SimulationCraft 1015-01

for World of Warcraft 10.2.0.52095 PTR (hotfix 2023-11-09/52095, git build e1ec9bc853)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
Adjust bear thrash periodic damage spell level requirement
Thrash spell_level 11.00 18.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-05-16 Base value of Frost aura's effect 191124 is truncated.
Frost Mage (effect#5) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191122 is truncated.
Frost Mage (effect#3) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191121 is truncated.
Frost Mage (effect#2) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 179703 is truncated.
Frost Mage (effect#1) base_value 9.00 9.20
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-01-08 Manually set secondary Malefic Rapture level requirement
Malefic Rapture spell_level 11.00 43.00

Table of Contents

Raid Summary

Created with Highcharts 4.2.3 Damage per Second(Click title for burst)940,742935,656933,913931,117930,339900,448phial_of_corrupting_rage_3phial_of_static_empowerment_3phial_of_charged_isolation_3phial_of_tepid_versatility_3phial_of_elemental_chaos_3Basephial_of_corrupting_rage_3 Damage per Second: 940,742.0
Created with Highcharts 4.2.3 Priority Target/Boss Damage 171,685170,669170,291169,766169,696164,192phial_of_corrupting_rage_3phial_of_static_empowerment_3phial_of_charged_isolation_3phial_of_tepid_versatility_3phial_of_elemental_chaos_3Base
Created with Highcharