248896.86
Minimum 216026.11
Maximum 293103.83
Spread ( max - min ) 77077.72
Range [ ( max - min ) / 2 * 100% ] 15.48%
Standard Deviation 9115.7585
5th Percentile 234532.35
95th Percentile 264508.69
( 95th Percentile - 5th Percentile ) 29976.34
Mean Distribution
Standard Deviation 63.3727
95.00% Confidence Interval ( 248772.65 - 249021.07 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5153
0.1 Scale Factor Error with Delta=300 709365
0.05 Scale Factor Error with Delta=300 2837457
0.01 Scale Factor Error with Delta=300 70936425
Priority Target DPS
buzzing_rune_3 Priority Target Damage Per Second
Count 20691
Mean 248896.86
Minimum 216026.11
Maximum 293103.83
Spread ( max - min ) 77077.72
Range [ ( max - min ) / 2 * 100% ] 15.48%
Standard Deviation 9115.7585
5th Percentile 234532.35
95th Percentile 264508.69
( 95th Percentile - 5th Percentile ) 29976.34
Mean Distribution
Standard Deviation 63.3727
95.00% Confidence Interval ( 248772.65 - 249021.07 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5153
0.1 Scale Factor Error with Delta=300 709365
0.05 Scale Factor Error with Delta=300 2837457
0.01 Scale Factor Error with Delta=300 70936425
DPS(e)
buzzing_rune_3 Damage Per Second (Effective)
Count 20691
Mean 248896.86
Minimum 216026.11
Maximum 293103.83
Spread ( max - min ) 77077.72
Range [ ( max - min ) / 2 * 100% ] 15.48%
Damage
buzzing_rune_3 Damage
Count 20691
Mean 72230825.23
Minimum 53364023.73
Maximum 92012937.10
Spread ( max - min ) 38648913.37
Range [ ( max - min ) / 2 * 100% ] 26.75%
DTPS
buzzing_rune_3 Damage Taken Per Second
Count 20691
Mean 4980.75
Minimum 1242.54
Maximum 9823.23
Spread ( max - min ) 8580.69
Range [ ( max - min ) / 2 * 100% ] 86.14%
HPS
buzzing_rune_3 Healing Per Second
Count 20691
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
buzzing_rune_3 Healing Per Second (Effective)
Count 20691
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
buzzing_rune_3 Heal
Count 20691
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
buzzing_rune_3 Healing Taken Per Second
Count 20691
Mean 4194.85
Minimum 872.52
Maximum 8651.29
Spread ( max - min ) 7778.77
Range [ ( max - min ) / 2 * 100% ] 92.72%
TMI
buzzing_rune_3 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
buzzing_rune_3Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
buzzing_rune_3 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.47 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.59 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.75 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.st
# count action,conditions
J 1.45 sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
K 1.25 moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
0.00 starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
0.00 starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
L 1.00 starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
M 0.00 wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
0.00 celestial_alignment,if=variable.cd_condition_st
N 2.00 incarnation,if=variable.cd_condition_st
0.00 variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
0.00 variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
O 6.09 warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
P 25.12 starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
0.00 wrath,if=variable.enter_eclipse
0.00 variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
0.00 convoke_the_spirits,if=variable.convoke_condition
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+55
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 starfall,if=buff.starweavers_warp.up
0.00 variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
Q 83.40 starsurge,if=variable.starsurge_condition1
R 15.95 sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
S 13.10 moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
T 6.03 new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
U 5.72 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
V 5.36 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
W 12.18 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
X 33.00 starsurge,if=variable.starsurge_condition2
Y 115.62 wrath
Z 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFJKLNDEQQQTQUQVYXYYRXYXYSWQQQYYYYYXYXOTYXYXYYRWQQQYQQYYYSYXYXYXPPWQQRYYQYYYYXYXYSPPQQUQQRVOYXXYXPPYQQYSQYRYXYFXYYPPQQYYQYYYRSXYXETUQQYQYYOXYYPPQRYWQQSYQYYXYYXPPWQQRYQYYYYXSYXVQQQRTYYXPOPQYYXYYQQSYYQRYPPFQXYNUWQQQVQQYQYRQSYYYYEQQYQYYYTXYYXYRWQQQSYYOYYXYXYXPPYQQQRUQYQYYSXYPPWQQYQYYRYYXYYXPPQQSYQYYROYYXYFXVQQQTQYYXSYPPQRXYYQQYYQYYYPEPXRYDWQQSYQYUYOXQVWQQY

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask buzzing_rune_3 50.0/100: 50% astral_power
Pre precombat 1 food buzzing_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 2 augmentation buzzing_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 4 no_cd_talent buzzing_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 5 on_use_trinket buzzing_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 6 on_use_trinket buzzing_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 7 on_use_trinket buzzing_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 60.0/100: 60% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil buzzing_rune_3 50.0/100: 50% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.000 st J sunfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.929 st K moonfire Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:01.856 st L starfire Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, corrupting_rage
0:02.692 st N incarnation_chosen_of_elune Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, corrupting_rage
0:02.692 default D potion Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), corrupting_rage
0:02.692 default E use_items Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power
0:02.692 st Q starsurge Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:03.538 st Q starsurge Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:04.349 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:05.131 st T new_moon Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:05.887 st Q starsurge Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:06.642 st U half_moon Fluffy_Pillow 12.0/100: 12% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:07.646 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
0:08.399 st V full_moon Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate(2), elemental_potion_of_ultimate_power, kindled_soul(75)
0:09.903 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, elemental_potion_of_ultimate_power, kindled_soul(65)
0:10.657 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, elemental_potion_of_ultimate_power, kindled_soul(65)
0:11.412 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(60)
0:12.166 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(55)
0:12.920 st R sunfire Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(50)
0:13.675 st X starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(50)
0:14.429 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(45)
0:15.184 st X starsurge Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(40)
0:15.938 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(35)
0:16.693 st S moonfire Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.449 st W cancel_buff Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.449 st Q starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(30)
0:18.293 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(11), elemental_potion_of_ultimate_power, kindled_soul(25)
0:19.104 st Q starsurge Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(10), elemental_potion_of_ultimate_power, kindled_soul(20)
0:19.886 st Y wrath Fluffy_Pillow 0.0/100: 0% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), elemental_potion_of_ultimate_power, kindled_soul(15)
0:20.641 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(8), elemental_potion_of_ultimate_power, kindled_soul(15)
0:21.398 st Y wrath Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(8), elemental_potion_of_ultimate_power, kindled_soul(10)
0:22.153 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(7), elemental_potion_of_ultimate_power, kindled_soul(5)
0:22.907 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(6), elemental_potion_of_ultimate_power
0:23.662 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(5), corrupting_rage, elemental_potion_of_ultimate_power
0:24.415 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(5), corrupting_rage, elemental_potion_of_ultimate_power
0:25.170 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(4), corrupting_rage, elemental_potion_of_ultimate_power
0:25.923 st O warrior_of_elune Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(3), corrupting_rage, elemental_potion_of_ultimate_power
0:25.923 st T new_moon Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(3), corrupting_rage, elemental_potion_of_ultimate_power
0:26.678 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(2), corrupting_rage, elemental_potion_of_ultimate_power
0:27.431 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(2), corrupting_rage, elemental_potion_of_ultimate_power
0:28.186 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip, corrupting_rage, elemental_potion_of_ultimate_power
0:28.940 st X starsurge Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:29.696 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:30.450 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:31.206 st R sunfire Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:31.962 st W cancel_buff Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:31.962 st Q starsurge Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power
0:32.803 st Q starsurge Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:33.615 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:34.397 st Y wrath Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:35.152 st Q starsurge Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:35.908 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:36.663 st Y wrath Fluffy_Pillow 12.0/100: 12% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:37.416 st Y wrath Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5)
0:38.169 st Y wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5)
0:38.925 st S moonfire Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5)
0:39.679 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5)
0:40.434 st X starsurge Fluffy_Pillow 84.0/100: 84% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5)
0:41.413 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5)
0:42.392 st X starsurge Fluffy_Pillow 74.0/100: 74% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5)
0:43.372 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5)
0:44.351 st X starsurge Fluffy_Pillow 64.0/100: 64% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5)
0:45.329 st P starfire Fluffy_Pillow 42.0/100: 42% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), dreamstate
0:46.083 st P starfire Fluffy_Pillow 58.8/100: 59% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2)
0:46.839 st W cancel_buff Fluffy_Pillow 77.6/100: 78% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune
0:46.839 st Q starsurge Fluffy_Pillow 77.6/100: 78% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(32), solstice, warrior_of_elune
0:47.935 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar
0:48.989 st R sunfire Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), wafting_devotion
0:49.931 st Y wrath Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), wafting_devotion
0:50.874 st Y wrath Fluffy_Pillow 35.6/100: 36% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), wafting_devotion
0:51.910 st Q starsurge Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, wafting_devotion
0:52.946 st Y wrath Fluffy_Pillow 19.6/100: 20% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
0:53.946 st Y wrath Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, wafting_devotion
0:54.944 st Y wrath Fluffy_Pillow 55.6/100: 56% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, wafting_devotion
0:55.945 st Y wrath Fluffy_Pillow 73.6/100: 74% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, wafting_devotion
0:56.945 st X starsurge Fluffy_Pillow 89.6/100: 90% astral_power eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, wafting_devotion
0:57.943 st Y wrath Fluffy_Pillow 57.6/100: 58% astral_power eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, wafting_devotion
0:58.943 st X starsurge Fluffy_Pillow 73.6/100: 74% astral_power eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, wafting_devotion
0:59.943 st Y wrath Fluffy_Pillow 39.6/100: 40% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, wafting_devotion
1:00.942 st S moonfire Fluffy_Pillow 59.6/100: 60% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, wafting_devotion
1:01.940 st P starfire Fluffy_Pillow 65.6/100: 66% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(52), dreamstate, best_friends_with_aerwynn, best_friends_with_aerwynn_static, wafting_devotion
1:02.694 st P starfire Fluffy_Pillow 77.6/100: 78% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), best_friends_with_aerwynn, best_friends_with_aerwynn_static, wafting_devotion
1:03.611 st Q starsurge Fluffy_Pillow 91.6/100: 92% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, best_friends_with_aerwynn_static
1:04.708 st Q starsurge Fluffy_Pillow 59.6/100: 60% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_pip(11), best_friends_with_pip_static
1:05.763 st U half_moon Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, best_friends_with_pip(10), best_friends_with_pip_static
1:06.994 st Q starsurge Fluffy_Pillow 57.6/100: 58% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, best_friends_with_pip(9), best_friends_with_pip_static
1:07.918 st Q starsurge Fluffy_Pillow 31.6/100: 32% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(8), best_friends_with_pip_static
1:08.900 st R sunfire Fluffy_Pillow 5.6/100: 6% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(7), best_friends_with_pip_static, corrupting_rage
1:09.878 st V full_moon Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage
1:11.834 st O warrior_of_elune Fluffy_Pillow 65.6/100: 66% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage
1:11.834 st Y wrath Fluffy_Pillow 65.6/100: 66% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage
1:12.814 st X starsurge Fluffy_Pillow 83.6/100: 84% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(3), best_friends_with_pip_static, corrupting_rage
1:13.793 st X starsurge Fluffy_Pillow 55.6/100: 56% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage
1:14.773 st Y wrath Fluffy_Pillow 29.6/100: 30% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip, best_friends_with_pip_static, corrupting_rage
1:15.755 st X starsurge Fluffy_Pillow 47.6/100: 48% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
1:16.734 st P starfire Fluffy_Pillow 19.6/100: 20% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip_static, corrupting_rage
1:17.489 st P starfire Fluffy_Pillow 36.4/100: 36% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage
1:18.245 st Y wrath Fluffy_Pillow 59.2/100: 59% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage
1:19.223 st Q starsurge Fluffy_Pillow 75.2/100: 75% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, warrior_of_elune, best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage
1:20.319 st Q starsurge Fluffy_Pillow 41.2/100: 41% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip(8), best_friends_with_pip_static, corrupting_rage
1:21.375 st Y wrath Fluffy_Pillow 11.2/100: 11% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(7), best_friends_with_pip_static, corrupting_rage
1:22.390 st S moonfire Fluffy_Pillow 29.2/100: 29% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage
1:23.405 st Q starsurge Fluffy_Pillow 67.2/100: 67% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(5), best_friends_with_pip_static, corrupting_rage
1:24.522 st Y wrath Fluffy_Pillow 33.2/100: 33% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage
1:25.600 st R sunfire Fluffy_Pillow 51.2/100: 51% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip(3), best_friends_with_pip_static, corrupting_rage
1:26.675 st Y wrath Fluffy_Pillow 59.2/100: 59% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage
1:27.751 st X starsurge Fluffy_Pillow 77.2/100: 77% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
1:28.828 st Y wrath Fluffy_Pillow 41.2/100: 41% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
1:29.907 default F natures_vigil buzzing_rune_3 57.2/100: 57% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
1:30.000 st X starsurge Fluffy_Pillow 59.2/100: 59% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
1:31.078 st Y wrath Fluffy_Pillow 23.2/100: 23% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
1:32.157 st Y wrath Fluffy_Pillow 41.2/100: 41% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
1:33.236 st P starfire Fluffy_Pillow 53.2/100: 53% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, dreamstate, best_friends_with_pip_static, corrupting_rage
1:33.991 st P starfire Fluffy_Pillow 70.0/100: 70% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_pip_static, corrupting_rage
1:34.871 st Q starsurge Fluffy_Pillow 84.0/100: 84% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, best_friends_with_pip_static, corrupting_rage
1:35.968 st Q starsurge Fluffy_Pillow 48.0/100: 48% astral_power natures_vigil, balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_pip_static, corrupting_rage
1:37.022 st Y wrath Fluffy_Pillow 14.0/100: 14% astral_power natures_vigil, balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, corrupting_rage
1:38.038 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power natures_vigil, balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, corrupting_rage
1:39.054 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power natures_vigil, balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, corrupting_rage
1:40.172 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power natures_vigil, balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
1:41.250 st Y wrath Fluffy_Pillow 34.0/100: 34% astral_power natures_vigil, balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
1:42.328 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power natures_vigil, balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
1:43.406 st R sunfire Fluffy_Pillow 70.0/100: 70% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
1:44.483 st S moonfire Fluffy_Pillow 76.0/100: 76% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
1:45.561 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage
1:46.638 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage
1:47.715 st X starsurge Fluffy_Pillow 68.0/100: 68% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip(8), best_friends_with_pip_static, corrupting_rage
1:48.790 default E use_items Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip(7), best_friends_with_pip_static, corrupting_rage
1:48.790 st T new_moon Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip(7), best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
1:49.544 st U half_moon Fluffy_Pillow 46.0/100: 46% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
1:50.850 st Q starsurge Fluffy_Pillow 72.0/100: 72% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(90)
1:51.946 st Q starsurge Fluffy_Pillow 48.0/100: 48% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage, kindled_soul(85)
1:53.000 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(80)
1:54.017 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(75)
1:55.033 st Y wrath Fluffy_Pillow 18.0/100: 18% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip, best_friends_with_pip_static, corrupting_rage, kindled_soul(70)
1:56.011 st Y wrath Fluffy_Pillow 34.0/100: 34% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage, kindled_soul(65)
1:56.991 st O warrior_of_elune Fluffy_Pillow 50.0/100: 50% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage, kindled_soul(60)
1:56.991 st X starsurge Fluffy_Pillow 50.0/100: 50% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage, kindled_soul(60)
1:57.970 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(55)
1:58.950 st Y wrath Fluffy_Pillow 44.0/100: 44% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(50)
1:59.928 st P starfire Fluffy_Pillow 54.0/100: 54% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip_static, corrupting_rage, kindled_soul(45)
2:00.683 st P starfire Fluffy_Pillow 72.8/100: 73% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(45)
2:01.438 st Q starsurge Fluffy_Pillow 91.6/100: 92% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, corrupting_rage, kindled_soul(40)
2:02.420 st R sunfire Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip_static, corrupting_rage, kindled_soul(35)
2:03.400 st Y wrath Fluffy_Pillow 65.6/100: 66% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(30)
2:04.379 st W cancel_buff Fluffy_Pillow 85.6/100: 86% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(25)
2:04.379 st Q starsurge Fluffy_Pillow 85.6/100: 86% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(25)
2:05.476 st Q starsurge Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(20)
2:06.531 st S moonfire Fluffy_Pillow 19.6/100: 20% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(15)
2:07.648 st Y wrath Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(28), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(10)
2:08.764 st Q starsurge Fluffy_Pillow 47.6/100: 48% astral_power eclipse_solar, primordial_arcanic_pulsar(28), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(5)
2:09.883 st Y wrath Fluffy_Pillow 13.6/100: 14% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, corrupting_rage
2:10.960 st Y wrath Fluffy_Pillow 31.6/100: 32% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, corrupting_rage
2:12.037 st X starsurge Fluffy_Pillow 49.6/100: 50% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, corrupting_rage
2:13.115 st Y wrath Fluffy_Pillow 13.6/100: 14% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn, best_friends_with_aerwynn_static, corrupting_rage
2:14.193 st Y wrath Fluffy_Pillow 29.6/100: 30% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, corrupting_rage
2:15.270 st X starsurge Fluffy_Pillow 47.6/100: 48% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage
2:16.348 st P starfire Fluffy_Pillow 11.6/100: 12% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, dreamstate, best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage
2:17.103 st P starfire Fluffy_Pillow 28.4/100: 28% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage
2:17.984 st W cancel_buff Fluffy_Pillow 42.4/100: 42% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage
2:17.984 st Q starsurge Fluffy_Pillow 42.4/100: 42% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage
2:19.082 st Q starsurge Fluffy_Pillow 40.4/100: 40% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_pip(8), best_friends_with_pip_static
2:20.137 st R sunfire Fluffy_Pillow 8.4/100: 8% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip(7), best_friends_with_pip_static
2:21.153 st Y wrath Fluffy_Pillow 18.4/100: 18% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip(6), best_friends_with_pip_static
2:22.168 st Q starsurge Fluffy_Pillow 38.4/100: 38% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip(5), best_friends_with_pip_static
2:23.287 st Y wrath Fluffy_Pillow 4.4/100: 4% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip(3), best_friends_with_pip_static
2:24.365 st Y wrath Fluffy_Pillow 24.4/100: 24% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip(2), best_friends_with_pip_static
2:25.443 st Y wrath Fluffy_Pillow 40.4/100: 40% astral_power balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip, best_friends_with_pip_static
2:26.521 st Y wrath Fluffy_Pillow 60.4/100: 60% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static
2:27.598 st X starsurge Fluffy_Pillow 78.4/100: 78% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(11), best_friends_with_urctos_static
2:28.674 st S moonfire Fluffy_Pillow 42.4/100: 42% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos(10), best_friends_with_urctos_static
2:29.752 st Y wrath Fluffy_Pillow 50.4/100: 50% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos(9), best_friends_with_urctos_static
2:30.830 st X starsurge Fluffy_Pillow 70.4/100: 70% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos(8), best_friends_with_urctos_static
2:31.907 st V full_moon Fluffy_Pillow 34.4/100: 34% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_urctos(7), best_friends_with_urctos_static
2:33.863 st Q starsurge Fluffy_Pillow 88.4/100: 88% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage
2:34.960 st Q starsurge Fluffy_Pillow 62.4/100: 62% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage
2:36.017 st Q starsurge Fluffy_Pillow 38.4/100: 38% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage
2:37.033 st R sunfire Fluffy_Pillow 12.4/100: 12% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage
2:38.013 st T new_moon Fluffy_Pillow 18.4/100: 18% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage
2:38.768 st Y wrath Fluffy_Pillow 30.4/100: 30% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage
2:39.750 st Y wrath Fluffy_Pillow 50.4/100: 50% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage
2:40.729 st X starsurge Fluffy_Pillow 68.4/100: 68% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage
2:41.708 st P starfire Fluffy_Pillow 40.4/100: 40% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
2:43.177 st O warrior_of_elune Fluffy_Pillow 58.4/100: 58% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(16), starlord(3), dreamstate(2), best_friends_with_urctos_static, corrupting_rage
2:43.177 st P starfire Fluffy_Pillow 58.4/100: 58% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, corrupting_rage
2:43.933 st Q starsurge Fluffy_Pillow 77.2/100: 77% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), warrior_of_elune(2), dreamstate, best_friends_with_urctos_static, corrupting_rage
2:44.914 st Y wrath Fluffy_Pillow 41.2/100: 41% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, corrupting_rage
2:45.669 st Y wrath Fluffy_Pillow 59.2/100: 59% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, corrupting_rage
2:46.649 st X starsurge Fluffy_Pillow 75.2/100: 75% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_urctos_static
2:47.629 st Y wrath Fluffy_Pillow 41.2/100: 41% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static
2:48.610 st Y wrath Fluffy_Pillow 63.2/100: 63% astral_power balance_of_all_things_nature(3), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static
2:49.590 st Q starsurge Fluffy_Pillow 79.2/100: 79% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static
2:50.796 st Q starsurge Fluffy_Pillow 45.2/100: 45% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord, warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static
2:51.956 st S moonfire Fluffy_Pillow 11.2/100: 11% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static
2:53.074 st Y wrath Fluffy_Pillow 17.2/100: 17% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static
2:54.193 st Y wrath Fluffy_Pillow 35.2/100: 35% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static
2:55.309 st Q starsurge Fluffy_Pillow 53.2/100: 53% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static
2:56.427 st R sunfire Fluffy_Pillow 17.2/100: 17% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static
2:57.503 st Y wrath Fluffy_Pillow 27.2/100: 27% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static
2:58.580 st P starfire Fluffy_Pillow 37.2/100: 37% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(2), dreamstate, best_friends_with_urctos_static
2:59.334 st P starfire Fluffy_Pillow 54.0/100: 54% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_urctos_static
3:00.088 default F natures_vigil buzzing_rune_3 72.8/100: 73% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(3), best_friends_with_urctos_static
3:00.088 st Q starsurge Fluffy_Pillow 72.8/100: 73% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(3), best_friends_with_urctos_static
3:01.069 st X starsurge Fluffy_Pillow 40.8/100: 41% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:01.977 st Y wrath Fluffy_Pillow 38.8/100: 39% astral_power natures_vigil, balance_of_all_things_nature(6), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:02.887 st N incarnation_chosen_of_elune Fluffy_Pillow 56.8/100: 57% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:02.887 st U half_moon Fluffy_Pillow 56.8/100: 57% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), dreamstate(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:03.990 st W cancel_buff Fluffy_Pillow 84.8/100: 85% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), dreamstate(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:03.990 st Q starsurge Fluffy_Pillow 84.8/100: 85% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, dreamstate(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:04.916 st Q starsurge Fluffy_Pillow 62.8/100: 63% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:05.894 st Q starsurge Fluffy_Pillow 34.8/100: 35% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:06.834 st V full_moon Fluffy_Pillow 10.8/100: 11% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:08.650 st Q starsurge Fluffy_Pillow 64.8/100: 65% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:09.560 st Q starsurge Fluffy_Pillow 38.8/100: 39% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:10.470 st Y wrath Fluffy_Pillow 12.8/100: 13% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, best_friends_with_urctos_static, wafting_devotion
3:11.224 st Q starsurge Fluffy_Pillow 28.8/100: 29% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, best_friends_with_urctos_static, wafting_devotion
3:12.135 st Y wrath Fluffy_Pillow 2.8/100: 3% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion
3:12.890 st R sunfire Fluffy_Pillow 18.8/100: 19% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion
3:13.800 st Q starsurge Fluffy_Pillow 28.8/100: 29% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(11), best_friends_with_pip_static, wafting_devotion
3:14.708 st S moonfire Fluffy_Pillow 0.8/100: 1% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(10), best_friends_with_pip_static, wafting_devotion
3:15.618 st Y wrath Fluffy_Pillow 10.8/100: 11% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, wafting_devotion
3:16.528 st Y wrath Fluffy_Pillow 26.8/100: 27% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(8), best_friends_with_pip_static, wafting_devotion
3:17.436 st Y wrath Fluffy_Pillow 42.8/100: 43% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(7), best_friends_with_pip_static, wafting_devotion
3:18.347 st Y wrath Fluffy_Pillow 62.8/100: 63% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(6), best_friends_with_pip_static, wafting_devotion
3:19.256 default E use_items Fluffy_Pillow 78.8/100: 79% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(5), best_friends_with_pip_static, wafting_devotion
3:19.256 st Q starsurge Fluffy_Pillow 78.8/100: 79% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(5), best_friends_with_pip_static, wafting_devotion, kindled_soul(100)
3:20.275 st Q starsurge Fluffy_Pillow 50.8/100: 51% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(4), best_friends_with_pip_static, wafting_devotion, kindled_soul(95)
3:21.256 st Y wrath Fluffy_Pillow 26.8/100: 27% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(3), best_friends_with_pip_static, wafting_devotion, kindled_soul(90)
3:22.199 st Q starsurge Fluffy_Pillow 42.8/100: 43% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(2), best_friends_with_pip_static, wafting_devotion, kindled_soul(90)
3:23.143 st Y wrath Fluffy_Pillow 14.8/100: 15% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip, best_friends_with_pip_static, wafting_devotion, kindled_soul(85)
3:24.052 st Y wrath Fluffy_Pillow 32.8/100: 33% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip, best_friends_with_pip_static, wafting_devotion, kindled_soul(80)
3:24.963 st Y wrath Fluffy_Pillow 48.8/100: 49% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, kindled_soul(75)
3:25.871 st T new_moon Fluffy_Pillow 66.8/100: 67% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(70)
3:26.627 st X starsurge Fluffy_Pillow 78.8/100: 79% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(65)
3:27.536 st Y wrath Fluffy_Pillow 52.8/100: 53% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(60)
3:28.445 st Y wrath Fluffy_Pillow 68.8/100: 69% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(55)
3:29.356 st X starsurge Fluffy_Pillow 84.8/100: 85% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(50)
3:30.335 st Y wrath Fluffy_Pillow 58.8/100: 59% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(45)
3:31.315 st R sunfire Fluffy_Pillow 74.8/100: 75% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(40)
3:32.295 st W cancel_buff Fluffy_Pillow 80.8/100: 81% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(35)
3:32.295 st Q starsurge Fluffy_Pillow 80.8/100: 81% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(35)
3:33.393 st Q starsurge Fluffy_Pillow 56.8/100: 57% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(30)
3:34.448 st Q starsurge Fluffy_Pillow 28.8/100: 29% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(25)
3:35.465 st S moonfire Fluffy_Pillow 0.8/100: 1% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(20)
3:36.445 st Y wrath Fluffy_Pillow 10.8/100: 11% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(15)
3:37.423 st Y wrath Fluffy_Pillow 28.8/100: 29% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(10)
3:38.400 st O warrior_of_elune Fluffy_Pillow 44.8/100: 45% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(5)
3:38.400 st Y wrath Fluffy_Pillow 44.8/100: 45% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(5)
3:39.380 st Y wrath Fluffy_Pillow 62.8/100: 63% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:40.359 st X starsurge Fluffy_Pillow 78.8/100: 79% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:41.268 st Y wrath Fluffy_Pillow 50.8/100: 51% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:42.177 st X starsurge Fluffy_Pillow 68.8/100: 69% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:43.084 st Y wrath Fluffy_Pillow 40.8/100: 41% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:43.995 st X starsurge Fluffy_Pillow 56.8/100: 57% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:44.905 st P starfire Fluffy_Pillow 28.8/100: 29% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:45.660 st P starfire Fluffy_Pillow 47.6/100: 48% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:46.417 st Y wrath Fluffy_Pillow 64.4/100: 64% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:47.325 st Q starsurge Fluffy_Pillow 84.4/100: 84% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, warrior_of_elune, best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:48.344 st Q starsurge Fluffy_Pillow 52.4/100: 52% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:49.234 st Q starsurge Fluffy_Pillow 28.4/100: 28% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:50.091 st R sunfire Fluffy_Pillow 2.4/100: 2% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:50.917 st U half_moon Fluffy_Pillow 8.4/100: 8% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:52.129 st Q starsurge Fluffy_Pillow 40.4/100: 40% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:53.039 st Y wrath Fluffy_Pillow 12.4/100: 12% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:53.947 st Q starsurge Fluffy_Pillow 28.4/100: 28% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:54.857 st Y wrath Fluffy_Pillow 2.4/100: 2% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:55.766 st Y wrath Fluffy_Pillow 18.4/100: 18% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:56.746 st S moonfire Fluffy_Pillow 36.4/100: 36% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:57.723 st X starsurge Fluffy_Pillow 44.4/100: 44% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:58.704 st Y wrath Fluffy_Pillow 16.4/100: 16% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:59.682 st P starfire Fluffy_Pillow 26.4/100: 26% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune, dreamstate, best_friends_with_pip_static
4:00.435 st P starfire Fluffy_Pillow 47.2/100: 47% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_pip_static
4:01.316 st W cancel_buff Fluffy_Pillow 59.2/100: 59% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), best_friends_with_pip_static
4:01.316 st Q starsurge Fluffy_Pillow 59.2/100: 59% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, best_friends_with_pip_static
4:02.410 st Q starsurge Fluffy_Pillow 57.2/100: 57% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_pip_static
4:03.466 st Y wrath Fluffy_Pillow 23.2/100: 23% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static
4:04.482 st Q starsurge Fluffy_Pillow 43.2/100: 43% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static
4:05.498 st Y wrath Fluffy_Pillow 9.2/100: 9% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static
4:06.576 st Y wrath Fluffy_Pillow 29.2/100: 29% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static
4:07.653 st R sunfire Fluffy_Pillow 45.2/100: 45% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip(11), best_friends_with_pip_static
4:08.730 st Y wrath Fluffy_Pillow 51.2/100: 51% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip(10), best_friends_with_pip_static
4:09.808 st Y wrath Fluffy_Pillow 71.2/100: 71% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip(9), best_friends_with_pip_static
4:10.885 st X starsurge Fluffy_Pillow 89.2/100: 89% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip(8), best_friends_with_pip_static
4:11.962 st Y wrath Fluffy_Pillow 53.2/100: 53% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip(7), best_friends_with_pip_static
4:13.041 st Y wrath Fluffy_Pillow 71.2/100: 71% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip(6), best_friends_with_pip_static
4:14.120 st X starsurge Fluffy_Pillow 87.2/100: 87% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip(5), best_friends_with_pip_static, corrupting_rage
4:15.198 st P starfire Fluffy_Pillow 53.2/100: 53% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage
4:16.814 st P starfire Fluffy_Pillow 65.2/100: 65% astral_power natures_grace, primordial_arcanic_pulsar(40), dreamstate, best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage
4:17.802 st Q starsurge Fluffy_Pillow 79.2/100: 79% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, dreamstate, best_friends_with_pip, best_friends_with_pip_static, corrupting_rage
4:18.897 st Q starsurge Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, balance_t31_4pc_buff_solar, dreamstate, best_friends_with_pip_static, corrupting_rage
4:19.953 st S moonfire Fluffy_Pillow 17.2/100: 17% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), dreamstate, best_friends_with_pip_static, corrupting_rage
4:20.967 st Y wrath Fluffy_Pillow 25.2/100: 25% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, corrupting_rage
4:21.721 st Q starsurge Fluffy_Pillow 43.2/100: 43% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, corrupting_rage
4:22.737 st Y wrath Fluffy_Pillow 9.2/100: 9% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
4:23.816 st Y wrath Fluffy_Pillow 27.2/100: 27% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
4:24.894 st R sunfire Fluffy_Pillow 47.2/100: 47% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
4:25.971 st O warrior_of_elune Fluffy_Pillow 53.2/100: 53% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
4:25.971 st Y wrath Fluffy_Pillow 53.2/100: 53% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
4:27.051 st Y wrath Fluffy_Pillow 71.2/100: 71% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
4:28.127 st X starsurge Fluffy_Pillow 89.2/100: 89% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
4:29.206 st Y wrath Fluffy_Pillow 55.2/100: 55% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
4:30.282 default F natures_vigil buzzing_rune_3 73.2/100: 73% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
4:30.282 st X starsurge Fluffy_Pillow 73.2/100: 73% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
4:31.359 st V full_moon Fluffy_Pillow 39.2/100: 39% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
4:33.316 st Q starsurge Fluffy_Pillow 97.2/100: 97% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
4:34.412 st Q starsurge Fluffy_Pillow 71.2/100: 71% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
4:35.465 st Q starsurge Fluffy_Pillow 47.2/100: 47% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
4:36.480 st T new_moon Fluffy_Pillow 21.2/100: 21% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(11), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:37.234 st Q starsurge Fluffy_Pillow 33.2/100: 33% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(11), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:38.143 st Y wrath Fluffy_Pillow 9.2/100: 9% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(10), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:39.052 st Y wrath Fluffy_Pillow 29.2/100: 29% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:39.961 st X starsurge Fluffy_Pillow 45.2/100: 45% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(8), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:40.868 st S moonfire Fluffy_Pillow 17.2/100: 17% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(7), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:41.778 st Y wrath Fluffy_Pillow 23.2/100: 23% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(6), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:42.688 st P starfire Fluffy_Pillow 35.2/100: 35% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:43.441 st P starfire Fluffy_Pillow 52.0/100: 52% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_pip(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:44.196 st Q starsurge Fluffy_Pillow 68.8/100: 69% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_pip(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:45.106 st R sunfire Fluffy_Pillow 36.8/100: 37% astral_power natures_vigil, balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:46.016 st X starsurge Fluffy_Pillow 76.8/100: 77% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:46.926 st Y wrath Fluffy_Pillow 42.8/100: 43% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip, best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:47.835 st Y wrath Fluffy_Pillow 60.8/100: 61% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:48.746 st Q starsurge Fluffy_Pillow 82.8/100: 83% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(28), solstice, warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:49.864 st Q starsurge Fluffy_Pillow 48.8/100: 49% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(32), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:50.941 st Y wrath Fluffy_Pillow 12.8/100: 13% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:51.978 st Y wrath Fluffy_Pillow 30.8/100: 31% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
4:53.096 st Q starsurge Fluffy_Pillow 46.8/100: 47% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
4:54.212 st Y wrath Fluffy_Pillow 16.8/100: 17% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
4:55.288 st Y wrath Fluffy_Pillow 32.8/100: 33% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
4:56.364 st Y wrath Fluffy_Pillow 48.8/100: 49% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
4:57.443 st P starfire Fluffy_Pillow 66.8/100: 67% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
4:59.057 default E use_items Fluffy_Pillow 80.8/100: 81% astral_power natures_grace, primordial_arcanic_pulsar(40), starlord(3), dreamstate(2), best_friends_with_pip_static, corrupting_rage
4:59.057 st P starfire Fluffy_Pillow 80.8/100: 81% astral_power natures_grace, primordial_arcanic_pulsar(40), starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
4:59.939 st X starsurge Fluffy_Pillow 92.8/100: 93% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
5:00.918 st R sunfire Fluffy_Pillow 60.8/100: 61% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, dreamstate, best_friends_with_pip_static, corrupting_rage, kindled_soul(95)
5:01.897 st Y wrath Fluffy_Pillow 70.8/100: 71% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_pip_static, corrupting_rage, kindled_soul(90)
5:02.651 default D potion Fluffy_Pillow 88.8/100: 89% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_pip_static, corrupting_rage, kindled_soul(85)
5:02.692 st W cancel_buff Fluffy_Pillow 88.8/100: 89% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
5:02.692 st Q starsurge Fluffy_Pillow 88.8/100: 89% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, balance_t31_4pc_buff_solar, best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
5:03.790 st Q starsurge Fluffy_Pillow 56.8/100: 57% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
5:04.845 st S moonfire Fluffy_Pillow 22.8/100: 23% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
5:05.964 st Y wrath Fluffy_Pillow 30.8/100: 31% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
5:07.079 st Q starsurge Fluffy_Pillow 48.8/100: 49% astral_power balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
5:08.197 st Y wrath Fluffy_Pillow 12.8/100: 13% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
5:09.275 st U half_moon Fluffy_Pillow 32.8/100: 33% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
5:10.710 st Y wrath Fluffy_Pillow 56.8/100: 57% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
5:11.788 st O warrior_of_elune Fluffy_Pillow 74.8/100: 75% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
5:11.788 st X starsurge Fluffy_Pillow 74.8/100: 75% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
5:12.867 st Q starsurge Fluffy_Pillow 42.8/100: 43% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
5:13.847 st V full_moon Fluffy_Pillow 16.8/100: 17% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
5:15.802 st W cancel_buff Fluffy_Pillow 74.8/100: 75% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
5:15.802 st Q starsurge Fluffy_Pillow 74.8/100: 75% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
5:16.897 st Q starsurge Fluffy_Pillow 52.8/100: 53% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
5:17.951 st Y wrath Fluffy_Pillow 24.8/100: 25% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)

Stats

Level Bonus (70) Race Bonus (tauren) Raid-Buffed Unbuffed Gear Amount
Strength 898 2 986 900 0
Agility 2089 -2 2173 2087 0
Stamina 3848 2 44833 42698 38825
Intellect 2089 -2 15807 14885 12090 (7538)
Spirit 0 0 0 0 0
Health 896660 896660 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 15807 14885 0
Crit 30.23% 24.02% 3424
Haste 24.78% 24.78% 4212
Versatility 6.30% 1.30% 267
Mana Regen 2560 2560 0
Attack Power 16439 15480 0
Mastery 29.91% 29.91% 7842
Armor 5324 5324 5324
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 489.00
Local Head Benevolent Embersage's Casque
ilevel: 489, stats: { 673 Armor, +3966 Sta, +704 Crit, +330 Haste, +938 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }, enchant: incandescent_essence
Local Neck Eye of the Rising Flame
ilevel: 489, stats: { +2231 Sta, +256 Haste, +1537 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Life-Bound Shoulderpads
ilevel: 486, stats: { 603 Armor, +2875 Sta, +383 Mastery, +383 Haste, +684 AgiInt }
item effects: { equip: Toxified }
Local Chest Benevolent Embersage's Robe
ilevel: 489, stats: { 897 Armor, +3966 Sta, +715 Crit, +318 Mastery, +938 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 489, stats: { 505 Armor, +2975 Sta, +535 Haste, +241 Mastery, +704 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 489, stats: { 785 Armor, +3966 Sta, +705 Haste, +328 Mastery, +938 AgiInt }, enchant: { +155 StrAgiInt, +41 Vers (lambent_armor_kit_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 486, stats: { 548 Armor, +2875 Sta, +274 Crit, +438 Haste, +684 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Thermal Bindings
ilevel: 489, stats: { 449 Armor, +2231 Sta, +191 Crit, +390 Mastery, +528 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Benevolent Embersage's Talons
ilevel: 489, stats: { 505 Armor, +2975 Sta, +226 Vers, +549 Mastery, +704 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 489, stats: { +2231 Sta, +512 Haste, +1281 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 489, stats: { +2231 Sta, +1230 Crit, +564 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 489, stats: { +892 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 489, stats: { +738 Mastery }
item effects: { use: Balefire Branch }
Local Back Drape of the Loyal Vassal
ilevel: 489, stats: { 359 Armor, +2231 Sta, +328 Haste, +253 Mastery, +528 StrAgiInt }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 489, weapon: { 606 - 781, 2.6 }, stats: { +469 Int, +2264 Int, +1983 Sta, +156 Haste, +361 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Buzzing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 489, stats: { +1439 Int, +1983 Sta, +174 Haste, +343 Mastery }

Profile

druid="buzzing_rune_3"
source=default
spec=balance
level=70
race=tauren
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:buzzing_rune_3

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=489,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=489,gem_id=192961/192961/192961
shoulders=lifebound_shoulderpads,id=193406,bonus_id=8836/1576/8797/8960,ilevel=486,crafted_stats=49/36
back=drape_of_the_loyal_vassal,id=158375,bonus_id=4795,ilevel=489
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=489,enchant_id=6625
wrists=thermal_bindings,id=134461,bonus_id=4795,ilevel=489,gem_id=192961
hands=benevolent_embersages_talons,id=207255,bonus_id=4795,ilevel=489
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=489,enchant_id=6830
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=486
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=489
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=489
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=489,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=489

# Gear Summary
# gear_ilvl=488.63
# gear_stamina=38825
# gear_intellect=12090
# gear_crit_rating=3424
# gear_haste_rating=4212
# gear_mastery_rating=7842
# gear_versatility_rating=267
# gear_armor=5324
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

hissing_rune_3 : 249073 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
249072.7 249072.7 124.4 / 0.050% 36060.9 / 14.5% 19678.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.2 12.2 Astral Power 0.00% 67.2 100.0% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
hissing_rune_3 249073
Astral Smolder 17689 7.1% 66.9 4.45s 79267 0 Periodic 118.4 44758 0 44758 0.0% 78.9%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 66.86 0.00 118.41 118.41 51.50 0.0000 2.0000 5299635.94 5299635.94 0.00% 22379.18 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 118.41 73 163 44757.63 9495 163189 44777.60 33573 59384 5299636 5299636 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Denizen of the Dream 0 (7854) 0.0% (3.2%) 8.6 31.76s 273233 0

Stats Details: Denizen Of The Dream

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.62 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Denizen Of The Dream

  • id:394065
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394065
  • name:Denizen of the Dream
  • school:physical
  • tooltip:
  • description:Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.
    Fey Missile 21677  / 7854 3.2% 152.8 1.70s 15410 12016 Direct 151.9 11842 24596 15505 28.7%

Stats Details: Fey Missile

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 152.84 151.91 0.00 0.00 0.00 1.2825 0.0000 2355309.50 2355309.50 0.00% 12015.72 12015.72
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.28% 108.28 21 277 11841.82 7755 20667 11833.45 10468 14183 1282272 1282272 0.00%
crit 28.72% 43.63 4 111 24595.69 17191 42501 24581.42 21622 32237 1073037 1073037 0.00%

Action Details: Fey Missile

  • id:188046
  • school:astral
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.248
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.236000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:188046
  • name:Fey Missile
  • school:astral
  • tooltip:
  • description:{$@spelldesc187875=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$188083d=30 seconds}.}

Action Priority List

    default
    [ ]:17532.06
Hungering Shadowflame 3911 1.6% 17.4 16.67s 67290 0 Direct 17.4 51768 105635 67286 28.8%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.44 17.44 0.00 0.00 0.00 0.0000 0.0000 1173395.52 1173395.52 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.19% 12.41 2 27 51767.80 34936 202233 51584.12 34936 140663 642627 642627 0.00%
crit 28.81% 5.02 0 16 105634.93 71270 412555 104593.44 0 389138 530768 530768 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:31299.68
  • base_dd_max:31299.68
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 7145 2.9% 34.4 8.51s 62271 0 Direct 34.3 48084 98019 62432 28.7%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.41 34.32 0.00 0.00 0.00 0.0000 0.0000 2142673.86 2142673.86 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.27% 24.46 8 46 48084.02 47503 54996 48084.40 47503 50167 1176125 1176125 0.00%
crit 28.73% 9.86 0 25 98019.40 96907 112191 98019.22 0 109221 966549 966549 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42559.30
  • base_dd_max:42559.30
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 12988 5.2% 14.3 21.60s 271153 281124 Direct 14.3 9290 19441 12943 36.0%
Periodic 312.3 8412 17910 11864 36.3% 99.5%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.35 14.35 312.30 312.30 13.35 0.9646 0.9561 3890752.71 3890752.71 0.00% 12453.40 281123.75
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 64.01% 9.18 1 17 9289.98 6019 17661 9290.58 7353 12376 85330 85330 0.00%
crit 35.99% 5.16 0 13 19441.11 12279 36442 19396.45 0 29499 100392 100392 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 63.66% 198.81 133 273 8411.94 661 15541 8416.13 7911 9094 1672377 1672377 0.00%
crit 36.34% 113.49 68 166 17910.28 186 31704 17921.72 16621 19562 2032654 2032654 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    st
    [K]:1.25
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [S]:13.10
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
New Moon (Talent) 0 (23485) 0.0% (9.4%) 17.0 17.95s 413840 349321

Stats Details: Moons Talent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.01 0.00 0.00 0.00 0.00 1.1847 0.0000 0.00 0.00 0.00% 349320.56 349320.56

Action Details: Moons Talent

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
    Full Moon 8584 3.5% 5.3 62.93s 486518 264748 Direct 5.3 331306 663358 489317 47.6%

Stats Details: Full Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.30 5.27 0.00 0.00 0.00 1.8378 0.0000 2580499.04 2580499.04 0.00% 264748.03 264748.03
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.42% 2.76 0 6 331305.52 200315 547757 324064.44 0 527124 915784 915784 0.00%
crit 47.58% 2.51 0 6 663358.47 408643 1121372 635974.97 0 1121372 1664715 1664715 0.00%

Action Details: Full Moon

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:50.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Action Priority List

    st
    [V]:5.36
  • if_expr:astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    New Moon 6388 2.6% 6.0 53.57s 317250 420515 Direct 6.0 204216 436594 319118 49.4%

Stats Details: New Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.02 5.98 0.00 0.00 0.00 0.7545 0.0000 1909559.01 1909559.01 0.00% 420515.09 420515.09
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 50.56% 3.03 0 7 204216.12 99252 323745 200914.51 0 302834 617794 617794 0.00%
crit 49.44% 2.96 0 7 436593.73 202474 644464 432721.26 0 626685 1291765 1291765 0.00%

Action Details: New Moon

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Action Priority List

    st
    [T]:6.03
  • if_expr:astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Half Moon 8514 3.4% 5.7 57.87s 448270 368996 Direct 5.7 287386 583322 450644 55.2%

Stats Details: Half Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.69 5.66 0.00 0.00 0.00 1.2150 0.0000 2550497.84 2550497.84 0.00% 368995.64 368995.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 44.82% 2.54 0 7 287385.77 144547 454175 276791.71 0 452868 728926 728926 0.00%
crit 55.18% 3.12 0 7 583321.95 320162 926517 576038.60 0 889094 1821572 1821572 0.00%

Action Details: Half Moon

  • id:274282
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:24.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.875000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274282
  • name:Half Moon
  • school:astral
  • tooltip:
  • description:Deals {$s1=0} Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates {$=}{{$m3=240}/10} Astral Power.|r

Action Priority List

    st
    [U]:5.71
  • if_expr:astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (21812) 0.0% (8.8%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 8136 3.3% 95.4 3.12s 25552 0 Direct 95.2 16931 36202 25621 45.1%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 95.44 95.18 0.00 0.00 0.00 0.0000 0.0000 2438736.86 2438736.86 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.91% 52.26 23 88 16931.02 10173 33603 16937.01 14927 19676 884881 884881 0.00%
crit 45.09% 42.92 19 73 36202.25 20754 68550 36217.24 31227 44104 1553856 1553856 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 8161 3.3% 95.8 3.11s 25536 0 Direct 95.6 16903 36186 25605 45.1%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 95.81 95.55 0.00 0.00 0.00 0.0000 0.0000 2446630.53 2446630.53 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.87% 52.43 26 92 16902.81 10069 33603 16908.15 14662 19257 886198 886198 0.00%
crit 45.13% 43.12 18 74 36186.37 20540 68550 36199.87 31390 41985 1560432 1560432 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 5515 2.2% 6.4 47.57s 259421 0 Direct 6.4 171430 366655 260198 45.5%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.37 6.35 0.00 0.00 0.00 0.0000 0.0000 1653264.69 1653264.69 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.53% 3.46 0 8 171430.10 101668 335076 170103.91 0 323022 593885 593885 0.00%
crit 45.47% 2.89 0 8 366654.87 207402 676543 358522.99 0 656468 1059380 1059380 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 5944 2.4% 26.0 11.49s 68605 76169 Direct 27.0 46083 93982 66069 41.7%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.04 27.04 0.00 0.00 0.00 0.9007 0.0000 1786392.37 1786392.37 0.00% 76169.03 76169.03
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.28% 15.76 4 30 46083.43 20672 96196 46082.65 36478 54926 726157 726157 0.00%
crit 41.72% 11.28 2 23 93981.79 42172 184034 93951.81 60190 117656 1060235 1060235 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    st
    [L]:1.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
    st
    [P]:25.09
  • if_expr:variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Warrior of Elune2024251-1.000Spell DataNo-stacks
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Starsurge 79903 (107874) 32.1% (43.3%) 116.4 2.56s 277495 282924 Direct 116.1 (154.4) 139127 293920 205978 43.2% (43.7%)

Stats Details: Starsurge

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 116.38 116.13 0.00 0.00 0.00 0.9808 0.0000 23921125.32 23921125.32 0.00% 282923.56 282923.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.81% 65.98 38 95 139127.25 93001 267120 139204.06 125482 153607 9179457 9179457 0.00%
crit 43.19% 50.16 25 79 293920.05 185852 544925 294150.78 261492 334987 14741668 14741668 0.00%

Action Details: Starsurge

  • id:78674
  • school:astral
  • range:45.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:36.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.455000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.18

Spelldata

  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$s1=0} Astral damage.

Action Priority List

    st
    [Q]:83.39
  • if_expr:variable.starsurge_condition1
    st
    [X]:32.99
  • if_expr:variable.starsurge_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Flat Cost Incarnation: Chosen of Elune1025603-8.000Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Goldrinn's Fang 27971 11.2% 38.4 7.72s 218041 0 Direct 38.2 146388 307311 219109 45.2%

Stats Details: Goldrinns Fang

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.41 38.22 0.00 0.00 0.00 0.0000 0.0000 8374033.48 8374033.48 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.81% 20.95 5 43 146387.98 97247 279315 146453.17 120859 179176 3066472 3066472 0.00%
crit 45.19% 17.27 4 35 307311.04 198384 569803 307494.65 247869 400493 5307562 5307562 0.00%

Action Details: Goldrinns Fang

  • id:394047
  • school:astral
  • range:60.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.852000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10

Spelldata

  • id:394047
  • name:Goldrinn's Fang
  • school:astral
  • tooltip:Deals {$m1=0} Arcane damage.
  • description:Deals {$m1=0} Arcane damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountPower of Goldrinn3940462PCT1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Friend of the Fae39408310.100Spell Data
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Incarnation: Chosen of Elune10256020.100Spell Data
Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Dot / Debuff on Target Moonfire16481250.283Mastery
Sunfire16481550.283Mastery
Waning Twilight39395710.100
Sunfire 13017 5.2% 17.4 18.04s 224323 232593 Direct 17.4 9302 19200 13195 39.3%
Periodic 313.3 8297 17159 11724 38.7% 99.8%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.40 17.40 313.27 313.27 16.39 0.9645 0.9561 3902207.79 3902207.79 0.00% 12337.44 232592.70
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 60.67% 10.55 2 20 9301.83 5472 16657 9293.03 7369 11181 98173 98173 0.00%
crit 39.33% 6.84 0 16 19199.74 11163 33357 19198.40 0 28289 131358 131358 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 61.33% 192.14 128 256 8296.98 1324 14727 8296.43 7857 8807 1594144 1594144 0.00%
crit 38.67% 121.13 73 181 17158.90 3758 30043 17160.68 16048 18658 2078533 2078533 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    st
    [J]:1.44
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [R]:15.95
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (4126) 0.0% (1.7%) 8.6 31.56s 144167 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.58 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 2148 0.9% 8.6 31.56s 75048 0 Direct 8.6 57827 117844 75045 28.7%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.58 8.58 0.00 0.00 0.00 0.0000 0.0000 644231.52 644231.52 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.31% 6.12 0 19 57827.26 57075 66076 57789.30 0 66076 353974 353974 0.00%
crit 28.69% 2.46 0 12 117844.19 116432 134796 108624.95 0 134796 290257 290257 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:51134.41
  • base_dd_max:51134.41
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 1978 0.8% 16.6 15.37s 35693 0 Direct 16.6 27499 56056 35694 28.7%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.62 16.62 0.00 0.00 0.00 0.0000 0.0000 593343.27 593343.27 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.31% 11.85 1 33 27499.12 27158 31441 27498.02 27158 30371 325955 325955 0.00%
crit 28.69% 4.77 0 19 56056.04 55402 64140 55430.21 0 64140 267389 267389 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24330.91
  • base_dd_max:24330.91
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 23226 9.3% 117.3 2.50s 59313 63047 Direct 116.9 39048 82127 59533 47.6%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.31 116.88 0.00 0.00 0.00 0.9408 0.0000 6958335.07 6958335.07 0.00% 63046.67 63046.67
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.45% 61.30 34 93 39048.30 15177 129592 39053.75 34161 45476 2393614 2393614 0.00%
crit 47.55% 55.58 26 83 82126.79 30962 264369 82158.31 69790 95980 4564721 4564721 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    st
    [M]:0.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
    st
    [Y]:115.63

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.400Spell Data
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
hissing_rune_3
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:hissing_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:hissing_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:hissing_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 190.51s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    st
    [N]:2.00
  • if_expr:variable.cd_condition_st

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.7 68.75s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.66 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:hissing_rune_3
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:70932.17
  • base_dd_max:70932.17
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.34s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.75 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:hissing_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.75
Elemental Potion of Ultimate Power 1.5 306.65s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.47
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
Warrior of Elune 6.1 49.03s

Stats Details: Warrior Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.09 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Warrior Of Elune

  • id:202425
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202425
  • name:Warrior of Elune
  • school:arcane
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.

Action Priority List

    st
    [O]:6.09
  • if_expr:variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 8.8 1.4 35.8s 33.6s 8.5s 25.05% 29.05% 1.4 (7.1) 8.6

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 50.8s
  • trigger_min/max:2.7s / 50.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:22.18% / 27.79%

Stack Uptimes

  • balance_of_all_things_arcane_1:2.88%
  • balance_of_all_things_arcane_2:2.93%
  • balance_of_all_things_arcane_3:3.00%
  • balance_of_all_things_arcane_4:3.03%
  • balance_of_all_things_arcane_5:3.06%
  • balance_of_all_things_arcane_6:3.30%
  • balance_of_all_things_arcane_7:3.42%
  • balance_of_all_things_arcane_8:3.43%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 18.3 3.2 16.8s 14.2s 8.3s 50.65% 54.68% 3.2 (18.7) 17.7

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.4s
  • trigger_min/max:0.0s / 40.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.2s
  • uptime_min/max:44.69% / 54.60%

Stack Uptimes

  • balance_of_all_things_nature_1:5.92%
  • balance_of_all_things_nature_2:6.00%
  • balance_of_all_things_nature_3:6.11%
  • balance_of_all_things_nature_4:6.21%
  • balance_of_all_things_nature_5:6.35%
  • balance_of_all_things_nature_6:6.50%
  • balance_of_all_things_nature_7:6.66%
  • balance_of_all_things_nature_8:6.90%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 7.2 62.7 44.4s 4.2s 20.2s 48.50% 0.00% 34.9 (34.9) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.6s
  • trigger_min/max:0.8s / 43.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:42.77% / 55.00%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:4.66%
  • balance_t31_4pc_buff_lunar_2:4.34%
  • balance_t31_4pc_buff_lunar_3:4.93%
  • balance_t31_4pc_buff_lunar_4:5.62%
  • balance_t31_4pc_buff_lunar_5:28.95%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 14.1 102.3 21.9s 2.6s 19.2s 90.47% 0.00% 48.5 (48.5) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 58.1s
  • trigger_min/max:0.8s / 11.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:86.90% / 92.93%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:7.61%
  • balance_t31_4pc_buff_solar_2:11.60%
  • balance_t31_4pc_buff_solar_3:16.04%
  • balance_t31_4pc_buff_solar_4:11.68%
  • balance_t31_4pc_buff_solar_5:43.54%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 70.6s 70.6s 10.8s 10.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 340.5s
  • trigger_min/max:12.0s / 340.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 36.44%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.89%
  • best_friends_with_aerwynn_2:0.90%
  • best_friends_with_aerwynn_3:0.90%
  • best_friends_with_aerwynn_4:0.90%
  • best_friends_with_aerwynn_5:0.91%
  • best_friends_with_aerwynn_6:0.91%
  • best_friends_with_aerwynn_7:0.91%
  • best_friends_with_aerwynn_8:0.92%
  • best_friends_with_aerwynn_9:0.92%
  • best_friends_with_aerwynn_10:0.92%
  • best_friends_with_aerwynn_11:0.93%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 114.6s 70.6s 45.7s 33.37% 0.00% 69.6 (69.6) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 352.8s
  • trigger_min/max:12.0s / 340.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 341.0s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.37%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.3s 70.3s 10.8s 10.02% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 344.6s
  • trigger_min/max:12.0s / 344.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 37.02%

Stack Uptimes

  • best_friends_with_pip_1:0.90%
  • best_friends_with_pip_2:0.90%
  • best_friends_with_pip_3:0.90%
  • best_friends_with_pip_4:0.90%
  • best_friends_with_pip_5:0.91%
  • best_friends_with_pip_6:0.91%
  • best_friends_with_pip_7:0.91%
  • best_friends_with_pip_8:0.92%
  • best_friends_with_pip_9:0.92%
  • best_friends_with_pip_10:0.92%
  • best_friends_with_pip_11:0.93%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 113.8s 70.3s 45.5s 33.22% 0.00% 69.4 (69.4) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 357.5s
  • trigger_min/max:12.0s / 344.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 337.5s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.22%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 70.2s 70.2s 10.8s 10.02% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 338.3s
  • trigger_min/max:12.0s / 338.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 38.74%

Stack Uptimes

  • best_friends_with_urctos_1:0.90%
  • best_friends_with_urctos_2:0.90%
  • best_friends_with_urctos_3:0.90%
  • best_friends_with_urctos_4:0.90%
  • best_friends_with_urctos_5:0.91%
  • best_friends_with_urctos_6:0.91%
  • best_friends_with_urctos_7:0.91%
  • best_friends_with_urctos_8:0.92%
  • best_friends_with_urctos_9:0.92%
  • best_friends_with_urctos_10:0.92%
  • best_friends_with_urctos_11:0.93%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 113.9s 70.2s 45.8s 33.41% 0.00% 69.4 (69.4) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 352.7s
  • trigger_min/max:12.0s / 338.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 319.1s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.41%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.51% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.51%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 61.9s 58.3s 49.9s 80.10% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 354.0s
  • trigger_min/max:15.0s / 295.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 357.7s
  • uptime_min/max:46.69% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.10%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Denizen of the Dream 8.6 0.0 44.9s 31.7s 41.3s 57.63% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_denizen_of_the_dream
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 250.7s
  • trigger_min/max:0.0s / 145.3s
  • trigger_pct:99.98%
  • duration_min/max:0.0s / 231.5s
  • uptime_min/max:20.48% / 94.98%

Stack Uptimes

  • denizen_of_the_dream_1:38.60%
  • denizen_of_the_dream_2:14.60%
  • denizen_of_the_dream_3:3.65%
  • denizen_of_the_dream_4:0.68%
  • denizen_of_the_dream_5:0.10%
  • denizen_of_the_dream_6:0.02%
  • denizen_of_the_dream_7:0.00%
  • denizen_of_the_dream_8:0.00%

Spelldata

  • id:394076
  • name:Denizen of the Dream
  • tooltip:
  • description:{$@spelldesc394065=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Dreamstate 15.3 0.6 20.2s 20.6s 3.0s 15.53% 20.81% 0.6 (1.2) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 56.3s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:8.35% / 27.33%

Stack Uptimes

  • dreamstate_1:9.56%
  • dreamstate_2:5.97%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 7.2 1.0 44.8s 44.4s 20.6s 49.52% 52.70% 1.0 (1.0) 6.8

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.6s
  • trigger_min/max:12.0s / 89.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:44.10% / 56.12%

Stack Uptimes

  • eclipse_lunar_1:49.52%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 13.9 5.5 22.3s 15.7s 20.1s 93.01% 96.19% 5.5 (5.5) 12.9

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 70.6s
  • trigger_min/max:0.0s / 55.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.0s
  • uptime_min/max:90.76% / 95.33%

Stack Uptimes

  • eclipse_solar_1:93.01%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 307.0s 307.0s 27.4s 13.21% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.3s
  • trigger_min/max:300.0s / 328.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.88% / 18.03%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.21%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Friend of the Fae 5.3 3.4 55.4s 31.7s 25.0s 43.76% 43.71% 3.4 (3.4) 4.8

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_friend_of_the_fae
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 207.9s
  • trigger_min/max:0.0s / 145.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 137.7s
  • uptime_min/max:13.66% / 81.00%

Stack Uptimes

  • friend_of_the_fae_1:43.76%

Spelldata

  • id:394083
  • name:Friend of the Fae
  • tooltip:Arcane and Nature damage increased by {$=}w1%.
  • description:{$@spelldesc394081=When a Faerie Dragon is summoned, your spells deal {$394083m1=10}% increased damage for {$394083d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 7.2 0.0 44.4s 44.4s 20.3s 48.62% 51.43% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.6s
  • trigger_min/max:12.0s / 89.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:43.35% / 55.00%

Stack Uptimes

  • incarnation_chosen_of_elune_1:48.62%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.6 0.0 99.2s 99.2s 19.5s 23.33% 0.00% 0.0 (0.0) 3.2

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:65.76

Trigger Details

  • interval_min/max:90.0s / 124.6s
  • trigger_min/max:90.0s / 124.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.30% / 26.28%

Stack Uptimes

  • kindled_soul_5:1.11%
  • kindled_soul_10:1.14%
  • kindled_soul_15:1.15%
  • kindled_soul_20:1.15%
  • kindled_soul_25:1.15%
  • kindled_soul_30:1.16%
  • kindled_soul_35:1.16%
  • kindled_soul_40:1.16%
  • kindled_soul_45:1.16%
  • kindled_soul_50:1.17%
  • kindled_soul_55:1.17%
  • kindled_soul_60:1.17%
  • kindled_soul_65:1.17%
  • kindled_soul_70:1.18%
  • kindled_soul_75:1.18%
  • kindled_soul_80:1.18%
  • kindled_soul_85:1.19%
  • kindled_soul_90:1.19%
  • kindled_soul_95:1.19%
  • kindled_soul_100:1.19%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Grace 12.9 0.0 20.5s 20.5s 5.9s 25.49% 0.00% 0.0 (0.0) 12.6

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.8s / 70.6s
  • trigger_min/max:12.8s / 70.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:20.20% / 30.24%

Stack Uptimes

  • natures_grace_1:25.49%

Spelldata

  • id:393959
  • name:Nature's Grace
  • tooltip:Haste increased by {$s1=10}%.
  • description:{$@spelldesc393958=After an Eclipse ends, you gain {$393959s1=10}% Haste for {$393959d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Vigil 3.7 0.0 90.3s 90.3s 14.7s 18.42% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.9s
  • trigger_min/max:90.0s / 91.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.55% / 21.04%

Stack Uptimes

  • natures_vigil_1:18.42%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.1 74.3s 68.1s 7.7s 6.41% 7.10% 0.1 (0.1) 1.3

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 343.2s
  • trigger_min/max:0.0s / 340.8s
  • trigger_pct:15.07%
  • duration_min/max:0.0s / 29.3s
  • uptime_min/max:0.00% / 28.31%

Stack Uptimes

  • owlkin_frenzy_1:6.41%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 8.2 109.1 38.5s 38.5s 34.4s 94.05% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:24.0s / 50.2s
  • trigger_min/max:24.0s / 50.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.7s
  • uptime_min/max:90.71% / 96.85%

Stack Uptimes

  • primordial_arcanic_pulsar_4:4.98%
  • primordial_arcanic_pulsar_8:5.32%
  • primordial_arcanic_pulsar_12:6.71%
  • primordial_arcanic_pulsar_16:6.77%
  • primordial_arcanic_pulsar_20:6.62%
  • primordial_arcanic_pulsar_24:6.09%
  • primordial_arcanic_pulsar_28:7.03%
  • primordial_arcanic_pulsar_32:8.31%
  • primordial_arcanic_pulsar_36:6.59%
  • primordial_arcanic_pulsar_40:7.18%
  • primordial_arcanic_pulsar_44:7.27%
  • primordial_arcanic_pulsar_48:6.86%
  • primordial_arcanic_pulsar_52:7.66%
  • primordial_arcanic_pulsar_56:6.67%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 18.7 3.8 16.6s 14.2s 6.4s 39.64% 39.84% 3.8 (3.8) 18.2

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 49.6s
  • trigger_min/max:0.0s / 40.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.9s
  • uptime_min/max:35.03% / 42.41%

Stack Uptimes

  • solstice_1:39.64%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 20.8 95.6 14.7s 2.6s 14.1s 97.28% 0.00% 54.5 (54.5) 7.6

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 20.0s
  • trigger_min/max:0.8s / 11.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:93.84% / 99.22%

Stack Uptimes

  • starlord_1:9.24%
  • starlord_2:14.89%
  • starlord_3:73.15%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Wafting Devotion 4.3 1.2 60.9s 45.4s 16.5s 23.72% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 237.5s
  • trigger_min/max:0.0s / 214.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 77.7s
  • uptime_min/max:4.61% / 61.45%

Stack Uptimes

  • wafting_devotion_1:23.72%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Warrior of Elune 6.1 0.0 49.0s 49.0s 21.7s 43.98% 43.11% 0.0 (0.0) 2.3

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_warrior_of_elune
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:45.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 82.0s
  • trigger_min/max:45.0s / 82.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s
  • uptime_min/max:32.60% / 50.48%

Stack Uptimes

  • warrior_of_elune_1:20.49%
  • warrior_of_elune_2:5.24%
  • warrior_of_elune_3:18.24%

Spelldata

  • id:202425
  • name:Warrior of Elune
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.
  • max_stacks:0
  • duration:25.00
  • cooldown:45.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Denizen of the Dream 8.6 2.0 22.0 31.7s 0.0s 145.3s
Primordial Arcanic Pulsar 7.2 6.0 9.0 40.2s 28.5s 50.0s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.08% 0.00% 1.72% 0.5s 0.0s 2.8s
Astral Smolder 79.15% 57.22% 94.05% 15.5s 0.0s 144.0s
Incarnation (Total) 48.62% 43.35% 55.00% 20.3s 0.0s 54.0s
Incarnation (Pulsar) 28.37% 26.09% 30.73% 11.7s 0.0s 12.0s
Lunar Eclipse Only 0.91% 0.71% 1.12% 2.7s 2.5s 2.7s
Solar Eclipse Only 44.40% 36.34% 50.45% 10.9s 0.0s 15.0s
No Eclipse 6.06% 3.56% 8.31% 1.4s 0.0s 3.6s
Friend of the Fae 43.76% 13.66% 81.00% 25.0s 0.0s 137.7s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Warrior of Elune7.6050.00037.01646.39826.00370.072
Full Moon
New Moon
Half Moon
0.3420.00025.4855.8235.31531.119

Eclipse Utilization

NoneSolarLunarBoth
Wrath5.134.5%57.5149.9%0.000.0%52.6745.7%
Starfire25.0392.6%0.000.0%2.007.4%0.010.0%
Starsurge0.000.0%46.5540.0%0.000.0%69.8360.0%
New Moon0.030.5%0.264.3%0.000.0%5.7395.2%
Half Moon0.000.0%0.346.0%0.000.0%5.3493.9%
Full Moon0.201.7%3.1026.6%0.080.6%8.3071.0%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
hissing_rune_3
Nature's BalanceAstral Power99.51198.925.43%2.000.100.05%
Full MoonAstral Power5.30264.827.22%49.930.360.14%
Half MoonAstral Power5.69136.563.73%24.000.000.00%
MoonfireAstral Power14.3586.022.35%6.000.070.08%
New MoonAstral Power6.0272.231.97%12.000.000.00%
Orbit BreakerAstral Power6.37190.125.19%29.831.060.55%
Shooting Stars (Moonfire)Astral Power95.44190.685.20%2.000.200.11%
Shooting Stars (Sunfire)Astral Power95.81191.425.22%2.000.200.11%
StarfireAstral Power27.04396.5910.82%14.672.840.71%
SunfireAstral Power17.39104.362.85%6.000.010.01%
WrathAstral Power117.321834.2450.03%15.640.000.00%
Usage Type Count Total Tot% Avg RPE APR
hissing_rune_3
StarsurgeAstral Power 116.563677.87100.00%31.5531.608780.94
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 896660.0 4204.17 4973.22 1803581.4 665928.0 -662716.1 896660.0
Astral Power 70.0 12.22 12.24 4.8 23.6 0.0 100.0

Statistics & Data Analysis

Fight Length
hissing_rune_3 Fight Length
Count 21150
Mean 300.02
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 34.6219
5th Percentile 245.68
95th Percentile 353.98
( 95th Percentile - 5th Percentile ) 108.31
Mean Distribution
Standard Deviation 0.2381
95.00% Confidence Interval ( 299.55 - 300.49 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 512
0.1% Error 51157
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1024
DPS
hissing_rune_3 Damage Per Second
Count 21150
Mean 249072.70
Minimum 216031.81
Maximum 290213.57
Spread ( max - min ) 74181.76
Range [ ( max - min ) / 2 * 100% ] 14.89%
Standard Deviation 9230.1742
5th Percentile 234432.48
95th Percentile 264855.97
( 95th Percentile - 5th Percentile ) 30423.49
Mean Distribution
Standard Deviation 63.4680
95.00% Confidence Interval ( 248948.30 - 249197.09 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5276
0.1 Scale Factor Error with Delta=300 727284
0.05 Scale Factor Error with Delta=300 2909133
0.01 Scale Factor Error with Delta=300 72728305
Priority Target DPS
hissing_rune_3 Priority Target Damage Per Second
Count 21150
Mean 249072.70
Minimum 216031.81
Maximum 290213.57
Spread ( max - min ) 74181.76
Range [ ( max - min ) / 2 * 100% ] 14.89%
Standard Deviation 9230.1742
5th Percentile 234432.48
95th Percentile 264855.97
( 95th Percentile - 5th Percentile ) 30423.49
Mean Distribution
Standard Deviation 63.4680
95.00% Confidence Interval ( 248948.30 - 249197.09 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5276
0.1 Scale Factor Error with Delta=300 727284
0.05 Scale Factor Error with Delta=300 2909133
0.01 Scale Factor Error with Delta=300 72728305
DPS(e)
hissing_rune_3 Damage Per Second (Effective)
Count 21150
Mean 249072.70
Minimum 216031.81
Maximum 290213.57
Spread ( max - min ) 74181.76
Range [ ( max - min ) / 2 * 100% ] 14.89%
Damage
hissing_rune_3 Damage
Count 21150
Mean 72265314.81
Minimum 54787083.18
Maximum 95597479.68
Spread ( max - min ) 40810396.50
Range [ ( max - min ) / 2 * 100% ] 28.24%
DTPS
hissing_rune_3 Damage Taken Per Second
Count 21150
Mean 4974.22
Minimum 1272.03
Maximum 10201.70
Spread ( max - min ) 8929.67
Range [ ( max - min ) / 2 * 100% ] 89.76%
HPS
hissing_rune_3 Healing Per Second
Count 21150
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
hissing_rune_3 Healing Per Second (Effective)
Count 21150
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
hissing_rune_3 Heal
Count 21150
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
hissing_rune_3 Healing Taken Per Second
Count 21150
Mean 4191.21
Minimum 923.08
Maximum 8773.63
Spread ( max - min ) 7850.55
Range [ ( max - min ) / 2 * 100% ] 93.65%
TMI
hissing_rune_3 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
hissing_rune_3Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
hissing_rune_3 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.47 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.59 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.75 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.st
# count action,conditions
J 1.44 sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
K 1.25 moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
0.00 starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
0.00 starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
L 1.00 starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
M 0.00 wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
0.00 celestial_alignment,if=variable.cd_condition_st
N 2.00 incarnation,if=variable.cd_condition_st
0.00 variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
0.00 variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
O 6.09 warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
P 25.09 starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
0.00 wrath,if=variable.enter_eclipse
0.00 variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
0.00 convoke_the_spirits,if=variable.convoke_condition
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+55
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 starfall,if=buff.starweavers_warp.up
0.00 variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
Q 83.39 starsurge,if=variable.starsurge_condition1
R 15.95 sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
S 13.10 moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
T 6.03 new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
U 5.71 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
V 5.36 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
W 12.17 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
X 32.99 starsurge,if=variable.starsurge_condition2
Y 115.63 wrath
Z 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFJKLNDEQQQTQUQVYXYXRYXYYSWQQQYYYYXYYXOTYXYXXYRWQQQYQYYYYSXYXXYYPPWQQYQRYYYYXYYXPPQQSQQUQRVOYXXYPPQQYYQYSYRYXYXFYPPQQYYQYYYYXRSXETWQQQUQYYYOXYPPXRYWQQYYQSYYXYYPPWQQYRQYYYYXYYXWQSQQVTXRXPPYYWQQYQYYOYSYXXRYPPQQFYYQYYYYXYXURQQSVEQYPNQQQYTYWQQQYRYYXSYYXYXYYQQQUQYRQYYYYXSYOQQYQYYPPQQQRYYYWQQYYQSYPPQYYRWQQVFQQTQYYYXPPSQRQYYQYEOYXYUXXYPPQYQR

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask hissing_rune_3 50.0/100: 50% astral_power
Pre precombat 1 food hissing_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 2 augmentation hissing_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 4 no_cd_talent hissing_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 5 on_use_trinket hissing_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 6 on_use_trinket hissing_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 7 on_use_trinket hissing_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 60.0/100: 60% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil hissing_rune_3 50.0/100: 50% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.000 st J sunfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.926 st K moonfire Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:01.854 st L starfire Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice
0:02.692 st N incarnation_chosen_of_elune Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice
0:02.692 default D potion Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2)
0:02.692 default E use_items Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), elemental_potion_of_ultimate_power
0:02.692 st Q starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), elemental_potion_of_ultimate_power, kindled_soul(100)
0:03.535 st Q starsurge Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), elemental_potion_of_ultimate_power, kindled_soul(100)
0:04.347 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate(2), elemental_potion_of_ultimate_power, kindled_soul(95)
0:05.130 st T new_moon Fluffy_Pillow 16.0/100: 16% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), elemental_potion_of_ultimate_power, kindled_soul(90)
0:05.885 st Q starsurge Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), elemental_potion_of_ultimate_power, kindled_soul(85)
0:06.639 st U half_moon Fluffy_Pillow 12.0/100: 12% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), elemental_potion_of_ultimate_power, kindled_soul(85)
0:07.643 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), elemental_potion_of_ultimate_power, kindled_soul(80)
0:08.399 st V full_moon Fluffy_Pillow 14.0/100: 14% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate(2), elemental_potion_of_ultimate_power, kindled_soul(75)
0:09.904 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, elemental_potion_of_ultimate_power, kindled_soul(65)
0:10.659 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, best_friends_with_urctos(11), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(65)
0:11.415 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(10), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(60)
0:12.171 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(10), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(55)
0:12.926 st R sunfire Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(50)
0:13.681 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(50)
0:14.435 st X starsurge Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(45)
0:15.189 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(40)
0:15.946 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(6), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(35)
0:16.702 st S moonfire Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.457 st W cancel_buff Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.457 st Q starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:18.302 st Q starsurge Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:19.115 st Q starsurge Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:19.898 st Y wrath Fluffy_Pillow 4.0/100: 4% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:20.652 st Y wrath Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:21.408 st Y wrath Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:22.162 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:22.917 st X starsurge Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:23.674 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:24.429 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:25.184 st X starsurge Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:25.939 st O warrior_of_elune Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:25.939 st T new_moon Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:26.694 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:27.449 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:28.203 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:28.957 st X starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:29.711 st X starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:30.466 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:31.221 st R sunfire Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power
0:31.976 st W cancel_buff Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power
0:31.976 st Q starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power
0:32.760 st Q starsurge Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion
0:33.513 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion
0:34.269 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion
0:35.023 st Q starsurge Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion
0:35.778 st Y wrath Fluffy_Pillow 8.0/100: 8% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion
0:36.532 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion
0:37.285 st Y wrath Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion
0:38.039 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(11), best_friends_with_pip_static, wafting_devotion
0:38.795 st S moonfire Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(11), best_friends_with_pip_static, wafting_devotion
0:39.550 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(10), best_friends_with_pip_static, wafting_devotion
0:40.303 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, wafting_devotion
0:41.213 st X starsurge Fluffy_Pillow 74.0/100: 74% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(8), best_friends_with_pip_static, wafting_devotion
0:42.122 st X starsurge Fluffy_Pillow 50.0/100: 50% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(7), best_friends_with_pip_static, wafting_devotion
0:43.031 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(6), best_friends_with_pip_static, wafting_devotion
0:43.943 st Y wrath Fluffy_Pillow 42.0/100: 42% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(5), best_friends_with_pip_static, wafting_devotion
0:44.853 st P starfire Fluffy_Pillow 52.0/100: 52% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip(5), best_friends_with_pip_static, wafting_devotion
0:45.607 st P starfire Fluffy_Pillow 70.8/100: 71% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), best_friends_with_pip(4), best_friends_with_pip_static
0:46.361 st W cancel_buff Fluffy_Pillow 89.6/100: 90% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, best_friends_with_pip(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:46.361 st Q starsurge Fluffy_Pillow 89.6/100: 90% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(32), solstice, warrior_of_elune, best_friends_with_pip(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:47.378 st Q starsurge Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:48.355 st Y wrath Fluffy_Pillow 23.6/100: 24% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip, best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:49.297 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:50.240 st R sunfire Fluffy_Pillow 7.6/100: 8% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:51.150 st Y wrath Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:52.150 st Y wrath Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:53.151 st Y wrath Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:54.149 st Y wrath Fluffy_Pillow 69.6/100: 70% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:55.151 st X starsurge Fluffy_Pillow 85.6/100: 86% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:56.149 st Y wrath Fluffy_Pillow 51.6/100: 52% astral_power eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:57.146 st Y wrath Fluffy_Pillow 71.6/100: 72% astral_power eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:58.145 st X starsurge Fluffy_Pillow 87.6/100: 88% astral_power eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:59.143 st P starfire Fluffy_Pillow 53.6/100: 54% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:00.638 st P starfire Fluffy_Pillow 67.6/100: 68% astral_power natures_grace, primordial_arcanic_pulsar(52), starlord(3), dreamstate, best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:01.456 st Q starsurge Fluffy_Pillow 79.6/100: 80% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, dreamstate, best_friends_with_pip_static, corrupting_rage
1:02.553 st Q starsurge Fluffy_Pillow 45.6/100: 46% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, balance_t31_4pc_buff_solar, dreamstate, best_friends_with_pip_static, corrupting_rage
1:03.608 st S moonfire Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_pip_static, corrupting_rage
1:04.532 st Q starsurge Fluffy_Pillow 57.6/100: 58% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_pip_static, corrupting_rage
1:05.456 st Q starsurge Fluffy_Pillow 35.6/100: 36% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage
1:06.347 st U half_moon Fluffy_Pillow 11.6/100: 12% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), dreamstate, best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage
1:07.532 st Q starsurge Fluffy_Pillow 35.6/100: 36% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), dreamstate, best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage
1:08.510 st R sunfire Fluffy_Pillow 11.6/100: 12% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), dreamstate, best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage
1:09.490 st V full_moon Fluffy_Pillow 21.6/100: 22% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), dreamstate, best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage
1:11.445 st O warrior_of_elune Fluffy_Pillow 73.6/100: 74% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), dreamstate, best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage
1:11.445 st Y wrath Fluffy_Pillow 73.6/100: 74% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage
1:12.199 st X starsurge Fluffy_Pillow 93.6/100: 94% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage
1:13.178 st X starsurge Fluffy_Pillow 65.6/100: 66% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage
1:14.156 st Y wrath Fluffy_Pillow 37.6/100: 38% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage
1:15.136 st P starfire Fluffy_Pillow 49.6/100: 50% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage
1:15.892 st P starfire Fluffy_Pillow 66.4/100: 66% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage
1:16.646 st Q starsurge Fluffy_Pillow 83.2/100: 83% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
1:17.744 st Q starsurge Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_urctos_static, corrupting_rage
1:18.799 st Y wrath Fluffy_Pillow 15.2/100: 15% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, corrupting_rage
1:19.815 st Y wrath Fluffy_Pillow 31.2/100: 31% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, corrupting_rage
1:20.830 st Q starsurge Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, corrupting_rage
1:21.947 st Y wrath Fluffy_Pillow 17.2/100: 17% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage
1:23.026 st S moonfire Fluffy_Pillow 33.2/100: 33% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage
1:24.103 st Y wrath Fluffy_Pillow 41.2/100: 41% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage
1:25.180 st R sunfire Fluffy_Pillow 59.2/100: 59% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage
1:26.258 st Y wrath Fluffy_Pillow 65.2/100: 65% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage
1:27.334 st X starsurge Fluffy_Pillow 83.2/100: 83% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage
1:28.409 st Y wrath Fluffy_Pillow 47.2/100: 47% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage
1:29.487 st X starsurge Fluffy_Pillow 67.2/100: 67% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static
1:30.566 default F natures_vigil hissing_rune_3 37.2/100: 37% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static
1:30.566 st Y wrath Fluffy_Pillow 37.2/100: 37% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static
1:31.642 st P starfire Fluffy_Pillow 51.2/100: 51% astral_power natures_vigil, denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, dreamstate, best_friends_with_urctos_static
1:32.397 st P starfire Fluffy_Pillow 70.0/100: 70% astral_power natures_vigil, denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), best_friends_with_urctos_static
1:33.386 st Q starsurge Fluffy_Pillow 84.0/100: 84% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, best_friends_with_urctos_static
1:34.483 st Q starsurge Fluffy_Pillow 48.0/100: 48% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_urctos_static
1:35.539 st Y wrath Fluffy_Pillow 14.0/100: 14% astral_power natures_vigil, balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static
1:36.554 st Y wrath Fluffy_Pillow 34.0/100: 34% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static
1:37.569 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power natures_vigil, balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static
1:38.687 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power natures_vigil, balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static
1:39.765 st Y wrath Fluffy_Pillow 36.0/100: 36% astral_power natures_vigil, balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static
1:40.842 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power natures_vigil, balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static
1:41.920 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static
1:42.996 st X starsurge Fluffy_Pillow 88.0/100: 88% astral_power natures_vigil, denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static
1:44.075 st R sunfire Fluffy_Pillow 52.0/100: 52% astral_power natures_vigil, denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage
1:45.150 st S moonfire Fluffy_Pillow 60.0/100: 60% astral_power natures_vigil, denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage
1:46.229 st X starsurge Fluffy_Pillow 68.0/100: 68% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage
1:47.306 default E use_items Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, corrupting_rage
1:47.306 st T new_moon Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, corrupting_rage, kindled_soul(100)
1:48.059 st W cancel_buff Fluffy_Pillow 52.0/100: 52% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, corrupting_rage, kindled_soul(100)
1:48.059 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, corrupting_rage, kindled_soul(100)
1:49.156 st Q starsurge Fluffy_Pillow 56.0/100: 56% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, corrupting_rage, kindled_soul(95)
1:50.210 st Q starsurge Fluffy_Pillow 30.0/100: 30% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(90)
1:51.225 st U half_moon Fluffy_Pillow 8.0/100: 8% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage, kindled_soul(85)
1:52.531 st Q starsurge Fluffy_Pillow 36.0/100: 36% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage, kindled_soul(75)
1:53.510 st Y wrath Fluffy_Pillow 10.0/100: 10% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(70)
1:54.489 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(65)
1:55.469 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(60)
1:56.447 st O warrior_of_elune Fluffy_Pillow 64.0/100: 64% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(55)
1:56.447 st X starsurge Fluffy_Pillow 64.0/100: 64% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(55)
1:57.427 st Y wrath Fluffy_Pillow 38.0/100: 38% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(50)
1:58.405 st P starfire Fluffy_Pillow 48.0/100: 48% astral_power denizen_of_the_dream(3), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, corrupting_rage, kindled_soul(45)
1:59.159 st P starfire Fluffy_Pillow 64.8/100: 65% astral_power denizen_of_the_dream(3), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_urctos_static, corrupting_rage, kindled_soul(45)
1:59.913 st X starsurge Fluffy_Pillow 83.6/100: 84% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage, kindled_soul(40)
2:00.892 st R sunfire Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_urctos_static, corrupting_rage, kindled_soul(35)
2:01.872 st Y wrath Fluffy_Pillow 63.6/100: 64% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_urctos_static, corrupting_rage, kindled_soul(30)
2:02.852 st W cancel_buff Fluffy_Pillow 81.6/100: 82% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_urctos_static, corrupting_rage, kindled_soul(25)
2:02.852 st Q starsurge Fluffy_Pillow 81.6/100: 82% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_urctos_static, corrupting_rage, kindled_soul(25)
2:03.949 st Q starsurge Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, corrupting_rage, kindled_soul(20)
2:05.005 st Y wrath Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(15)
2:06.123 st Y wrath Fluffy_Pillow 31.6/100: 32% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(10)
2:07.239 st Q starsurge Fluffy_Pillow 47.6/100: 48% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(5)
2:08.357 st S moonfire Fluffy_Pillow 11.6/100: 12% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage
2:09.436 st Y wrath Fluffy_Pillow 19.6/100: 20% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:10.435 st Y wrath Fluffy_Pillow 35.6/100: 36% astral_power denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:11.435 st X starsurge Fluffy_Pillow 55.6/100: 56% astral_power denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:12.434 st Y wrath Fluffy_Pillow 21.6/100: 22% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:13.434 st Y wrath Fluffy_Pillow 37.6/100: 38% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:14.434 st P starfire Fluffy_Pillow 47.6/100: 48% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, dreamstate, best_friends_with_pip(11), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:15.188 st P starfire Fluffy_Pillow 66.4/100: 66% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_pip(11), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:16.006 st W cancel_buff Fluffy_Pillow 80.4/100: 80% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_pip(10), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:16.006 st Q starsurge Fluffy_Pillow 80.4/100: 80% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, best_friends_with_pip(10), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:17.023 st Q starsurge Fluffy_Pillow 46.4/100: 46% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_pip(9), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:18.003 st Y wrath Fluffy_Pillow 12.4/100: 12% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip(8), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:18.945 st R sunfire Fluffy_Pillow 30.4/100: 30% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip(7), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:19.887 st Q starsurge Fluffy_Pillow 40.4/100: 40% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip(6), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:20.828 st Y wrath Fluffy_Pillow 8.4/100: 8% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:21.828 st Y wrath Fluffy_Pillow 28.4/100: 28% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:22.829 st Y wrath Fluffy_Pillow 44.4/100: 44% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:23.827 st Y wrath Fluffy_Pillow 60.4/100: 60% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage
2:24.904 st X starsurge Fluffy_Pillow 78.4/100: 78% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip, best_friends_with_pip_static, corrupting_rage
2:25.982 st Y wrath Fluffy_Pillow 42.4/100: 42% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
2:27.058 st Y wrath Fluffy_Pillow 62.4/100: 62% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
2:28.135 st X starsurge Fluffy_Pillow 80.4/100: 80% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
2:29.212 st W cancel_buff Fluffy_Pillow 48.4/100: 48% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
2:29.212 st Q starsurge Fluffy_Pillow 48.4/100: 48% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
2:30.309 st S moonfire Fluffy_Pillow 22.4/100: 22% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
2:31.364 st Q starsurge Fluffy_Pillow 60.4/100: 60% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
2:32.419 st Q starsurge Fluffy_Pillow 34.4/100: 34% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
2:33.433 st V full_moon Fluffy_Pillow 10.4/100: 10% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
2:35.389 st T new_moon Fluffy_Pillow 64.4/100: 64% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static
2:36.142 st X starsurge Fluffy_Pillow 78.4/100: 78% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static
2:37.122 st R sunfire Fluffy_Pillow 50.4/100: 50% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static
2:38.102 st X starsurge Fluffy_Pillow 56.4/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static
2:39.081 st P starfire Fluffy_Pillow 30.4/100: 30% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static
2:40.549 st P starfire Fluffy_Pillow 42.4/100: 42% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(3), dreamstate, best_friends_with_pip_static
2:41.429 st Y wrath Fluffy_Pillow 54.4/100: 54% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), best_friends_with_pip_static
2:42.185 st Y wrath Fluffy_Pillow 72.4/100: 72% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), best_friends_with_pip_static
2:43.165 st W cancel_buff Fluffy_Pillow 92.4/100: 92% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), best_friends_with_pip_static
2:43.165 st Q starsurge Fluffy_Pillow 92.4/100: 92% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, best_friends_with_pip_static
2:44.261 st Q starsurge Fluffy_Pillow 58.4/100: 58% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_pip_static
2:45.318 st Y wrath Fluffy_Pillow 28.4/100: 28% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static
2:46.333 st Q starsurge Fluffy_Pillow 46.4/100: 46% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static
2:47.451 st Y wrath Fluffy_Pillow 12.4/100: 12% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static
2:48.528 st Y wrath Fluffy_Pillow 30.4/100: 30% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static
2:49.606 st O warrior_of_elune Fluffy_Pillow 46.4/100: 46% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
2:49.606 st Y wrath Fluffy_Pillow 46.4/100: 46% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
2:50.683 st S moonfire Fluffy_Pillow 62.4/100: 62% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
2:51.761 st Y wrath Fluffy_Pillow 70.4/100: 70% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
2:52.837 st X starsurge Fluffy_Pillow 86.4/100: 86% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
2:53.915 st X starsurge Fluffy_Pillow 50.4/100: 50% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
2:54.993 st R sunfire Fluffy_Pillow 16.4/100: 16% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
2:56.070 st Y wrath Fluffy_Pillow 24.4/100: 24% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
2:57.149 st P starfire Fluffy_Pillow 38.4/100: 38% astral_power natures_grace, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip_static, corrupting_rage
2:57.904 st P starfire Fluffy_Pillow 55.2/100: 55% astral_power natures_grace, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(2), best_friends_with_pip_static, corrupting_rage
2:58.656 st Q starsurge Fluffy_Pillow 72.0/100: 72% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, warrior_of_elune, best_friends_with_pip_static, corrupting_rage
2:59.751 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip_static, corrupting_rage
3:00.807 default F natures_vigil hissing_rune_3 6.0/100: 6% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, corrupting_rage
3:00.807 st Y wrath Fluffy_Pillow 6.0/100: 6% astral_power natures_vigil, balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, corrupting_rage
3:01.823 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power natures_vigil, balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, corrupting_rage
3:02.840 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power natures_vigil, balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, corrupting_rage
3:03.958 st Y wrath Fluffy_Pillow 8.0/100: 8% astral_power natures_vigil, balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
3:05.035 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power natures_vigil, balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
3:06.113 st Y wrath Fluffy_Pillow 42.0/100: 42% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
3:07.191 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
3:08.270 st X starsurge Fluffy_Pillow 76.0/100: 76% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
3:09.347 st Y wrath Fluffy_Pillow 42.0/100: 42% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
3:10.423 st X starsurge Fluffy_Pillow 58.0/100: 58% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
3:11.502 st U half_moon Fluffy_Pillow 26.0/100: 26% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
3:12.808 st R sunfire Fluffy_Pillow 54.0/100: 54% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage
3:13.790 st Q starsurge Fluffy_Pillow 64.0/100: 64% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage
3:14.888 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage
3:15.942 st S moonfire Fluffy_Pillow 16.0/100: 16% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage
3:16.958 st V full_moon Fluffy_Pillow 22.0/100: 22% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage
3:18.985 default E use_items Fluffy_Pillow 74.0/100: 74% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage
3:18.985 st Q starsurge Fluffy_Pillow 74.0/100: 74% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage, kindled_soul(100)
3:20.002 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(95)
3:20.980 st P starfire Fluffy_Pillow 68.0/100: 68% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage, kindled_soul(95)
3:22.447 st N incarnation_chosen_of_elune Fluffy_Pillow 82.0/100: 82% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(12), starlord(3), dreamstate(2), best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage, kindled_soul(85)
3:22.447 st Q starsurge Fluffy_Pillow 82.0/100: 82% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(12), solstice, starlord(3), dreamstate(2), best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage, kindled_soul(85)
3:23.338 st Q starsurge Fluffy_Pillow 86.0/100: 86% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), best_friends_with_urctos_static, corrupting_rage, kindled_soul(80)
3:24.228 st Q starsurge Fluffy_Pillow 64.0/100: 64% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate(2), best_friends_with_urctos_static, corrupting_rage, kindled_soul(75)
3:25.120 st Y wrath Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate, best_friends_with_urctos_static, corrupting_rage, kindled_soul(70)
3:25.874 st T new_moon Fluffy_Pillow 58.0/100: 58% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate, best_friends_with_urctos_static, corrupting_rage, kindled_soul(70)
3:26.628 st Y wrath Fluffy_Pillow 72.0/100: 72% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(65)
3:27.383 st W cancel_buff Fluffy_Pillow 92.0/100: 92% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(60)
3:27.383 st Q starsurge Fluffy_Pillow 92.0/100: 92% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(60)
3:28.379 st Q starsurge Fluffy_Pillow 68.0/100: 68% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage, kindled_soul(55)
3:29.339 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(50)
3:30.355 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(45)
3:31.335 st R sunfire Fluffy_Pillow 34.0/100: 34% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(40)
3:32.315 st Y wrath Fluffy_Pillow 40.0/100: 40% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(35)
3:33.294 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(30)
3:34.274 st X starsurge Fluffy_Pillow 76.0/100: 76% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(25)
3:35.255 st S moonfire Fluffy_Pillow 48.0/100: 48% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(20)
3:36.235 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(15)
3:37.214 st Y wrath Fluffy_Pillow 72.0/100: 72% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(10)
3:38.194 st X starsurge Fluffy_Pillow 88.0/100: 88% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(5)
3:39.175 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:40.157 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:41.135 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:42.113 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:43.091 st Q starsurge Fluffy_Pillow 84.0/100: 84% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:44.189 st Q starsurge Fluffy_Pillow 56.0/100: 56% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:45.243 st Q starsurge Fluffy_Pillow 30.0/100: 30% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:46.258 st U half_moon Fluffy_Pillow 2.0/100: 2% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:47.563 st Q starsurge Fluffy_Pillow 30.0/100: 30% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:48.540 st Y wrath Fluffy_Pillow 6.0/100: 6% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:49.519 st R sunfire Fluffy_Pillow 24.0/100: 24% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:50.500 st Q starsurge Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:51.477 st Y wrath Fluffy_Pillow 10.0/100: 10% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:52.456 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:53.435 st Y wrath Fluffy_Pillow 44.0/100: 44% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:54.414 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:55.395 st X starsurge Fluffy_Pillow 80.0/100: 80% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:56.375 st S moonfire Fluffy_Pillow 52.0/100: 52% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:57.353 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:58.334 st O warrior_of_elune Fluffy_Pillow 78.0/100: 78% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:58.334 st Q starsurge Fluffy_Pillow 78.0/100: 78% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:59.431 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
4:00.487 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
4:01.504 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
4:02.518 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
4:03.499 st Y wrath Fluffy_Pillow 36.0/100: 36% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
4:04.480 st P starfire Fluffy_Pillow 48.0/100: 48% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, corrupting_rage
4:05.234 st P starfire Fluffy_Pillow 64.8/100: 65% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(2), best_friends_with_urctos_static, corrupting_rage
4:05.986 st Q starsurge Fluffy_Pillow 83.6/100: 84% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
4:06.964 st Q starsurge Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_urctos_static, corrupting_rage
4:07.943 st Q starsurge Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, corrupting_rage
4:08.922 st R sunfire Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage
4:09.903 st Y wrath Fluffy_Pillow 23.6/100: 24% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage
4:10.882 st Y wrath Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(36), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage
4:11.957 st Y wrath Fluffy_Pillow 59.6/100: 60% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage
4:13.035 st W cancel_buff Fluffy_Pillow 81.6/100: 82% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage
4:13.035 st Q starsurge Fluffy_Pillow 81.6/100: 82% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(36), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage
4:14.241 st Q starsurge Fluffy_Pillow 47.6/100: 48% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage
4:15.400 st Y wrath Fluffy_Pillow 13.6/100: 14% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage
4:16.517 st Y wrath Fluffy_Pillow 31.6/100: 32% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage
4:17.635 st Q starsurge Fluffy_Pillow 47.6/100: 48% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage
4:18.753 st S moonfire Fluffy_Pillow 15.6/100: 16% astral_power eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage
4:19.831 st Y wrath Fluffy_Pillow 21.6/100: 22% astral_power eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage
4:20.908 st P starfire Fluffy_Pillow 33.6/100: 34% astral_power natures_grace, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune, dreamstate, best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage
4:21.664 st P starfire Fluffy_Pillow 52.4/100: 52% astral_power natures_grace, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage
4:22.546 st Q starsurge Fluffy_Pillow 66.4/100: 66% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage
4:23.525 st Y wrath Fluffy_Pillow 30.4/100: 30% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage
4:24.502 st Y wrath Fluffy_Pillow 50.4/100: 50% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage
4:25.482 st R sunfire Fluffy_Pillow 68.4/100: 68% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, corrupting_rage
4:26.460 st W cancel_buff Fluffy_Pillow 76.4/100: 76% astral_power balance_of_all_things_nature(5), eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, corrupting_rage
4:26.460 st Q starsurge Fluffy_Pillow 76.4/100: 76% astral_power balance_of_all_things_nature(5), eclipse_solar, primordial_arcanic_pulsar(52), solstice, balance_t31_4pc_buff_solar, best_friends_with_urctos_static, corrupting_rage
4:27.666 st Q starsurge Fluffy_Pillow 44.4/100: 44% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(56), solstice, starlord, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, corrupting_rage
4:28.828 st V full_moon Fluffy_Pillow 10.4/100: 10% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, corrupting_rage
4:30.855 default F natures_vigil hissing_rune_3 66.4/100: 66% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, corrupting_rage
4:30.855 st Q starsurge Fluffy_Pillow 66.4/100: 66% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, corrupting_rage
4:31.872 st Q starsurge Fluffy_Pillow 40.4/100: 40% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, corrupting_rage
4:32.852 st T new_moon Fluffy_Pillow 14.4/100: 14% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, corrupting_rage
4:33.607 st Q starsurge Fluffy_Pillow 30.4/100: 30% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, corrupting_rage
4:34.586 st Y wrath Fluffy_Pillow 2.4/100: 2% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage
4:35.566 st Y wrath Fluffy_Pillow 18.4/100: 18% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static
4:36.546 st Y wrath Fluffy_Pillow 36.4/100: 36% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static
4:37.526 st X starsurge Fluffy_Pillow 54.4/100: 54% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static
4:38.505 st P starfire Fluffy_Pillow 26.4/100: 26% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
4:39.974 st P starfire Fluffy_Pillow 40.4/100: 40% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(16), starlord(3), dreamstate, best_friends_with_urctos_static
4:40.855 st S moonfire Fluffy_Pillow 52.4/100: 52% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), dreamstate, best_friends_with_urctos_static
4:41.835 st Q starsurge Fluffy_Pillow 62.4/100: 62% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, dreamstate, best_friends_with_urctos_static
4:42.930 st R sunfire Fluffy_Pillow 30.4/100: 30% astral_power natures_vigil, balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord, balance_t31_4pc_buff_solar, dreamstate, best_friends_with_urctos_static
4:43.986 st Q starsurge Fluffy_Pillow 40.4/100: 40% astral_power natures_vigil, balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord, balance_t31_4pc_buff_solar, dreamstate, best_friends_with_urctos_static
4:45.039 st Y wrath Fluffy_Pillow 8.4/100: 8% astral_power natures_vigil, balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static
4:45.793 st Y wrath Fluffy_Pillow 26.4/100: 26% astral_power natures_vigil, balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(24), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static
4:46.910 st Q starsurge Fluffy_Pillow 76.4/100: 76% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(24), starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static
4:48.028 st Y wrath Fluffy_Pillow 44.4/100: 44% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static
4:49.105 default E use_items Fluffy_Pillow 60.4/100: 60% astral_power eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static
4:49.105 st O warrior_of_elune Fluffy_Pillow 60.4/100: 60% astral_power eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, kindled_soul(100)
4:49.105 st Y wrath Fluffy_Pillow 60.4/100: 60% astral_power eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, kindled_soul(100)
4:50.182 st X starsurge Fluffy_Pillow 78.4/100: 78% astral_power eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(95)
4:51.180 st Y wrath Fluffy_Pillow 44.4/100: 44% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(90)
4:52.180 st U half_moon Fluffy_Pillow 62.4/100: 62% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(85)
4:53.512 st X starsurge Fluffy_Pillow 86.4/100: 86% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(80)
4:54.510 st X starsurge Fluffy_Pillow 52.4/100: 52% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(75)
4:55.509 st Y wrath Fluffy_Pillow 16.4/100: 16% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(70)
4:56.509 st P starfire Fluffy_Pillow 26.4/100: 26% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, wafting_devotion, kindled_soul(65)
4:57.263 st P starfire Fluffy_Pillow 45.2/100: 45% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), warrior_of_elune(2), best_friends_with_urctos_static, wafting_devotion, kindled_soul(60)
4:58.015 st Q starsurge Fluffy_Pillow 64.0/100: 64% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, warrior_of_elune, best_friends_with_urctos_static, wafting_devotion, kindled_soul(60)
4:59.031 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_urctos_static, wafting_devotion, kindled_soul(55)
5:00.010 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_urctos_static, wafting_devotion, kindled_soul(50)
5:00.988 st R sunfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, wafting_devotion, kindled_soul(45)

Stats

Level Bonus (70) Race Bonus (tauren) Raid-Buffed Unbuffed Gear Amount
Strength 898 2 986 900 0
Agility 2089 -2 2173 2087 0
Stamina 3848 2 44833 42698 38825
Intellect 2089 -2 15807 14885 12090 (7538)
Spirit 0 0 0 0 0
Health 896660 896660 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 15807 14885 0
Crit 28.51% 22.30% 3114
Haste 24.78% 24.78% 4212
Versatility 6.30% 1.30% 267
Mana Regen 2560 2560 0
Attack Power 16439 15480 0
Mastery 30.74% 30.74% 8152
Armor 5324 5324 5324
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 489.00
Local Head Benevolent Embersage's Casque
ilevel: 489, stats: { 673 Armor, +3966 Sta, +704 Crit, +330 Haste, +938 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }, enchant: incandescent_essence
Local Neck Eye of the Rising Flame
ilevel: 489, stats: { +2231 Sta, +256 Haste, +1537 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Life-Bound Shoulderpads
ilevel: 486, stats: { 603 Armor, +2875 Sta, +383 Mastery, +383 Haste, +684 AgiInt }
item effects: { equip: Toxified }
Local Chest Benevolent Embersage's Robe
ilevel: 489, stats: { 897 Armor, +3966 Sta, +715 Crit, +318 Mastery, +938 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 489, stats: { 505 Armor, +2975 Sta, +535 Haste, +241 Mastery, +704 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 489, stats: { 785 Armor, +3966 Sta, +705 Haste, +328 Mastery, +938 AgiInt }, enchant: { +155 StrAgiInt, +41 Vers (lambent_armor_kit_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 486, stats: { 548 Armor, +2875 Sta, +274 Crit, +438 Haste, +684 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Thermal Bindings
ilevel: 489, stats: { 449 Armor, +2231 Sta, +191 Crit, +390 Mastery, +528 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Benevolent Embersage's Talons
ilevel: 489, stats: { 505 Armor, +2975 Sta, +226 Vers, +549 Mastery, +704 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 489, stats: { +2231 Sta, +512 Haste, +1281 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 489, stats: { +2231 Sta, +1230 Crit, +564 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 489, stats: { +892 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 489, stats: { +738 Mastery }
item effects: { use: Balefire Branch }
Local Back Drape of the Loyal Vassal
ilevel: 489, stats: { 359 Armor, +2231 Sta, +328 Haste, +253 Mastery, +528 StrAgiInt }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 489, weapon: { 606 - 781, 2.6 }, stats: { +469 Int, +2264 Int, +1983 Sta, +156 Haste, +361 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 489, stats: { +1439 Int, +1983 Sta, +174 Haste, +343 Mastery }

Profile

druid="hissing_rune_3"
source=default
spec=balance
level=70
race=tauren
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:hissing_rune_3

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=489,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=489,gem_id=192961/192961/192961
shoulders=lifebound_shoulderpads,id=193406,bonus_id=8836/1576/8797/8960,ilevel=486,crafted_stats=49/36
back=drape_of_the_loyal_vassal,id=158375,bonus_id=4795,ilevel=489
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=489,enchant_id=6625
wrists=thermal_bindings,id=134461,bonus_id=4795,ilevel=489,gem_id=192961
hands=benevolent_embersages_talons,id=207255,bonus_id=4795,ilevel=489
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=489,enchant_id=6830
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=486
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=489
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=489
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=489,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=489

# Gear Summary
# gear_ilvl=488.63
# gear_stamina=38825
# gear_intellect=12090
# gear_crit_rating=3114
# gear_haste_rating=4212
# gear_mastery_rating=8152
# gear_versatility_rating=267
# gear_armor=5324
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

howling_rune_3 : 249012 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
249012.2 249012.2 124.4 / 0.050% 35902.6 / 14.4% 19446.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.4 12.4 Astral Power 0.00% 67.9 100.0% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
howling_rune_3 249012
Astral Smolder 17762 7.1% 67.9 4.37s 78378 0 Periodic 119.1 44656 0 44656 0.0% 79.4%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 67.88 0.00 119.14 119.14 52.73 0.0000 2.0000 5320292.01 5320292.01 0.00% 22327.43 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 119.14 74 160 44655.90 9435 151632 44665.29 33358 58154 5320292 5320292 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Denizen of the Dream 0 (7963) 0.0% (3.2%) 8.7 31.09s 273020 0

Stats Details: Denizen Of The Dream

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Denizen Of The Dream

  • id:394065
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394065
  • name:Denizen of the Dream
  • school:physical
  • tooltip:
  • description:Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.
    Fey Missile 21479  / 7963 3.2% 156.7 1.66s 15231 12042 Direct 155.8 11705 24319 15326 28.7%

Stats Details: Fey Missile

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 156.74 155.77 0.00 0.00 0.00 1.2649 0.0000 2387437.52 2387437.52 0.00% 12041.65 12041.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.29% 111.06 23 300 11705.10 7842 20414 11696.45 10422 13992 1299939 1299939 0.00%
crit 28.71% 44.72 7 142 24319.34 17754 42460 24306.42 21572 29380 1087498 1087498 0.00%

Action Details: Fey Missile

  • id:188046
  • school:astral
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.389
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.236000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:188046
  • name:Fey Missile
  • school:astral
  • tooltip:
  • description:{$@spelldesc187875=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$188083d=30 seconds}.}

Action Priority List

    default
    [ ]:16475.75
Hungering Shadowflame 3949 1.6% 17.7 16.57s 67129 0 Direct 17.7 51712 105324 67122 28.7%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.65 17.65 0.00 0.00 0.00 0.0000 0.0000 1185103.74 1185103.74 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.26% 12.58 2 27 51712.06 34936 202233 51579.00 34936 145483 650576 650576 0.00%
crit 28.74% 5.07 0 16 105323.50 71270 412555 104596.38 0 403185 534528 534528 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:31299.68
  • base_dd_max:31299.68
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 7238 2.9% 34.9 8.54s 62246 0 Direct 34.8 48086 98015 62416 28.7%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.85 34.76 0.00 0.00 0.00 0.0000 0.0000 2169404.22 2169404.22 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.30% 24.78 8 46 48086.48 47503 54996 48086.41 47503 51083 1191710 1191710 0.00%
crit 28.70% 9.97 0 24 98015.20 96907 112191 98007.48 0 109645 977694 977694 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42559.30
  • base_dd_max:42559.30
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 13081 5.3% 14.3 21.59s 273040 286010 Direct 14.3 9247 19367 12918 36.3%
Periodic 316.8 8344 17787 11780 36.4% 99.5%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.35 14.35 316.79 316.79 13.35 0.9547 0.9422 3917188.61 3917188.61 0.00% 12547.65 286009.68
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 63.71% 9.14 2 17 9246.62 6797 17694 9253.41 7485 12157 84522 84522 0.00%
crit 36.29% 5.21 0 13 19366.51 12413 35518 19347.05 0 32535 100821 100821 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 63.61% 201.51 126 270 8343.82 349 15394 8347.72 7862 8976 1681350 1681350 0.00%
crit 36.39% 115.28 68 165 17787.19 500 31404 17798.20 16480 19510 2050495 2050495 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    st
    [K]:1.33
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [S]:13.01
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
New Moon (Talent) 0 (23237) 0.0% (9.3%) 17.0 17.93s 408829 349153

Stats Details: Moons Talent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.03 0.00 0.00 0.00 0.00 1.1709 0.0000 0.00 0.00 0.00% 349153.36 349153.36

Action Details: Moons Talent

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
    Full Moon 8530 3.4% 5.3 62.24s 482338 266322 Direct 5.3 328813 657135 485057 47.6%

Stats Details: Full Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.31 5.28 0.00 0.00 0.00 1.8111 0.0000 2563344.80 2563344.80 0.00% 266321.54 266321.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.42% 2.77 0 6 328812.76 196532 540353 321464.25 0 515345 911018 911018 0.00%
crit 47.58% 2.51 0 6 657134.71 400925 1120189 632318.48 0 1084683 1652327 1652327 0.00%

Action Details: Full Moon

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:50.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Action Priority List

    st
    [V]:5.36
  • if_expr:astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    New Moon 6280 2.5% 6.0 53.39s 311513 412890 Direct 6.0 199527 426497 313205 50.1%

Stats Details: New Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.02 5.99 0.00 0.00 0.00 0.7545 0.0000 1876174.20 1876174.20 0.00% 412890.45 412890.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.92% 2.99 0 7 199526.87 98655 311644 196205.02 0 298212 596654 596654 0.00%
crit 50.08% 3.00 0 7 426496.54 218515 635753 423474.46 0 624979 1279520 1279520 0.00%

Action Details: New Moon

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Action Priority List

    st
    [T]:6.04
  • if_expr:astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Half Moon 8427 3.4% 5.7 57.56s 443146 367233 Direct 5.7 284798 577769 445497 54.9%

Stats Details: Half Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.70 5.67 0.00 0.00 0.00 1.2069 0.0000 2523995.59 2523995.59 0.00% 367233.46 367233.46
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 45.14% 2.56 0 7 284797.93 163777 448036 274649.25 0 442426 728370 728370 0.00%
crit 54.86% 3.11 0 7 577769.08 314115 913993 570287.58 0 873784 1795626 1795626 0.00%

Action Details: Half Moon

  • id:274282
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:24.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.875000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274282
  • name:Half Moon
  • school:astral
  • tooltip:
  • description:Deals {$s1=0} Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates {$=}{{$m3=240}/10} Astral Power.|r

Action Priority List

    st
    [U]:5.72
  • if_expr:astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (21918) 0.0% (8.8%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 8176 3.3% 97.1 3.06s 25237 0 Direct 96.8 16672 35765 25306 45.2%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 97.07 96.81 0.00 0.00 0.00 0.0000 0.0000 2449894.05 2449894.05 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.78% 53.03 22 88 16672.34 9981 33149 16678.53 14671 19171 884104 884104 0.00%
crit 45.22% 43.78 20 74 35765.12 20362 67624 35781.85 30780 42261 1565790 1565790 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 8191 3.3% 97.4 3.08s 25212 0 Direct 97.1 16658 35728 25281 45.2%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 97.37 97.10 0.00 0.00 0.00 0.0000 0.0000 2454851.16 2454851.16 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.78% 53.19 26 86 16658.35 9912 33149 16664.02 14613 18732 886097 886097 0.00%
crit 45.22% 43.91 21 75 35727.65 20220 67624 35742.32 31350 41604 1568754 1568754 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 5552 2.2% 6.5 46.76s 257016 0 Direct 6.5 168999 362991 257758 45.8%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.47 6.45 0.00 0.00 0.00 0.0000 0.0000 1663742.30 1663742.30 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.24% 3.50 0 8 168999.02 100083 322586 167593.93 0 303633 591714 591714 0.00%
crit 45.76% 2.95 0 8 362991.41 204170 661392 354887.56 0 624899 1072028 1072028 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 5810 2.3% 25.7 11.62s 67925 75602 Direct 26.7 45627 92931 65385 41.8%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.72 26.72 0.00 0.00 0.00 0.8985 0.0000 1747160.12 1747160.12 0.00% 75601.91 75601.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.23% 15.56 4 29 45626.87 20476 89108 45610.37 36752 55403 709970 709970 0.00%
crit 41.77% 11.16 1 24 92931.01 41772 187745 92869.88 54847 114054 1037190 1037190 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    st
    [L]:1.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
    st
    [P]:24.77
  • if_expr:variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Warrior of Elune2024251-1.000Spell DataNo-stacks
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Starsurge 79486 (107305) 31.9% (43.1%) 117.7 2.54s 272969 281826 Direct 117.4 (156.0) 136563 289542 202636 43.2% (43.7%)

Stats Details: Starsurge

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.66 117.40 0.00 0.00 0.00 0.9686 0.0000 23790303.05 23790303.05 0.00% 281825.91 281825.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.81% 66.70 38 96 136562.60 91245 263509 136622.59 125150 151881 9108137 9108137 0.00%
crit 43.19% 50.71 25 81 289541.63 185626 537559 289766.09 260262 334899 14682166 14682166 0.00%

Action Details: Starsurge

  • id:78674
  • school:astral
  • range:45.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:36.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.455000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.18

Spelldata

  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$s1=0} Astral damage.

Action Priority List

    st
    [Q]:83.14
  • if_expr:variable.starsurge_condition1
    st
    [X]:34.51
  • if_expr:variable.starsurge_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Flat Cost Incarnation: Chosen of Elune1025603-8.000Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Goldrinn's Fang 27820 11.2% 38.8 7.62s 214763 0 Direct 38.6 143660 302502 215802 45.4%

Stats Details: Goldrinns Fang

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.77 38.58 0.00 0.00 0.00 0.0000 0.0000 8326577.52 8326577.52 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.58% 21.06 5 41 143659.80 95410 275540 143716.70 114980 177875 3025590 3025590 0.00%
crit 45.42% 17.52 3 38 302502.22 194637 555064 302703.58 245390 380861 5300988 5300988 0.00%

Action Details: Goldrinns Fang

  • id:394047
  • school:astral
  • range:60.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.852000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10

Spelldata

  • id:394047
  • name:Goldrinn's Fang
  • school:astral
  • tooltip:Deals {$m1=0} Arcane damage.
  • description:Deals {$m1=0} Arcane damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountPower of Goldrinn3940462PCT1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Friend of the Fae39408310.100Spell Data
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Incarnation: Chosen of Elune10256020.100Spell Data
Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Dot / Debuff on Target Moonfire16481250.283Mastery
Sunfire16481550.283Mastery
Waning Twilight39395710.100
Sunfire 13105 5.3% 17.4 18.05s 225810 237154 Direct 17.4 9221 19032 13082 39.4%
Periodic 317.8 8231 17035 11643 38.8% 99.8%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.39 17.39 317.76 317.76 16.39 0.9522 0.9422 3927276.61 3927276.61 0.00% 12429.55 237154.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 60.64% 10.55 2 19 9220.85 5438 16086 9213.01 7639 11193 97251 97251 0.00%
crit 39.36% 6.85 0 16 19032.04 11094 32815 19031.63 0 24881 130284 130284 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 61.24% 194.59 129 266 8230.52 856 14587 8229.76 7794 8763 1601585 1601585 0.00%
crit 38.76% 123.17 79 183 17034.83 2280 29758 17036.22 16084 18195 2098157 2098157 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    st
    [J]:1.44
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [R]:15.95
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (4194) 0.0% (1.7%) 8.7 32.40s 144174 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.72 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 2185 0.9% 8.7 32.40s 75109 0 Direct 8.7 57836 117829 75111 28.8%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.72 8.72 0.00 0.00 0.00 0.0000 0.0000 655115.65 655115.65 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.21% 6.21 0 17 57835.67 57075 66076 57772.80 0 66076 359217 359217 0.00%
crit 28.79% 2.51 0 11 117828.97 116432 134796 108908.59 0 134796 295898 295898 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:51134.41
  • base_dd_max:51134.41
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 2009 0.8% 16.9 15.69s 35687 0 Direct 16.9 27501 56050 35687 28.7%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.88 16.88 0.00 0.00 0.00 0.0000 0.0000 602404.24 602404.24 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.33% 12.04 0 36 27500.80 27158 31441 27499.90 0 30727 331116 331116 0.00%
crit 28.67% 4.84 0 16 56049.56 55402 64140 55452.37 0 64140 271288 271288 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24330.91
  • base_dd_max:24330.91
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 23449 9.4% 119.5 2.46s 58743 63082 Direct 119.1 38602 81360 58971 47.6%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 119.54 119.08 0.00 0.00 0.00 0.9312 0.0000 7021961.41 7021961.41 0.00% 63081.90 63081.90
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.36% 62.35 35 96 38601.73 15081 124332 38610.17 33926 44583 2406875 2406875 0.00%
crit 47.64% 56.72 32 89 81360.36 30766 249169 81396.42 70999 93900 4615087 4615087 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    st
    [M]:0.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
    st
    [Y]:117.85

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.400Spell Data
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
howling_rune_3
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:howling_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:howling_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:howling_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 195.21s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    st
    [N]:2.00
  • if_expr:variable.cd_condition_st

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.7 74.02s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.68 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:howling_rune_3
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:70932.17
  • base_dd_max:70932.17
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.31s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:howling_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.74
Elemental Potion of Ultimate Power 1.5 306.77s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.47
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
Warrior of Elune 6.0 49.67s

Stats Details: Warrior Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.03 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Warrior Of Elune

  • id:202425
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202425
  • name:Warrior of Elune
  • school:arcane
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.

Action Priority List

    st
    [O]:6.03
  • if_expr:variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 9.1 1.2 34.4s 33.3s 8.3s 25.40% 29.32% 1.2 (6.6) 8.9

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 49.1s
  • trigger_min/max:2.7s / 49.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:22.32% / 27.93%

Stack Uptimes

  • balance_of_all_things_arcane_1:2.99%
  • balance_of_all_things_arcane_2:3.01%
  • balance_of_all_things_arcane_3:3.04%
  • balance_of_all_things_arcane_4:3.06%
  • balance_of_all_things_arcane_5:3.09%
  • balance_of_all_things_arcane_6:3.32%
  • balance_of_all_things_arcane_7:3.45%
  • balance_of_all_things_arcane_8:3.45%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 18.7 2.6 16.4s 14.3s 8.2s 51.01% 54.90% 2.6 (15.7) 18.1

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.0s
  • trigger_min/max:0.0s / 40.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.5s
  • uptime_min/max:45.70% / 54.56%

Stack Uptimes

  • balance_of_all_things_nature_1:6.05%
  • balance_of_all_things_nature_2:6.10%
  • balance_of_all_things_nature_3:6.18%
  • balance_of_all_things_nature_4:6.27%
  • balance_of_all_things_nature_5:6.38%
  • balance_of_all_things_nature_6:6.51%
  • balance_of_all_things_nature_7:6.65%
  • balance_of_all_things_nature_8:6.86%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 7.3 63.4 43.6s 4.1s 20.1s 48.87% 0.00% 35.2 (35.2) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.6s
  • trigger_min/max:0.8s / 42.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:42.87% / 54.99%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:4.61%
  • balance_t31_4pc_buff_lunar_2:4.39%
  • balance_t31_4pc_buff_lunar_3:4.84%
  • balance_t31_4pc_buff_lunar_4:5.67%
  • balance_t31_4pc_buff_lunar_5:29.35%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 13.9 103.8 22.2s 2.5s 19.6s 90.68% 0.00% 50.1 (50.1) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 58.0s
  • trigger_min/max:0.8s / 10.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:87.29% / 93.23%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:7.34%
  • balance_t31_4pc_buff_solar_2:11.04%
  • balance_t31_4pc_buff_solar_3:15.87%
  • balance_t31_4pc_buff_solar_4:11.58%
  • balance_t31_4pc_buff_solar_5:44.85%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 70.1s 70.1s 10.8s 10.04% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 354.9s
  • trigger_min/max:12.0s / 354.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 38.61%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.90%
  • best_friends_with_aerwynn_2:0.90%
  • best_friends_with_aerwynn_3:0.90%
  • best_friends_with_aerwynn_4:0.91%
  • best_friends_with_aerwynn_5:0.91%
  • best_friends_with_aerwynn_6:0.91%
  • best_friends_with_aerwynn_7:0.92%
  • best_friends_with_aerwynn_8:0.92%
  • best_friends_with_aerwynn_9:0.92%
  • best_friends_with_aerwynn_10:0.93%
  • best_friends_with_aerwynn_11:0.93%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 113.7s 70.1s 45.6s 33.31% 0.00% 69.4 (69.4) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 356.6s
  • trigger_min/max:12.0s / 354.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 334.1s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.31%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.4s 70.4s 10.8s 9.99% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 333.0s
  • trigger_min/max:12.0s / 333.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 37.14%

Stack Uptimes

  • best_friends_with_pip_1:0.89%
  • best_friends_with_pip_2:0.90%
  • best_friends_with_pip_3:0.90%
  • best_friends_with_pip_4:0.90%
  • best_friends_with_pip_5:0.91%
  • best_friends_with_pip_6:0.91%
  • best_friends_with_pip_7:0.91%
  • best_friends_with_pip_8:0.91%
  • best_friends_with_pip_9:0.92%
  • best_friends_with_pip_10:0.92%
  • best_friends_with_pip_11:0.92%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 114.1s 70.4s 45.7s 33.27% 0.00% 69.5 (69.5) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 355.4s
  • trigger_min/max:12.0s / 333.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 333.2s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.27%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 70.3s 70.3s 10.8s 10.04% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 341.5s
  • trigger_min/max:12.0s / 341.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 34.93%

Stack Uptimes

  • best_friends_with_urctos_1:0.90%
  • best_friends_with_urctos_2:0.90%
  • best_friends_with_urctos_3:0.90%
  • best_friends_with_urctos_4:0.91%
  • best_friends_with_urctos_5:0.91%
  • best_friends_with_urctos_6:0.91%
  • best_friends_with_urctos_7:0.92%
  • best_friends_with_urctos_8:0.92%
  • best_friends_with_urctos_9:0.92%
  • best_friends_with_urctos_10:0.93%
  • best_friends_with_urctos_11:0.93%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 113.7s 70.3s 45.6s 33.42% 0.00% 69.9 (69.9) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 352.0s
  • trigger_min/max:12.0s / 341.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 330.2s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.42%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 61.9s 58.5s 50.0s 80.14% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 349.0s
  • trigger_min/max:15.0s / 309.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 359.0s
  • uptime_min/max:45.21% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.14%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Denizen of the Dream 8.7 0.0 44.7s 31.3s 41.5s 58.21% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_denizen_of_the_dream
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 262.9s
  • trigger_min/max:0.0s / 149.4s
  • trigger_pct:99.98%
  • duration_min/max:0.0s / 238.8s
  • uptime_min/max:18.46% / 96.09%

Stack Uptimes

  • denizen_of_the_dream_1:38.78%
  • denizen_of_the_dream_2:14.85%
  • denizen_of_the_dream_3:3.76%
  • denizen_of_the_dream_4:0.71%
  • denizen_of_the_dream_5:0.11%
  • denizen_of_the_dream_6:0.02%
  • denizen_of_the_dream_7:0.00%

Spelldata

  • id:394076
  • name:Denizen of the Dream
  • tooltip:
  • description:{$@spelldesc394065=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Dreamstate 15.0 0.8 20.6s 20.7s 2.9s 14.68% 20.12% 0.8 (1.7) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.6s / 55.9s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.4s
  • uptime_min/max:7.81% / 26.11%

Stack Uptimes

  • dreamstate_1:9.16%
  • dreamstate_2:5.52%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 7.3 1.0 44.1s 43.6s 20.5s 49.85% 52.90% 1.0 (1.0) 6.9

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.6s
  • trigger_min/max:12.0s / 89.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:44.11% / 56.10%

Stack Uptimes

  • eclipse_lunar_1:49.85%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 13.8 5.4 22.4s 15.9s 20.2s 93.17% 96.28% 5.4 (5.4) 12.9

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 70.1s
  • trigger_min/max:0.0s / 55.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 68.9s
  • uptime_min/max:90.97% / 95.43%

Stack Uptimes

  • eclipse_solar_1:93.17%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 307.0s 307.0s 27.4s 13.21% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.3s
  • trigger_min/max:300.0s / 328.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.89% / 18.03%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.21%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Friend of the Fae 5.3 3.4 54.9s 31.3s 25.0s 44.26% 44.17% 3.4 (3.4) 4.8

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_friend_of_the_fae
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 205.5s
  • trigger_min/max:0.0s / 149.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 168.2s
  • uptime_min/max:14.10% / 80.48%

Stack Uptimes

  • friend_of_the_fae_1:44.26%

Spelldata

  • id:394083
  • name:Friend of the Fae
  • tooltip:Arcane and Nature damage increased by {$=}w1%.
  • description:{$@spelldesc394081=When a Faerie Dragon is summoned, your spells deal {$394083m1=10}% increased damage for {$394083d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 7.3 0.0 43.6s 43.6s 20.1s 48.95% 51.62% 0.0 (0.0) 6.9

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.6s
  • trigger_min/max:12.0s / 89.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:43.38% / 54.99%

Stack Uptimes

  • incarnation_chosen_of_elune_1:48.95%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.6 0.0 98.7s 98.7s 19.5s 23.37% 0.00% 0.0 (0.0) 3.3

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:65.76

Trigger Details

  • interval_min/max:90.0s / 121.5s
  • trigger_min/max:90.0s / 121.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.45% / 26.42%

Stack Uptimes

  • kindled_soul_5:1.12%
  • kindled_soul_10:1.15%
  • kindled_soul_15:1.15%
  • kindled_soul_20:1.15%
  • kindled_soul_25:1.15%
  • kindled_soul_30:1.16%
  • kindled_soul_35:1.16%
  • kindled_soul_40:1.16%
  • kindled_soul_45:1.17%
  • kindled_soul_50:1.17%
  • kindled_soul_55:1.17%
  • kindled_soul_60:1.17%
  • kindled_soul_65:1.18%
  • kindled_soul_70:1.18%
  • kindled_soul_75:1.18%
  • kindled_soul_80:1.19%
  • kindled_soul_85:1.19%
  • kindled_soul_90:1.19%
  • kindled_soul_95:1.19%
  • kindled_soul_100:1.20%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Grace 12.9 0.0 20.6s 20.6s 5.9s 25.37% 0.00% 0.0 (0.0) 12.6

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.8s / 70.4s
  • trigger_min/max:12.8s / 70.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:19.71% / 30.20%

Stack Uptimes

  • natures_grace_1:25.37%

Spelldata

  • id:393959
  • name:Nature's Grace
  • tooltip:Haste increased by {$s1=10}%.
  • description:{$@spelldesc393958=After an Eclipse ends, you gain {$393959s1=10}% Haste for {$393959d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Vigil 3.7 0.0 90.3s 90.3s 14.7s 18.42% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.8s
  • trigger_min/max:90.0s / 91.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.56% / 21.05%

Stack Uptimes

  • natures_vigil_1:18.42%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.2 74.5s 68.1s 7.8s 6.49% 7.17% 0.2 (0.2) 1.4

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 334.7s
  • trigger_min/max:0.1s / 334.7s
  • trigger_pct:15.00%
  • duration_min/max:0.0s / 33.9s
  • uptime_min/max:0.00% / 30.08%

Stack Uptimes

  • owlkin_frenzy_1:6.49%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 8.3 110.3 38.1s 38.1s 34.1s 94.11% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:23.6s / 49.5s
  • trigger_min/max:23.6s / 49.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.7s
  • uptime_min/max:90.64% / 96.78%

Stack Uptimes

  • primordial_arcanic_pulsar_4:5.08%
  • primordial_arcanic_pulsar_8:5.07%
  • primordial_arcanic_pulsar_12:6.73%
  • primordial_arcanic_pulsar_16:6.93%
  • primordial_arcanic_pulsar_20:6.49%
  • primordial_arcanic_pulsar_24:6.00%
  • primordial_arcanic_pulsar_28:6.62%
  • primordial_arcanic_pulsar_32:8.27%
  • primordial_arcanic_pulsar_36:6.71%
  • primordial_arcanic_pulsar_40:7.25%
  • primordial_arcanic_pulsar_44:7.35%
  • primordial_arcanic_pulsar_48:6.76%
  • primordial_arcanic_pulsar_52:7.87%
  • primordial_arcanic_pulsar_56:6.99%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 18.9 3.4 16.4s 14.3s 6.3s 39.76% 40.00% 3.4 (3.4) 18.4

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 49.6s
  • trigger_min/max:0.0s / 40.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.7s
  • uptime_min/max:35.72% / 42.67%

Stack Uptimes

  • solstice_1:39.76%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 20.8 96.9 14.6s 2.5s 14.0s 97.37% 0.00% 55.7 (55.7) 7.6

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 20.2s
  • trigger_min/max:0.8s / 10.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:93.79% / 99.19%

Stack Uptimes

  • starlord_1:9.05%
  • starlord_2:14.50%
  • starlord_3:73.82%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Wafting Devotion 4.3 1.2 61.2s 45.7s 16.5s 23.57% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 233.9s
  • trigger_min/max:0.0s / 221.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 83.5s
  • uptime_min/max:4.77% / 59.93%

Stack Uptimes

  • wafting_devotion_1:23.57%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Warrior of Elune 6.0 0.0 49.7s 49.7s 21.8s 43.70% 42.89% 0.0 (0.0) 2.5

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_warrior_of_elune
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:45.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 82.0s
  • trigger_min/max:45.0s / 82.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s
  • uptime_min/max:32.83% / 51.06%

Stack Uptimes

  • warrior_of_elune_1:20.75%
  • warrior_of_elune_2:5.12%
  • warrior_of_elune_3:17.84%

Spelldata

  • id:202425
  • name:Warrior of Elune
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.
  • max_stacks:0
  • duration:25.00
  • cooldown:45.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Denizen of the Dream 8.7 2.0 22.0 31.3s 0.0s 149.4s
Primordial Arcanic Pulsar 7.3 6.0 9.0 39.7s 28.5s 49.1s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.08% 0.00% 1.80% 0.4s 0.0s 3.3s
Astral Smolder 79.69% 60.47% 94.56% 15.8s 0.0s 126.0s
Incarnation (Total) 48.95% 43.38% 54.99% 20.1s 0.0s 54.0s
Incarnation (Pulsar) 28.69% 26.63% 31.06% 11.7s 0.0s 12.0s
Lunar Eclipse Only 0.90% 0.70% 1.11% 2.7s 2.5s 2.7s
Solar Eclipse Only 44.22% 36.69% 50.17% 11.2s 0.0s 15.0s
No Eclipse 5.91% 3.53% 8.11% 1.4s 0.0s 3.3s
Friend of the Fae 44.26% 14.10% 80.48% 25.0s 0.0s 168.2s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Warrior of Elune8.1950.00037.69949.52025.90871.180
Full Moon
New Moon
Half Moon
0.3400.00024.9345.7905.26030.433

Eclipse Utilization

NoneSolarLunarBoth
Wrath5.194.4%59.0850.3%0.000.0%53.2645.3%
Starfire24.7292.5%0.000.0%2.007.5%0.000.0%
Starsurge0.000.0%47.0140.0%0.000.0%70.6460.0%
New Moon0.010.2%0.254.2%0.000.0%5.7595.6%
Half Moon0.000.0%0.295.1%0.000.0%5.4094.9%
Full Moon0.201.7%3.0726.0%0.070.6%8.4471.6%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
howling_rune_3
Nature's BalanceAstral Power99.46198.835.37%2.000.100.05%
Full MoonAstral Power5.31265.287.16%49.920.410.16%
Half MoonAstral Power5.70136.713.69%24.000.000.00%
MoonfireAstral Power14.3586.022.32%6.000.050.06%
New MoonAstral Power6.0272.271.95%12.000.000.00%
Orbit BreakerAstral Power6.47193.125.21%29.841.060.55%
Shooting Stars (Moonfire)Astral Power97.07193.945.23%2.000.190.10%
Shooting Stars (Sunfire)Astral Power97.36194.545.25%2.000.190.10%
StarfireAstral Power26.72391.3710.56%14.652.900.74%
SunfireAstral Power17.39104.342.82%6.000.010.01%
WrathAstral Power119.541869.4750.45%15.640.000.00%
Usage Type Count Total Tot% Avg RPE APR
howling_rune_3
StarsurgeAstral Power 117.843718.30100.00%31.5531.608637.51
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 896660.0 4158.30 4999.24 1693474.2 644460.5 -803172.6 896660.0
Astral Power 70.0 12.36 12.38 4.9 23.4 0.0 100.0

Statistics & Data Analysis

Fight Length
howling_rune_3 Fight Length
Count 20505
Mean 299.90
Minimum 240.00
Maximum 359.99
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 34.6301
5th Percentile 245.99
95th Percentile 353.70
( 95th Percentile - 5th Percentile ) 107.71
Mean Distribution
Standard Deviation 0.2418
95.00% Confidence Interval ( 299.43 - 300.38 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 513
0.1% Error 51221
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1024
DPS
howling_rune_3 Damage Per Second
Count 20505
Mean 249012.18
Minimum 215617.08
Maximum 290353.79
Spread ( max - min ) 74736.71
Range [ ( max - min ) / 2 * 100% ] 15.01%
Standard Deviation 9089.2768
5th Percentile 234655.53
95th Percentile 264389.09
( 95th Percentile - 5th Percentile ) 29733.56
Mean Distribution
Standard Deviation 63.4745
95.00% Confidence Interval ( 248887.77 - 249136.59 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5119
0.1 Scale Factor Error with Delta=300 705249
0.05 Scale Factor Error with Delta=300 2820995
0.01 Scale Factor Error with Delta=300 70524875
Priority Target DPS
howling_rune_3 Priority Target Damage Per Second
Count 20505
Mean 249012.18
Minimum 215617.08
Maximum 290353.79
Spread ( max - min ) 74736.71
Range [ ( max - min ) / 2 * 100% ] 15.01%
Standard Deviation 9089.2768
5th Percentile 234655.53
95th Percentile 264389.09
( 95th Percentile - 5th Percentile ) 29733.56
Mean Distribution
Standard Deviation 63.4745
95.00% Confidence Interval ( 248887.77 - 249136.59 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5119
0.1 Scale Factor Error with Delta=300 705249
0.05 Scale Factor Error with Delta=300 2820995
0.01 Scale Factor Error with Delta=300 70524875
DPS(e)
howling_rune_3 Damage Per Second (Effective)
Count 20505
Mean 249012.18
Minimum 215617.08
Maximum 290353.79
Spread ( max - min ) 74736.71
Range [ ( max - min ) / 2 * 100% ] 15.01%
Damage
howling_rune_3 Damage
Count 20505
Mean 72194789.28
Minimum 53164234.31
Maximum 91813405.15
Spread ( max - min ) 38649170.84
Range [ ( max - min ) / 2 * 100% ] 26.77%
DTPS
howling_rune_3 Damage Taken Per Second
Count 20505
Mean 4999.38
Minimum 1121.11
Maximum 11101.06
Spread ( max - min ) 9979.95
Range [ ( max - min ) / 2 * 100% ] 99.81%
HPS
howling_rune_3 Healing Per Second
Count 20505
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
howling_rune_3 Healing Per Second (Effective)
Count 20505
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
howling_rune_3 Heal
Count 20505
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
howling_rune_3 Healing Taken Per Second
Count 20505
Mean 4147.28
Minimum 845.96
Maximum 8438.00
Spread ( max - min ) 7592.04
Range [ ( max - min ) / 2 * 100% ] 91.53%
TMI
howling_rune_3 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
howling_rune_3Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
howling_rune_3 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.47 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.60 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.74 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.st
# count action,conditions
J 1.44 sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
K 1.33 moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
0.00 starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
0.00 starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
L 1.00 starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
M 0.00 wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
0.00 celestial_alignment,if=variable.cd_condition_st
N 2.00 incarnation,if=variable.cd_condition_st
0.00 variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
0.00 variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
O 6.03 warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
P 24.77 starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
0.00 wrath,if=variable.enter_eclipse
0.00 variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
0.00 convoke_the_spirits,if=variable.convoke_condition
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+55
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 starfall,if=buff.starweavers_warp.up
0.00 variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
Q 83.14 starsurge,if=variable.starsurge_condition1
R 15.95 sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
S 13.01 moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
T 6.04 new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
U 5.72 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
V 5.36 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
W 12.20 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
X 34.51 starsurge,if=variable.starsurge_condition2
Y 117.85 wrath
Z 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFJKLNDEQQQTUQQVYYXYRXYXYSYQQQYYYYXYYOXTXXQYYRWQQYQYYYYXSYXYXXYPPYQQRYQYYYYXYXPPQSYQUQQQJOVYXXYYPPQQYQSRYYYXFYXYYPPQQYYQYYRSYXYXETUQQQYYOXYYXPPQRYWQQSYYQYYXYYPPXRYQYQYQYYYSYXYYXYWQQRQVPOPQQYQYYYWQSYQRYQPPQFYYNTWQQQUQVQQRQSYYYYQQEYQYYYTXYYXYRWQQQSYYOYYXYYXXYPPQQRQQUQYYYSXYPPWQQYYQRYYYXYYXYWQPPQSYQYYRYOXYYFWQQVQQQTYYSXRPPWQQQYYQYYYYXYXPPQDRSYQYQYYYEYOYXUQQQQRVXXSTPPXXWYYQ

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask howling_rune_3 50.0/100: 50% astral_power
Pre precombat 1 food howling_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 2 augmentation howling_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 4 no_cd_talent howling_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 5 on_use_trinket howling_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 6 on_use_trinket howling_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 7 on_use_trinket howling_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 60.0/100: 60% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil howling_rune_3 50.0/100: 50% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.000 st J sunfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.915 st K moonfire Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:01.832 st L starfire Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, corrupting_rage
0:02.657 st N incarnation_chosen_of_elune Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, corrupting_rage
0:02.657 default D potion Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), corrupting_rage
0:02.657 default E use_items Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power
0:02.657 st Q starsurge Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:03.489 st Q starsurge Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:04.289 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:05.060 st T new_moon Fluffy_Pillow 12.0/100: 12% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:05.815 st U half_moon Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:06.806 st Q starsurge Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
0:07.562 st Q starsurge Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
0:08.318 st V full_moon Fluffy_Pillow 2.0/100: 2% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:09.803 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:10.561 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:11.315 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(60)
0:12.070 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(55)
0:12.824 st R sunfire Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(50)
0:13.579 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(50)
0:14.333 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(45)
0:15.087 st X starsurge Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(40)
0:15.841 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(35)
0:16.595 st S moonfire Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(35)
0:17.349 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(30)
0:18.102 st Q starsurge Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(25)
0:18.880 st Q starsurge Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(20)
0:19.634 st Q starsurge Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(20)
0:20.389 st Y wrath Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(15)
0:21.141 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(10)
0:21.894 st Y wrath Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(5)
0:22.648 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(5)
0:23.401 st X starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, elemental_potion_of_ultimate_power
0:24.155 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, elemental_potion_of_ultimate_power
0:24.910 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, elemental_potion_of_ultimate_power
0:25.664 st O warrior_of_elune Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, elemental_potion_of_ultimate_power
0:25.664 st X starsurge Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, elemental_potion_of_ultimate_power
0:26.419 st T new_moon Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:27.173 st X starsurge Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:27.927 st X starsurge Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:28.681 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:29.436 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:30.191 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:30.946 st R sunfire Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:31.702 st W cancel_buff Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:31.702 st Q starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:32.478 st Q starsurge Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:33.232 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, corrupting_rage
0:33.988 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, corrupting_rage
0:34.740 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, corrupting_rage
0:35.495 st Y wrath Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:36.251 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:37.007 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:37.761 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:38.516 st S moonfire Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:39.269 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:40.024 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:40.990 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:41.955 st X starsurge Fluffy_Pillow 76.0/100: 76% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:42.921 st X starsurge Fluffy_Pillow 50.0/100: 50% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:43.886 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:44.852 st P starfire Fluffy_Pillow 34.0/100: 34% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn(11), corrupting_rage
0:45.608 st P starfire Fluffy_Pillow 52.8/100: 53% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), best_friends_with_aerwynn(10), corrupting_rage
0:46.363 st Y wrath Fluffy_Pillow 71.6/100: 72% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn(9), corrupting_rage
0:47.330 st Q starsurge Fluffy_Pillow 89.6/100: 90% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, warrior_of_elune, best_friends_with_aerwynn(8), corrupting_rage
0:48.411 st Q starsurge Fluffy_Pillow 59.6/100: 60% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn(7), corrupting_rage
0:49.451 st R sunfire Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(6), corrupting_rage
0:50.452 st Y wrath Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(5), corrupting_rage
0:51.453 st Q starsurge Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(4), corrupting_rage
0:52.553 st Y wrath Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(3), corrupting_rage
0:53.615 st Y wrath Fluffy_Pillow 31.6/100: 32% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(2), corrupting_rage
0:54.678 st Y wrath Fluffy_Pillow 49.6/100: 50% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn, corrupting_rage
0:55.741 st Y wrath Fluffy_Pillow 65.6/100: 66% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), corrupting_rage
0:56.803 st X starsurge Fluffy_Pillow 81.6/100: 82% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), corrupting_rage
0:57.864 st Y wrath Fluffy_Pillow 47.6/100: 48% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(4), corrupting_rage
0:58.924 st X starsurge Fluffy_Pillow 63.6/100: 64% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(4), corrupting_rage
0:59.986 st P starfire Fluffy_Pillow 29.6/100: 30% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), corrupting_rage
1:01.577 st P starfire Fluffy_Pillow 43.6/100: 44% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(52), starlord(3), dreamstate, corrupting_rage
1:02.447 st Q starsurge Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, dreamstate, corrupting_rage
1:03.528 st S moonfire Fluffy_Pillow 21.6/100: 22% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, balance_t31_4pc_buff_solar, dreamstate, corrupting_rage
1:04.568 st Y wrath Fluffy_Pillow 29.6/100: 30% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, balance_t31_4pc_buff_solar, corrupting_rage
1:05.324 st Q starsurge Fluffy_Pillow 47.6/100: 48% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, balance_t31_4pc_buff_solar, corrupting_rage
1:06.363 st U half_moon Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, corrupting_rage
1:07.576 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, corrupting_rage
1:08.578 st Q starsurge Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), corrupting_rage
1:09.544 st Q starsurge Fluffy_Pillow 29.6/100: 30% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), corrupting_rage
1:10.510 st J sunfire Fluffy_Pillow 1.6/100: 2% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), corrupting_rage
1:11.474 st O warrior_of_elune Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), corrupting_rage
1:11.474 st V full_moon Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), corrupting_rage
1:13.401 st Y wrath Fluffy_Pillow 65.6/100: 66% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(11), best_friends_with_pip_static, corrupting_rage
1:14.366 st X starsurge Fluffy_Pillow 81.6/100: 82% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage
1:15.331 st X starsurge Fluffy_Pillow 55.6/100: 56% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage
1:16.297 st Y wrath Fluffy_Pillow 29.6/100: 30% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(8), best_friends_with_pip_static
1:17.263 st Y wrath Fluffy_Pillow 45.6/100: 46% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(7), best_friends_with_pip_static
1:18.231 st P starfire Fluffy_Pillow 59.6/100: 60% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), warrior_of_elune(3), dreamstate, best_friends_with_pip(6), best_friends_with_pip_static
1:18.983 st P starfire Fluffy_Pillow 76.4/100: 76% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), warrior_of_elune(2), best_friends_with_pip(5), best_friends_with_pip_static
1:19.739 st Q starsurge Fluffy_Pillow 93.2/100: 93% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, warrior_of_elune, best_friends_with_pip(4), best_friends_with_pip_static
1:20.821 st Q starsurge Fluffy_Pillow 57.2/100: 57% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip(3), best_friends_with_pip_static
1:21.861 st Y wrath Fluffy_Pillow 25.2/100: 25% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(2), best_friends_with_pip_static
1:22.862 st Q starsurge Fluffy_Pillow 45.2/100: 45% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip, best_friends_with_pip_static
1:23.864 st S moonfire Fluffy_Pillow 11.2/100: 11% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static
1:24.927 st R sunfire Fluffy_Pillow 21.2/100: 21% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static
1:25.989 st Y wrath Fluffy_Pillow 27.2/100: 27% astral_power balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static
1:27.051 st Y wrath Fluffy_Pillow 45.2/100: 45% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static
1:28.113 st Y wrath Fluffy_Pillow 61.2/100: 61% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static
1:29.177 st X starsurge Fluffy_Pillow 77.2/100: 77% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static
1:30.239 default F natures_vigil howling_rune_3 43.2/100: 43% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static
1:30.239 st Y wrath Fluffy_Pillow 43.2/100: 43% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static
1:31.300 st X starsurge Fluffy_Pillow 61.2/100: 61% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
1:32.361 st Y wrath Fluffy_Pillow 25.2/100: 25% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
1:33.424 st Y wrath Fluffy_Pillow 43.2/100: 43% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
1:34.486 st P starfire Fluffy_Pillow 53.2/100: 53% astral_power natures_vigil, denizen_of_the_dream(2), natures_grace, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, dreamstate, best_friends_with_pip_static, corrupting_rage
1:35.241 st P starfire Fluffy_Pillow 72.0/100: 72% astral_power natures_vigil, denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(40), best_friends_with_pip_static, corrupting_rage
1:36.214 st Q starsurge Fluffy_Pillow 86.0/100: 86% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, best_friends_with_pip_static, corrupting_rage
1:37.297 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_pip_static, corrupting_rage
1:38.336 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power natures_vigil, balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, corrupting_rage
1:39.338 st Y wrath Fluffy_Pillow 34.0/100: 34% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, corrupting_rage
1:40.339 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power natures_vigil, balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, corrupting_rage
1:41.441 st Y wrath Fluffy_Pillow 18.0/100: 18% astral_power natures_vigil, balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
1:42.502 st Y wrath Fluffy_Pillow 38.0/100: 38% astral_power natures_vigil, balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
1:43.564 st R sunfire Fluffy_Pillow 56.0/100: 56% astral_power natures_vigil, balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
1:44.624 st S moonfire Fluffy_Pillow 64.0/100: 64% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
1:45.687 st Y wrath Fluffy_Pillow 72.0/100: 72% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
1:46.748 st X starsurge Fluffy_Pillow 88.0/100: 88% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage
1:47.811 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
1:48.874 st X starsurge Fluffy_Pillow 70.0/100: 70% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
1:49.935 default E use_items Fluffy_Pillow 36.0/100: 36% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
1:49.935 st T new_moon Fluffy_Pillow 36.0/100: 36% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
1:50.688 st U half_moon Fluffy_Pillow 48.0/100: 48% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
1:51.973 st Q starsurge Fluffy_Pillow 80.0/100: 80% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage, kindled_soul(90)
1:53.053 st Q starsurge Fluffy_Pillow 56.0/100: 56% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(85)
1:54.094 st Q starsurge Fluffy_Pillow 32.0/100: 32% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(80)
1:55.094 st Y wrath Fluffy_Pillow 4.0/100: 4% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage, kindled_soul(75)
1:56.058 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(10), best_friends_with_pip_static, corrupting_rage, kindled_soul(70)
1:57.023 st O warrior_of_elune Fluffy_Pillow 40.0/100: 40% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage, kindled_soul(65)
1:57.023 st X starsurge Fluffy_Pillow 40.0/100: 40% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(9), best_friends_with_pip_static, corrupting_rage, kindled_soul(65)
1:57.989 st Y wrath Fluffy_Pillow 12.0/100: 12% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(8), best_friends_with_pip_static, corrupting_rage, kindled_soul(60)
1:58.955 st Y wrath Fluffy_Pillow 28.0/100: 28% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(7), best_friends_with_pip_static, corrupting_rage, kindled_soul(55)
1:59.920 st X starsurge Fluffy_Pillow 76.0/100: 76% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage, kindled_soul(55)
2:00.885 st P starfire Fluffy_Pillow 50.0/100: 50% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(50)
2:01.640 st P starfire Fluffy_Pillow 68.8/100: 69% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage, kindled_soul(45)
2:02.394 st Q starsurge Fluffy_Pillow 85.6/100: 86% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_pip(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(40)
2:03.360 st R sunfire Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(35)
2:04.326 st Y wrath Fluffy_Pillow 59.6/100: 60% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip, best_friends_with_pip_static, corrupting_rage, kindled_soul(30)
2:05.291 st W cancel_buff Fluffy_Pillow 77.6/100: 78% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip_static, corrupting_rage, kindled_soul(25)
2:05.291 st Q starsurge Fluffy_Pillow 77.6/100: 78% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip_static, corrupting_rage, kindled_soul(25)
2:06.373 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(20)
2:07.412 st S moonfire Fluffy_Pillow 11.6/100: 12% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(15)
2:08.512 st Y wrath Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(10)
2:09.613 st Y wrath Fluffy_Pillow 35.6/100: 36% astral_power balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(5)
2:10.716 st Q starsurge Fluffy_Pillow 51.6/100: 52% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:11.739 st Y wrath Fluffy_Pillow 15.6/100: 16% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:12.726 st Y wrath Fluffy_Pillow 33.6/100: 34% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:13.714 st X starsurge Fluffy_Pillow 51.6/100: 52% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:14.702 st Y wrath Fluffy_Pillow 15.6/100: 16% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:15.689 st Y wrath Fluffy_Pillow 33.6/100: 34% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:16.675 st P starfire Fluffy_Pillow 43.6/100: 44% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, dreamstate, best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:17.430 st P starfire Fluffy_Pillow 60.4/100: 60% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:18.240 st X starsurge Fluffy_Pillow 74.4/100: 74% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:19.139 st R sunfire Fluffy_Pillow 42.4/100: 42% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:20.037 st Y wrath Fluffy_Pillow 48.4/100: 48% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:20.936 st Q starsurge Fluffy_Pillow 66.4/100: 66% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, balance_t31_4pc_buff_solar, best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:21.940 st Y wrath Fluffy_Pillow 34.4/100: 34% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:22.907 st Q starsurge Fluffy_Pillow 54.4/100: 54% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:23.970 st Y wrath Fluffy_Pillow 20.4/100: 20% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:24.993 st Q starsurge Fluffy_Pillow 38.4/100: 38% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip(11), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:26.017 st Y wrath Fluffy_Pillow 4.4/100: 4% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip(10), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:27.003 st Y wrath Fluffy_Pillow 24.4/100: 24% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip(9), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:27.989 st Y wrath Fluffy_Pillow 42.4/100: 42% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip(8), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:28.977 st S moonfire Fluffy_Pillow 58.4/100: 58% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip(8), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:29.964 st Y wrath Fluffy_Pillow 66.4/100: 66% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip(7), best_friends_with_pip_static, wafting_devotion, corrupting_rage
2:30.950 st X starsurge Fluffy_Pillow 84.4/100: 84% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip(6), best_friends_with_pip_static, wafting_devotion
2:31.937 st Y wrath Fluffy_Pillow 50.4/100: 50% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip(5), best_friends_with_pip_static, wafting_devotion
2:32.836 st Y wrath Fluffy_Pillow 68.4/100: 68% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip(4), best_friends_with_pip_static, wafting_devotion
2:33.735 st X starsurge Fluffy_Pillow 86.4/100: 86% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip(3), best_friends_with_pip_static, wafting_devotion
2:34.633 st Y wrath Fluffy_Pillow 60.4/100: 60% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(2), best_friends_with_pip_static
2:35.598 st W cancel_buff Fluffy_Pillow 76.4/100: 76% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip, best_friends_with_pip_static
2:35.598 st Q starsurge Fluffy_Pillow 76.4/100: 76% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip, best_friends_with_pip_static
2:36.678 st Q starsurge Fluffy_Pillow 50.4/100: 50% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static
2:37.717 st R sunfire Fluffy_Pillow 24.4/100: 24% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static
2:38.717 st Q starsurge Fluffy_Pillow 30.4/100: 30% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static
2:39.718 st V full_moon Fluffy_Pillow 6.4/100: 6% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static
2:41.645 st P starfire Fluffy_Pillow 56.4/100: 56% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(11), best_friends_with_pip_static
2:43.092 st O warrior_of_elune Fluffy_Pillow 70.4/100: 70% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), starlord(3), dreamstate(2), best_friends_with_pip(10), best_friends_with_pip_static
2:43.092 st P starfire Fluffy_Pillow 70.4/100: 70% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip(10), best_friends_with_pip_static
2:43.846 st Q starsurge Fluffy_Pillow 89.2/100: 89% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), warrior_of_elune(2), dreamstate, best_friends_with_pip(9), best_friends_with_pip_static
2:44.810 st Q starsurge Fluffy_Pillow 55.2/100: 55% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar, dreamstate, best_friends_with_pip(8), best_friends_with_pip_static
2:45.777 st Y wrath Fluffy_Pillow 21.2/100: 21% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip(7), best_friends_with_pip_static, corrupting_rage
2:46.531 st Q starsurge Fluffy_Pillow 41.2/100: 41% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip(7), best_friends_with_pip_static, corrupting_rage
2:47.498 st Y wrath Fluffy_Pillow 7.2/100: 7% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage
2:48.463 st Y wrath Fluffy_Pillow 25.2/100: 25% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip(5), best_friends_with_pip_static, corrupting_rage
2:49.429 st Y wrath Fluffy_Pillow 41.2/100: 41% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage
2:50.490 st W cancel_buff Fluffy_Pillow 59.2/100: 59% astral_power balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip(3), best_friends_with_pip_static, corrupting_rage
2:50.490 st Q starsurge Fluffy_Pillow 59.2/100: 59% astral_power balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip(3), best_friends_with_pip_static, corrupting_rage
2:51.678 st S moonfire Fluffy_Pillow 25.2/100: 25% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord, warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_pip, best_friends_with_pip_static, corrupting_rage
2:52.821 st Y wrath Fluffy_Pillow 31.2/100: 31% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord, warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
2:53.966 st Q starsurge Fluffy_Pillow 49.2/100: 49% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord, warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, corrupting_rage
2:55.111 st R sunfire Fluffy_Pillow 15.2/100: 15% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
2:56.213 st Y wrath Fluffy_Pillow 21.2/100: 21% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
2:57.316 st Q starsurge Fluffy_Pillow 39.2/100: 39% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, corrupting_rage
2:58.417 st P starfire Fluffy_Pillow 3.2/100: 3% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(2), dreamstate, best_friends_with_pip_static, corrupting_rage
2:59.173 st P starfire Fluffy_Pillow 20.0/100: 20% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, best_friends_with_pip_static, corrupting_rage
2:59.927 st Q starsurge Fluffy_Pillow 36.8/100: 37% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_pip_static, corrupting_rage
3:00.893 default F natures_vigil howling_rune_3 34.8/100: 35% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_pip_static, corrupting_rage
3:00.893 st Y wrath Fluffy_Pillow 34.8/100: 35% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_pip_static, corrupting_rage
3:01.858 st Y wrath Fluffy_Pillow 54.8/100: 55% astral_power natures_vigil, balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_pip_static, corrupting_rage
3:02.823 st N incarnation_chosen_of_elune Fluffy_Pillow 72.8/100: 73% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, corrupting_rage
3:02.823 st T new_moon Fluffy_Pillow 72.8/100: 73% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), dreamstate(2), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, corrupting_rage
3:03.575 st W cancel_buff Fluffy_Pillow 90.8/100: 91% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), dreamstate(2), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage
3:03.575 st Q starsurge Fluffy_Pillow 90.8/100: 91% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, dreamstate(2), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage
3:04.558 st Q starsurge Fluffy_Pillow 64.8/100: 65% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage
3:05.597 st Q starsurge Fluffy_Pillow 36.8/100: 37% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate(2), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, corrupting_rage
3:06.598 st U half_moon Fluffy_Pillow 12.8/100: 13% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, corrupting_rage
3:07.883 st Q starsurge Fluffy_Pillow 42.8/100: 43% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, corrupting_rage
3:08.848 st V full_moon Fluffy_Pillow 18.8/100: 19% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, corrupting_rage
3:10.776 st Q starsurge Fluffy_Pillow 70.8/100: 71% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, corrupting_rage
3:11.741 st Q starsurge Fluffy_Pillow 44.8/100: 45% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate(2), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, corrupting_rage
3:12.706 st R sunfire Fluffy_Pillow 22.8/100: 23% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate(2), best_friends_with_aerwynn, best_friends_with_aerwynn_static, corrupting_rage
3:13.673 st Q starsurge Fluffy_Pillow 30.8/100: 31% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
3:14.573 st S moonfire Fluffy_Pillow 2.8/100: 3% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate(2), best_friends_with_pip(11), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:15.471 st Y wrath Fluffy_Pillow 10.8/100: 11% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, best_friends_with_pip(10), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:16.225 st Y wrath Fluffy_Pillow 26.8/100: 27% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(10), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:16.980 st Y wrath Fluffy_Pillow 42.8/100: 43% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:17.879 st Y wrath Fluffy_Pillow 60.8/100: 61% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(8), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:18.775 st Q starsurge Fluffy_Pillow 78.8/100: 79% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(7), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:19.780 st Q starsurge Fluffy_Pillow 52.8/100: 53% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(6), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:20.746 default E use_items Fluffy_Pillow 24.8/100: 25% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:20.746 st Y wrath Fluffy_Pillow 24.8/100: 25% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(100)
3:21.676 st Q starsurge Fluffy_Pillow 42.8/100: 43% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(100)
3:22.609 st Y wrath Fluffy_Pillow 14.8/100: 15% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(95)
3:23.508 st Y wrath Fluffy_Pillow 32.8/100: 33% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(90)
3:24.408 st Y wrath Fluffy_Pillow 50.8/100: 51% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip, best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(85)
3:25.307 st T new_moon Fluffy_Pillow 68.8/100: 69% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip, best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(80)
3:26.310 st X starsurge Fluffy_Pillow 80.8/100: 81% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(75)
3:27.209 st Y wrath Fluffy_Pillow 54.8/100: 55% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(70)
3:28.106 st Y wrath Fluffy_Pillow 72.8/100: 73% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(65)
3:29.006 st X starsurge Fluffy_Pillow 88.8/100: 89% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(60)
3:29.973 st Y wrath Fluffy_Pillow 60.8/100: 61% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(55)
3:30.940 st R sunfire Fluffy_Pillow 78.8/100: 79% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(50)
3:31.906 st W cancel_buff Fluffy_Pillow 84.8/100: 85% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(45)
3:31.906 st Q starsurge Fluffy_Pillow 84.8/100: 85% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(45)
3:32.987 st Q starsurge Fluffy_Pillow 58.8/100: 59% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(40)
3:34.025 st Q starsurge Fluffy_Pillow 34.8/100: 35% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(35)
3:35.027 st S moonfire Fluffy_Pillow 6.8/100: 7% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(30)
3:35.992 st Y wrath Fluffy_Pillow 12.8/100: 13% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(25)
3:36.956 st Y wrath Fluffy_Pillow 30.8/100: 31% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(20)
3:37.921 st O warrior_of_elune Fluffy_Pillow 46.8/100: 47% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(15)
3:37.921 st Y wrath Fluffy_Pillow 46.8/100: 47% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(15)
3:38.887 st Y wrath Fluffy_Pillow 64.8/100: 65% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(10)
3:39.853 st X starsurge Fluffy_Pillow 82.8/100: 83% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(5)
3:40.817 st Y wrath Fluffy_Pillow 54.8/100: 55% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static
3:41.782 st Y wrath Fluffy_Pillow 72.8/100: 73% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static
3:42.748 st X starsurge Fluffy_Pillow 90.8/100: 91% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static
3:43.714 st X starsurge Fluffy_Pillow 62.8/100: 63% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static
3:44.680 st Y wrath Fluffy_Pillow 34.8/100: 35% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:45.646 st P starfire Fluffy_Pillow 48.8/100: 49% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip_static, corrupting_rage
3:46.401 st P starfire Fluffy_Pillow 65.6/100: 66% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(2), best_friends_with_pip_static, corrupting_rage
3:47.155 st Q starsurge Fluffy_Pillow 82.4/100: 82% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, warrior_of_elune, best_friends_with_pip_static, corrupting_rage
3:48.236 st Q starsurge Fluffy_Pillow 50.4/100: 50% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
3:49.183 st R sunfire Fluffy_Pillow 24.4/100: 24% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
3:50.094 st Q starsurge Fluffy_Pillow 32.4/100: 32% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
3:51.004 st Q starsurge Fluffy_Pillow 38.4/100: 38% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
3:51.968 st U half_moon Fluffy_Pillow 12.4/100: 12% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
3:53.253 st Q starsurge Fluffy_Pillow 36.4/100: 36% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
3:54.220 st Y wrath Fluffy_Pillow 10.4/100: 10% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:55.187 st Y wrath Fluffy_Pillow 26.4/100: 26% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:56.152 st Y wrath Fluffy_Pillow 42.4/100: 42% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:57.117 st S moonfire Fluffy_Pillow 60.4/100: 60% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:58.082 st X starsurge Fluffy_Pillow 66.4/100: 66% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
3:59.047 st Y wrath Fluffy_Pillow 38.4/100: 38% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
4:00.011 st P starfire Fluffy_Pillow 50.4/100: 50% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune, dreamstate, best_friends_with_pip_static, corrupting_rage
4:00.764 st P starfire Fluffy_Pillow 67.2/100: 67% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_pip_static, corrupting_rage
4:01.633 st W cancel_buff Fluffy_Pillow 79.2/100: 79% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, corrupting_rage
4:01.633 st Q starsurge Fluffy_Pillow 79.2/100: 79% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, corrupting_rage
4:02.714 st Q starsurge Fluffy_Pillow 43.2/100: 43% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage
4:03.753 st Y wrath Fluffy_Pillow 9.2/100: 9% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage
4:04.754 st Y wrath Fluffy_Pillow 29.2/100: 29% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, corrupting_rage
4:05.757 st Q starsurge Fluffy_Pillow 47.2/100: 47% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, corrupting_rage
4:06.859 st R sunfire Fluffy_Pillow 15.2/100: 15% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(32), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, corrupting_rage
4:07.919 st Y wrath Fluffy_Pillow 23.2/100: 23% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, corrupting_rage
4:08.979 st Y wrath Fluffy_Pillow 41.2/100: 41% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, corrupting_rage
4:10.039 st Y wrath Fluffy_Pillow 61.2/100: 61% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, corrupting_rage
4:11.102 st X starsurge Fluffy_Pillow 77.2/100: 77% astral_power eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, corrupting_rage
4:12.164 st Y wrath Fluffy_Pillow 43.2/100: 43% astral_power eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn, best_friends_with_aerwynn_static, corrupting_rage
4:13.226 st Y wrath Fluffy_Pillow 59.2/100: 59% astral_power eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, corrupting_rage
4:14.288 st X starsurge Fluffy_Pillow 75.2/100: 75% astral_power eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, corrupting_rage
4:15.349 st Y wrath Fluffy_Pillow 43.2/100: 43% astral_power eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, corrupting_rage
4:16.410 st W cancel_buff Fluffy_Pillow 59.2/100: 59% astral_power eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, corrupting_rage
4:16.410 st Q starsurge Fluffy_Pillow 59.2/100: 59% astral_power eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(40), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, corrupting_rage
4:17.597 st P starfire Fluffy_Pillow 25.2/100: 25% astral_power natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(44), starlord, dreamstate, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, corrupting_rage
4:18.351 st P starfire Fluffy_Pillow 39.2/100: 39% astral_power natures_grace, primordial_arcanic_pulsar(44), starlord, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage
4:19.287 st Q starsurge Fluffy_Pillow 51.2/100: 51% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage
4:20.327 st S moonfire Fluffy_Pillow 19.2/100: 19% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar, best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, corrupting_rage
4:21.329 st Y wrath Fluffy_Pillow 31.2/100: 31% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, corrupting_rage
4:22.329 st Q starsurge Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, corrupting_rage
4:23.332 st Y wrath Fluffy_Pillow 17.2/100: 17% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, corrupting_rage
4:24.393 st Y wrath Fluffy_Pillow 35.2/100: 35% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, corrupting_rage
4:25.455 st R sunfire Fluffy_Pillow 51.2/100: 51% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static
4:26.517 st Y wrath Fluffy_Pillow 59.2/100: 59% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static
4:27.580 st O warrior_of_elune Fluffy_Pillow 79.2/100: 79% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn, best_friends_with_aerwynn_static
4:27.580 st X starsurge Fluffy_Pillow 79.2/100: 79% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn, best_friends_with_aerwynn_static
4:28.643 st Y wrath Fluffy_Pillow 45.2/100: 45% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static
4:29.705 st Y wrath Fluffy_Pillow 63.2/100: 63% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(11), best_friends_with_urctos_static
4:30.766 default F natures_vigil howling_rune_3 83.2/100: 83% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(10), best_friends_with_urctos_static
4:30.893 st W cancel_buff Fluffy_Pillow 83.2/100: 83% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(10), best_friends_with_urctos_static
4:30.893 st Q starsurge Fluffy_Pillow 83.2/100: 83% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(56), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(10), best_friends_with_urctos_static
4:32.081 st Q starsurge Fluffy_Pillow 49.2/100: 49% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_urctos(9), best_friends_with_urctos_static
4:33.121 st V full_moon Fluffy_Pillow 25.2/100: 25% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(8), best_friends_with_urctos_static
4:35.118 st Q starsurge Fluffy_Pillow 81.2/100: 81% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(6), best_friends_with_urctos_static
4:36.118 st Q starsurge Fluffy_Pillow 57.2/100: 57% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(5), best_friends_with_urctos_static
4:37.087 st Q starsurge Fluffy_Pillow 31.2/100: 31% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(4), best_friends_with_urctos_static
4:38.053 st T new_moon Fluffy_Pillow 3.2/100: 3% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(3), best_friends_with_urctos_static
4:38.807 st Y wrath Fluffy_Pillow 15.2/100: 15% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(2), best_friends_with_urctos_static
4:39.772 st Y wrath Fluffy_Pillow 65.2/100: 65% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos, best_friends_with_urctos_static
4:40.736 st S moonfire Fluffy_Pillow 83.2/100: 83% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
4:41.701 st X starsurge Fluffy_Pillow 89.2/100: 89% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
4:42.667 st R sunfire Fluffy_Pillow 65.2/100: 65% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
4:43.632 st P starfire Fluffy_Pillow 73.2/100: 73% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, corrupting_rage
4:44.388 st P starfire Fluffy_Pillow 90.0/100: 90% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_urctos_static, corrupting_rage
4:45.143 st W cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
4:45.143 st Q starsurge Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
4:46.223 st Q starsurge Fluffy_Pillow 68.0/100: 68% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_urctos_static, corrupting_rage
4:47.262 st Q starsurge Fluffy_Pillow 36.0/100: 36% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, corrupting_rage
4:48.261 st Y wrath Fluffy_Pillow 4.0/100: 4% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage
4:49.226 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage
4:50.287 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage
4:51.349 st Y wrath Fluffy_Pillow 6.0/100: 6% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage
4:52.410 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage
4:53.471 st Y wrath Fluffy_Pillow 38.0/100: 38% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage
4:54.532 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage
4:55.595 st X starsurge Fluffy_Pillow 76.0/100: 76% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage
4:56.657 st Y wrath Fluffy_Pillow 40.0/100: 40% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, corrupting_rage
4:57.719 st X starsurge Fluffy_Pillow 60.0/100: 60% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, corrupting_rage
4:58.779 st P starfire Fluffy_Pillow 24.0/100: 24% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, corrupting_rage
5:00.370 st P starfire Fluffy_Pillow 38.0/100: 38% astral_power natures_grace, primordial_arcanic_pulsar(44), dreamstate, best_friends_with_urctos_static, corrupting_rage
5:01.344 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, dreamstate, best_friends_with_urctos_static, corrupting_rage
5:02.426 default D potion Fluffy_Pillow 16.0/100: 16% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord, balance_t31_4pc_buff_solar, dreamstate, best_friends_with_urctos_static, corrupting_rage
5:02.657 st R sunfire Fluffy_Pillow 16.0/100: 16% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord, balance_t31_4pc_buff_solar, dreamstate, best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:03.697 st S moonfire Fluffy_Pillow 26.0/100: 26% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord, balance_t31_4pc_buff_solar, dreamstate, best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:04.736 st Y wrath Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:05.489 st Q starsurge Fluffy_Pillow 54.0/100: 54% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:06.633 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:07.737 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(52), starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:08.837 st Y wrath Fluffy_Pillow 2.0/100: 2% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:09.898 st Y wrath Fluffy_Pillow 20.0/100: 20% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:10.959 st Y wrath Fluffy_Pillow 36.0/100: 36% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:12.020 default E use_items Fluffy_Pillow 54.0/100: 54% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:12.020 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
5:13.081 st O warrior_of_elune Fluffy_Pillow 72.0/100: 72% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
5:13.081 st Y wrath Fluffy_Pillow 72.0/100: 72% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
5:14.143 st X starsurge Fluffy_Pillow 88.0/100: 88% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
5:15.203 st U half_moon Fluffy_Pillow 56.0/100: 56% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
5:16.488 st Q starsurge Fluffy_Pillow 88.0/100: 88% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
5:17.494 st Q starsurge Fluffy_Pillow 64.0/100: 64% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
5:18.459 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
5:19.390 st Q starsurge Fluffy_Pillow 48.0/100: 48% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
5:20.287 st R sunfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
5:21.186 st V full_moon Fluffy_Pillow 30.0/100: 30% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
5:22.979 st X starsurge Fluffy_Pillow 80.0/100: 80% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
5:23.878 st X starsurge Fluffy_Pillow 52.0/100: 52% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
5:24.777 st S moonfire Fluffy_Pillow 26.0/100: 26% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
5:25.677 st T new_moon Fluffy_Pillow 32.0/100: 32% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
5:26.431 st P starfire Fluffy_Pillow 44.0/100: 44% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
5:27.186 st P starfire Fluffy_Pillow 64.8/100: 65% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
5:27.941 st X starsurge Fluffy_Pillow 83.6/100: 84% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
5:28.839 st X starsurge Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
5:29.737 st W cancel_buff Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
5:29.737 st Y wrath Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
5:30.744 st Y wrath Fluffy_Pillow 35.6/100: 36% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
5:31.749 st Q starsurge Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)

Stats

Level Bonus (70) Race Bonus (tauren) Raid-Buffed Unbuffed Gear Amount
Strength 898 2 986 900 0
Agility 2089 -2 2173 2087 0
Stamina 3848 2 44833 42698 38825
Intellect 2089 -2 15807 14885 12090 (7538)
Spirit 0 0 0 0 0
Health 896660 853960 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 15807 14885 0
Crit 28.51% 22.30% 3114
Haste 26.60% 26.60% 4522
Versatility 6.30% 1.30% 267
Mana Regen 2560 2560 0
Attack Power 16439 15480 0
Mastery 29.91% 29.91% 7842
Armor 5324 5324 5324
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 489.00
Local Head Benevolent Embersage's Casque
ilevel: 489, stats: { 673 Armor, +3966 Sta, +704 Crit, +330 Haste, +938 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }, enchant: incandescent_essence
Local Neck Eye of the Rising Flame
ilevel: 489, stats: { +2231 Sta, +256 Haste, +1537 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Life-Bound Shoulderpads
ilevel: 486, stats: { 603 Armor, +2875 Sta, +383 Mastery, +383 Haste, +684 AgiInt }
item effects: { equip: Toxified }
Local Chest Benevolent Embersage's Robe
ilevel: 489, stats: { 897 Armor, +3966 Sta, +715 Crit, +318 Mastery, +938 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 489, stats: { 505 Armor, +2975 Sta, +535 Haste, +241 Mastery, +704 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 489, stats: { 785 Armor, +3966 Sta, +705 Haste, +328 Mastery, +938 AgiInt }, enchant: { +155 StrAgiInt, +41 Vers (lambent_armor_kit_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 486, stats: { 548 Armor, +2875 Sta, +274 Crit, +438 Haste, +684 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Thermal Bindings
ilevel: 489, stats: { 449 Armor, +2231 Sta, +191 Crit, +390 Mastery, +528 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Benevolent Embersage's Talons
ilevel: 489, stats: { 505 Armor, +2975 Sta, +226 Vers, +549 Mastery, +704 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 489, stats: { +2231 Sta, +512 Haste, +1281 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 489, stats: { +2231 Sta, +1230 Crit, +564 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 489, stats: { +892 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 489, stats: { +738 Mastery }
item effects: { use: Balefire Branch }
Local Back Drape of the Loyal Vassal
ilevel: 489, stats: { 359 Armor, +2231 Sta, +328 Haste, +253 Mastery, +528 StrAgiInt }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 489, weapon: { 606 - 781, 2.6 }, stats: { +469 Int, +2264 Int, +1983 Sta, +156 Haste, +361 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Howling Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 489, stats: { +1439 Int, +1983 Sta, +174 Haste, +343 Mastery }

Profile

druid="howling_rune_3"
source=default
spec=balance
level=70
race=tauren
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:howling_rune_3

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=489,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=489,gem_id=192961/192961/192961
shoulders=lifebound_shoulderpads,id=193406,bonus_id=8836/1576/8797/8960,ilevel=486,crafted_stats=49/36
back=drape_of_the_loyal_vassal,id=158375,bonus_id=4795,ilevel=489
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=489,enchant_id=6625
wrists=thermal_bindings,id=134461,bonus_id=4795,ilevel=489,gem_id=192961
hands=benevolent_embersages_talons,id=207255,bonus_id=4795,ilevel=489
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=489,enchant_id=6830
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=486
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=489
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=489
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=489,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=489

# Gear Summary
# gear_ilvl=488.63
# gear_stamina=38825
# gear_intellect=12090
# gear_crit_rating=3114
# gear_haste_rating=4522
# gear_mastery_rating=7842
# gear_versatility_rating=267
# gear_armor=5324
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

Simulation & Raid Information

Iterations: 20537
Threads: 32
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 528825013
Max Event Queue: 78
Sim Seconds: 6160948
CPU Seconds: 463.0168
Physical Seconds: 19.2890
Speed Up: 13306

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Base Base astral_smolder ticks -394061 5250876 17503 23.68 44344 0 66.9 118.4 0.0% 0.0% 0.0% 0.0% 4.46sec 5250876 299.98sec
Base Base augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
Base Base denizen_of_the_dream 394065 0 0 0.00 0 0 8.6 0.0 0.0% 0.0% 0.0% 0.0% 31.85sec 0 299.98sec
Base Base_Denizen of the Dream fey_missile 188046 2327970 61090 239.23 11702 24303 152.9 151.9 28.7% 0.0% 0.0% 0.0% 1.72sec 2327970 38.11sec
Base Base flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
Base Base food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
Base Base hungering_shadowflame 424324 1168073 3894 3.48 51660 105557 17.4 17.4 28.9% 0.0% 0.0% 0.0% 16.61sec 1168073 299.98sec
Base Base hungering_shadowflame_self 424324 688222 2294 3.48 30452 62101 17.4 17.4 28.9% 0.0% 0.0% 0.0% 16.61sec 761764 299.98sec
Base Base incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 190.53sec 0 299.98sec
Base Base launched_thorns 379403 2136530 7122 6.85 48090 98013 34.4 34.3 28.6% 0.0% 0.0% 0.0% 8.58sec 2136530 299.98sec
Base Base launched_thorns_heal 379407 0 0 0.00 0 0 0.7 0.0 0.0% 0.0% 0.0% 0.0% 64.85sec 0 299.98sec
Base Base moonfire 8921 183780 613 2.87 9209 19255 14.3 14.3 35.9% 0.0% 0.0% 0.0% 21.60sec 3853400 299.98sec
Base Base moonfire ticks -8921 3669621 12232 62.45 8334 17744 14.3 312.2 36.3% 0.0% 0.0% 0.0% 21.60sec 3853400 299.98sec
Base Base moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
Base Base moons_talent 274281 0 0 0.00 0 0 17.0 0.0 0.0% 0.0% 0.0% 0.0% 17.94sec 0 299.98sec
Base Base full_moon 274283 2531169 8438 1.05 325208 650109 5.3 5.3 47.6% 0.0% 0.0% 0.0% 62.66sec 2531169 299.98sec
Base Base new_moon 274281 1874513 6249 1.20 200548 428680 6.0 6.0 49.5% 0.0% 0.0% 0.0% 53.51sec 1874513 299.98sec
Base Base half_moon 274282 2501382 8339 1.13 282179 571901 5.7 5.7 55.2% 0.0% 0.0% 0.0% 57.79sec 2501382 299.98sec
Base Base natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.31sec 0 299.98sec
Base Base overwhelming_rage ticks -374037 799400 2665 3.94 40536 0 4.1 19.7 0.0% 0.0% 0.0% 0.0% 59.52sec 884134 299.98sec
Base Base potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.00sec 0 299.98sec
Base Base shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
Base Base shooting_stars_moonfire 202497 2395268 7985 19.05 16619 35534 95.5 95.2 45.1% 0.0% 0.0% 0.0% 3.12sec 2395268 299.98sec
Base Base shooting_stars_sunfire 202497 2399597 7999 19.10 16587 35502 95.8 95.5 45.1% 0.0% 0.0% 0.0% 3.12sec 2399597 299.98sec
Base Base orbit_breaker 274283 1625375 5418 1.27 168094 359889 6.4 6.4 45.7% 0.0% 0.0% 0.0% 47.54sec 1625375 299.98sec
Base Base starfire 194153 1772302 5908 5.41 45686 93101 26.0 27.0 41.8% 0.0% 0.0% 0.0% 11.45sec 1772302 299.98sec
Base Base starsurge 78674 23461390 78210 23.22 136603 288385 116.4 116.1 43.1% 0.0% 0.0% 0.0% 2.56sec 23461390 299.98sec
Base Base goldrinns_fang 394047 8226148 27422 7.65 143694 301370 38.4 38.2 45.3% 0.0% 0.0% 0.0% 7.64sec 8226148 299.98sec
Base Base sunfire 93402 227563 759 3.48 9216 19023 17.4 17.4 39.4% 0.0% 0.0% 0.0% 18.05sec 3865790 299.98sec
Base Base sunfire ticks -93402 3638227 12127 62.64 8220 16997 17.4 313.2 38.7% 0.0% 0.0% 0.0% 18.05sec 3865790 299.98sec
Base Base tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.6 0.0 0.0% 0.0% 0.0% 0.0% 32.24sec 0 299.98sec
Base Base denizen_of_the_flame 426486 644013 2147 1.71 57826 117851 8.6 8.6 28.8% 0.0% 0.0% 0.0% 32.24sec 644013 299.98sec
Base Base denizen_of_the_flame_secondary 426431 592697 1976 3.32 27497 56057 16.6 16.6 28.7% 0.0% 0.0% 0.0% 15.63sec 592697 299.98sec
Base Base warrior_of_elune 202425 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 49.05sec 0 299.98sec
Base Base wrath 190984 6890259 22969 23.37 38700 81323 117.3 116.8 47.6% 0.0% 0.0% 0.0% 2.51sec 6890259 299.98sec
buzzing_rune_3 buzzing_rune_3 astral_smolder ticks -394061 5445443 18151 24.06 45261 0 69.4 120.3 0.0% 0.0% 0.0% 0.0% 4.28sec 5445443 300.07sec
buzzing_rune_3 buzzing_rune_3 augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.07sec
buzzing_rune_3 buzzing_rune_3 denizen_of_the_dream 394065 0 0 0.00 0 0 8.6 0.0 0.0% 0.0% 0.0% 0.0% 31.90sec 0 300.07sec
buzzing_rune_3 buzzing_rune_3_Denizen of the Dream fey_missile 188046 2350872 60419 233.43 11694 24296 152.3 151.4 30.4% 0.0% 0.0% 0.0% 1.72sec 2350872 38.91sec
buzzing_rune_3 buzzing_rune_3 flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.07sec
buzzing_rune_3 buzzing_rune_3 food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.07sec
buzzing_rune_3 buzzing_rune_3 hungering_shadowflame 424324 1182701 3941 3.48 51753 105216 17.4 17.4 30.4% 0.0% 0.0% 0.0% 16.59sec 1182701 300.07sec
buzzing_rune_3 buzzing_rune_3 hungering_shadowflame_self 424324 697845 2326 3.48 30451 62097 17.4 17.4 30.6% 0.0% 0.0% 0.0% 16.59sec 772369 300.07sec
buzzing_rune_3 buzzing_rune_3 incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 190.38sec 0 300.07sec
buzzing_rune_3 buzzing_rune_3 launched_thorns 379403 2168043 7225 6.85 48084 98018 34.4 34.3 30.4% 0.0% 0.0% 0.0% 8.53sec 2168043 300.07sec
buzzing_rune_3 buzzing_rune_3 launched_thorns_heal 379407 0 0 0.00 0 0 0.7 0.0 0.0% 0.0% 0.0% 0.0% 64.70sec 0 300.07sec
buzzing_rune_3 buzzing_rune_3 moonfire 8921 186779 622 2.87 9217 19250 14.4 14.4 37.8% 0.0% 0.0% 0.0% 21.60sec 3906683 300.07sec
buzzing_rune_3 buzzing_rune_3 moonfire ticks -8921 3719905 12400 62.47 8334 17733 14.4 312.4 38.0% 0.0% 0.0% 0.0% 21.60sec 3906683 300.07sec
buzzing_rune_3 buzzing_rune_3 moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.07sec
buzzing_rune_3 buzzing_rune_3 moons_talent 274281 0 0 0.00 0 0 17.0 0.0 0.0% 0.0% 0.0% 0.0% 17.92sec 0 300.07sec
buzzing_rune_3 buzzing_rune_3 full_moon 274283 2563329 8543 1.05 325261 651424 5.3 5.3 49.2% 0.0% 0.0% 0.0% 62.86sec 2563329 300.07sec
buzzing_rune_3 buzzing_rune_3 new_moon 274281 1896581 6321 1.20 200521 427806 6.0 6.0 51.2% 0.0% 0.0% 0.0% 53.47sec 1896581 300.07sec
buzzing_rune_3 buzzing_rune_3 half_moon 274282 2529892 8431 1.13 282126 572839 5.7 5.7 56.7% 0.0% 0.0% 0.0% 57.66sec 2529892 300.07sec
buzzing_rune_3 buzzing_rune_3 natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.30sec 0 300.07sec
buzzing_rune_3 buzzing_rune_3 overwhelming_rage ticks -374037 796576 2655 3.93 40535 0 4.0 19.7 0.0% 0.0% 0.0% 0.0% 58.50sec 881040 300.07sec
buzzing_rune_3 buzzing_rune_3 potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 306.98sec 0 300.07sec
buzzing_rune_3 buzzing_rune_3 shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.07sec
buzzing_rune_3 buzzing_rune_3 shooting_stars_moonfire 202497 2428812 8094 19.06 16615 35521 95.6 95.3 46.9% 0.0% 0.0% 0.0% 3.12sec 2428812 300.07sec
buzzing_rune_3 buzzing_rune_3 shooting_stars_sunfire 202497 2430598 8100 19.11 16590 35464 95.8 95.6 46.8% 0.0% 0.0% 0.0% 3.11sec 2430598 300.07sec
buzzing_rune_3 buzzing_rune_3 orbit_breaker 274283 1641453 5470 1.27 167891 359832 6.4 6.4 47.0% 0.0% 0.0% 0.0% 47.50sec 1641453 300.07sec
buzzing_rune_3 buzzing_rune_3 starfire 194153 1793808 5978 5.41 45697 93131 26.1 27.1 43.4% 0.0% 0.0% 0.0% 11.47sec 1793808 300.07sec
buzzing_rune_3 buzzing_rune_3 starsurge 78674 23764320 79197 23.22 136564 288306 116.4 116.1 44.8% 0.0% 0.0% 0.0% 2.56sec 23764320 300.07sec
buzzing_rune_3 buzzing_rune_3 goldrinns_fang 394047 8327904 27753 7.64 143674 301450 38.4 38.2 47.0% 0.0% 0.0% 0.0% 7.72sec 8327904 300.07sec
buzzing_rune_3 buzzing_rune_3 sunfire 93402 230496 768 3.48 9215 19036 17.4 17.4 41.1% 0.0% 0.0% 0.0% 18.05sec 3918180 300.07sec
buzzing_rune_3 buzzing_rune_3 sunfire ticks -93402 3687683 12292 62.66 8223 16999 17.4 313.3 40.4% 0.0% 0.0% 0.0% 18.05sec 3918180 300.07sec
buzzing_rune_3 buzzing_rune_3 tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.6 0.0 0.0% 0.0% 0.0% 0.0% 31.56sec 0 300.07sec
buzzing_rune_3 buzzing_rune_3 denizen_of_the_flame 426486 653071 2176 1.71 57827 117848 8.6 8.6 30.6% 0.0% 0.0% 0.0% 31.56sec 653071 300.07sec
buzzing_rune_3 buzzing_rune_3 denizen_of_the_flame_secondary 426431 600483 2001 3.32 27500 56052 16.6 16.6 30.4% 0.0% 0.0% 0.0% 15.28sec 600483 300.07sec
buzzing_rune_3 buzzing_rune_3 warrior_of_elune 202425 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 49.03sec 0 300.07sec
buzzing_rune_3 buzzing_rune_3 wrath 190984 6979521 23260 23.37 38698 81342 117.3 116.9 49.3% 0.0% 0.0% 0.0% 2.50sec 6979521 300.07sec
hissing_rune_3 hissing_rune_3 astral_smolder ticks -394061 5299636 17665 23.68 44758 0 66.9 118.4 0.0% 0.0% 0.0% 0.0% 4.45sec 5299636 300.02sec
hissing_rune_3 hissing_rune_3 augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
hissing_rune_3 hissing_rune_3 denizen_of_the_dream 394065 0 0 0.00 0 0 8.6 0.0 0.0% 0.0% 0.0% 0.0% 31.76sec 0 300.02sec
hissing_rune_3 hissing_rune_3_Denizen of the Dream fey_missile 188046 2355310 58109 224.87 11842 24596 152.8 151.9 28.7% 0.0% 0.0% 0.0% 1.70sec 2355310 40.53sec
hissing_rune_3 hissing_rune_3 flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
hissing_rune_3 hissing_rune_3 food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
hissing_rune_3 hissing_rune_3 hungering_shadowflame 424324 1173396 3911 3.49 51768 105635 17.4 17.4 28.8% 0.0% 0.0% 0.0% 16.67sec 1173396 300.02sec
hissing_rune_3 hissing_rune_3 hungering_shadowflame_self 424324 689281 2297 3.49 30452 62099 17.4 17.4 28.7% 0.0% 0.0% 0.0% 16.67sec 762934 300.02sec
hissing_rune_3 hissing_rune_3 incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 190.51sec 0 300.02sec
hissing_rune_3 hissing_rune_3 launched_thorns 379403 2142674 7142 6.86 48084 98019 34.4 34.3 28.7% 0.0% 0.0% 0.0% 8.51sec 2142674 300.02sec
hissing_rune_3 hissing_rune_3 launched_thorns_heal 379407 0 0 0.00 0 0 0.7 0.0 0.0% 0.0% 0.0% 0.0% 68.75sec 0 300.02sec
hissing_rune_3 hissing_rune_3 moonfire 8921 185721 619 2.87 9290 19441 14.3 14.3 36.0% 0.0% 0.0% 0.0% 21.60sec 3890753 300.02sec
hissing_rune_3 hissing_rune_3 moonfire ticks -8921 3705031 12350 62.46 8412 17910 14.3 312.3 36.3% 0.0% 0.0% 0.0% 21.60sec 3890753 300.02sec
hissing_rune_3 hissing_rune_3 moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
hissing_rune_3 hissing_rune_3 moons_talent 274281 0 0 0.00 0 0 17.0 0.0 0.0% 0.0% 0.0% 0.0% 17.95sec 0 300.02sec
hissing_rune_3 hissing_rune_3 full_moon 274283 2580499 8601 1.05 331306 663358 5.3 5.3 47.6% 0.0% 0.0% 0.0% 62.93sec 2580499 300.02sec
hissing_rune_3 hissing_rune_3 new_moon 274281 1909559 6365 1.20 204216 436594 6.0 6.0 49.4% 0.0% 0.0% 0.0% 53.57sec 1909559 300.02sec
hissing_rune_3 hissing_rune_3 half_moon 274282 2550498 8501 1.13 287386 583322 5.7 5.7 55.2% 0.0% 0.0% 0.0% 57.87sec 2550498 300.02sec
hissing_rune_3 hissing_rune_3 natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.34sec 0 300.02sec
hissing_rune_3 hissing_rune_3 overwhelming_rage ticks -374037 802785 2676 3.96 40538 0 4.1 19.8 0.0% 0.0% 0.0% 0.0% 58.93sec 887835 300.02sec
hissing_rune_3 hissing_rune_3 potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 306.65sec 0 300.02sec
hissing_rune_3 hissing_rune_3 shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
hissing_rune_3 hissing_rune_3 shooting_stars_moonfire 202497 2438737 8129 19.04 16931 36202 95.4 95.2 45.1% 0.0% 0.0% 0.0% 3.12sec 2438737 300.02sec
hissing_rune_3 hissing_rune_3 shooting_stars_sunfire 202497 2446631 8155 19.11 16903 36186 95.8 95.6 45.1% 0.0% 0.0% 0.0% 3.11sec 2446631 300.02sec
hissing_rune_3 hissing_rune_3 orbit_breaker 274283 1653265 5511 1.27 171430 366655 6.4 6.4 45.5% 0.0% 0.0% 0.0% 47.57sec 1653265 300.02sec
hissing_rune_3 hissing_rune_3 starfire 194153 1786392 5954 5.41 46083 93982 26.0 27.0 41.7% 0.0% 0.0% 0.0% 11.49sec 1786392 300.02sec
hissing_rune_3 hissing_rune_3 starsurge 78674 23921125 79732 23.23 139127 293920 116.4 116.1 43.2% 0.0% 0.0% 0.0% 2.56sec 23921125 300.02sec
hissing_rune_3 hissing_rune_3 goldrinns_fang 394047 8374033 27912 7.64 146388 307311 38.4 38.2 45.2% 0.0% 0.0% 0.0% 7.72sec 8374033 300.02sec
hissing_rune_3 hissing_rune_3 sunfire 93402 229531 765 3.48 9302 19200 17.4 17.4 39.3% 0.0% 0.0% 0.0% 18.04sec 3902208 300.02sec
hissing_rune_3 hissing_rune_3 sunfire ticks -93402 3672677 12242 62.65 8297 17159 17.4 313.3 38.7% 0.0% 0.0% 0.0% 18.04sec 3902208 300.02sec
hissing_rune_3 hissing_rune_3 tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.6 0.0 0.0% 0.0% 0.0% 0.0% 31.56sec 0 300.02sec
hissing_rune_3 hissing_rune_3 denizen_of_the_flame 426486 644232 2147 1.72 57827 117844 8.6 8.6 28.7% 0.0% 0.0% 0.0% 31.56sec 644232 300.02sec
hissing_rune_3 hissing_rune_3 denizen_of_the_flame_secondary 426431 593343 1978 3.32 27499 56056 16.6 16.6 28.7% 0.0% 0.0% 0.0% 15.37sec 593343 300.02sec
hissing_rune_3 hissing_rune_3 warrior_of_elune 202425 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 49.03sec 0 300.02sec
hissing_rune_3 hissing_rune_3 wrath 190984 6958335 23193 23.37 39048 82127 117.3 116.9 47.6% 0.0% 0.0% 0.0% 2.50sec 6958335 300.02sec
howling_rune_3 howling_rune_3 astral_smolder ticks -394061 5320292 17734 23.83 44656 0 67.9 119.1 0.0% 0.0% 0.0% 0.0% 4.37sec 5320292 299.90sec
howling_rune_3 howling_rune_3 augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
howling_rune_3 howling_rune_3 denizen_of_the_dream 394065 0 0 0.00 0 0 8.7 0.0 0.0% 0.0% 0.0% 0.0% 31.09sec 0 299.90sec
howling_rune_3 howling_rune_3_Denizen of the Dream fey_missile 188046 2387438 61452 240.58 11705 24319 156.7 155.8 28.7% 0.0% 0.0% 0.0% 1.66sec 2387438 38.85sec
howling_rune_3 howling_rune_3 flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
howling_rune_3 howling_rune_3 food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
howling_rune_3 howling_rune_3 hungering_shadowflame 424324 1185104 3952 3.53 51712 105324 17.7 17.7 28.7% 0.0% 0.0% 0.0% 16.57sec 1185104 299.90sec
howling_rune_3 howling_rune_3 hungering_shadowflame_self 424324 698488 2329 3.53 30451 62096 17.7 17.7 28.8% 0.0% 0.0% 0.0% 16.57sec 773085 299.90sec
howling_rune_3 howling_rune_3 incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 195.21sec 0 299.90sec
howling_rune_3 howling_rune_3 launched_thorns 379403 2169404 7234 6.95 48086 98015 34.9 34.8 28.7% 0.0% 0.0% 0.0% 8.54sec 2169404 299.90sec
howling_rune_3 howling_rune_3 launched_thorns_heal 379407 0 0 0.00 0 0 0.7 0.0 0.0% 0.0% 0.0% 0.0% 74.02sec 0 299.90sec
howling_rune_3 howling_rune_3 moonfire 8921 185343 618 2.87 9247 19367 14.3 14.3 36.3% 0.0% 0.0% 0.0% 21.59sec 3917189 299.90sec
howling_rune_3 howling_rune_3 moonfire ticks -8921 3731846 12439 63.36 8344 17787 14.3 316.8 36.4% 0.0% 0.0% 0.0% 21.59sec 3917189 299.90sec
howling_rune_3 howling_rune_3 moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
howling_rune_3 howling_rune_3 moons_talent 274281 0 0 0.00 0 0 17.0 0.0 0.0% 0.0% 0.0% 0.0% 17.93sec 0 299.90sec
howling_rune_3 howling_rune_3 full_moon 274283 2563345 8547 1.06 328813 657135 5.3 5.3 47.6% 0.0% 0.0% 0.0% 62.24sec 2563345 299.90sec
howling_rune_3 howling_rune_3 new_moon 274281 1876174 6256 1.20 199527 426497 6.0 6.0 50.1% 0.0% 0.0% 0.0% 53.39sec 1876174 299.90sec
howling_rune_3 howling_rune_3 half_moon 274282 2523996 8416 1.13 284798 577769 5.7 5.7 54.9% 0.0% 0.0% 0.0% 57.56sec 2523996 299.90sec
howling_rune_3 howling_rune_3 natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.31sec 0 299.90sec
howling_rune_3 howling_rune_3 overwhelming_rage ticks -374037 800796 2669 3.95 40537 0 4.1 19.8 0.0% 0.0% 0.0% 0.0% 57.79sec 885662 299.90sec
howling_rune_3 howling_rune_3 potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 306.77sec 0 299.90sec
howling_rune_3 howling_rune_3 shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
howling_rune_3 howling_rune_3 shooting_stars_moonfire 202497 2449894 8169 19.37 16672 35765 97.1 96.8 45.2% 0.0% 0.0% 0.0% 3.06sec 2449894 299.90sec
howling_rune_3 howling_rune_3 shooting_stars_sunfire 202497 2454851 8185 19.43 16658 35728 97.4 97.1 45.2% 0.0% 0.0% 0.0% 3.08sec 2454851 299.90sec
howling_rune_3 howling_rune_3 orbit_breaker 274283 1663742 5548 1.29 168999 362991 6.5 6.5 45.8% 0.0% 0.0% 0.0% 46.76sec 1663742 299.90sec
howling_rune_3 howling_rune_3 starfire 194153 1747160 5826 5.35 45627 92931 25.7 26.7 41.8% 0.0% 0.0% 0.0% 11.62sec 1747160 299.90sec
howling_rune_3 howling_rune_3 starsurge 78674 23790303 79327 23.49 136563 289542 117.7 117.4 43.2% 0.0% 0.0% 0.0% 2.54sec 23790303 299.90sec
howling_rune_3 howling_rune_3 goldrinns_fang 394047 8326578 27764 7.72 143660 302502 38.8 38.6 45.4% 0.0% 0.0% 0.0% 7.62sec 8326578 299.90sec
howling_rune_3 howling_rune_3 sunfire 93402 227535 759 3.48 9221 19032 17.4 17.4 39.4% 0.0% 0.0% 0.0% 18.05sec 3927277 299.90sec
howling_rune_3 howling_rune_3 sunfire ticks -93402 3699742 12332 63.55 8231 17035 17.4 317.8 38.8% 0.0% 0.0% 0.0% 18.05sec 3927277 299.90sec
howling_rune_3 howling_rune_3 tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.7 0.0 0.0% 0.0% 0.0% 0.0% 32.40sec 0 299.90sec
howling_rune_3 howling_rune_3 denizen_of_the_flame 426486 655116 2184 1.75 57836 117829 8.7 8.7 28.8% 0.0% 0.0% 0.0% 32.40sec 655116 299.90sec
howling_rune_3 howling_rune_3 denizen_of_the_flame_secondary 426431 602404 2009 3.38 27501 56050 16.9 16.9 28.7% 0.0% 0.0% 0.0% 15.69sec 602404 299.90sec
howling_rune_3 howling_rune_3 warrior_of_elune 202425 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 49.67sec 0 299.90sec
howling_rune_3 howling_rune_3 wrath 190984 7021961 23414 23.82 38602 81360 119.5 119.1 47.6% 0.0% 0.0% 0.0% 2.46sec 7021961 299.90sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
230666.5 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Waning Twilight 5.3 0.0 56.7s 56.7s 52.7s 93.03% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 329.5s
  • trigger_min/max:6.2s / 329.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 356.6s
  • uptime_min/max:72.20% / 99.74%

Stack Uptimes

  • waning_twilight_1:93.03%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 5.0 0.0 59.4s 59.4s 55.7s 93.72% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 347.0s
  • trigger_min/max:6.2s / 347.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 354.3s
  • uptime_min/max:77.78% / 99.74%

Stack Uptimes

  • waning_twilight_1:93.72%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 5.3 0.0 56.7s 56.8s 52.7s 93.04% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 331.1s
  • trigger_min/max:6.0s / 331.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 349.7s
  • uptime_min/max:73.22% / 99.73%

Stack Uptimes

  • waning_twilight_1:93.04%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 5.0 0.0 59.0s 59.0s 56.4s 93.37% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 333.6s
  • trigger_min/max:6.2s / 333.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 356.8s
  • uptime_min/max:72.35% / 99.74%

Stack Uptimes

  • waning_twilight_1:93.37%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 83514
Mean 299.99
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 34.6340
5th Percentile 245.86
95th Percentile 353.86
( 95th Percentile - 5th Percentile ) 107.99
Mean Distribution
Standard Deviation 0.1198
95.00% Confidence Interval ( 299.76 - 300.23 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 513
0.1% Error 51202
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1024
DPS
Fluffy_Pillow Damage Per Second
Count 83514
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 83514
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 83514
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 83514
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 83514
Mean 248086.91
Minimum 214708.90
Maximum 293103.83
Spread ( max - min ) 78394.94
Range [ ( max - min ) / 2 * 100% ] 15.80%
Standard Deviation 9263.2674
5th Percentile 233458.99
95th Percentile 263840.39
( 95th Percentile - 5th Percentile ) 30381.40
Mean Distribution
Standard Deviation 32.0542
95.00% Confidence Interval ( 248024.08 - 248149.73 )
Normalized 95.00% Confidence Interval ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 54
0.1% Error 5356
0.1 Scale Factor Error with Delta=300 732508
0.05 Scale Factor Error with Delta=300 2930030
0.01 Scale Factor Error with Delta=300 73250749
HPS
Fluffy_Pillow Healing Per Second
Count 83514
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 83514
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 83514
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 83514
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 83514
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 83514
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 2802
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 82641325 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.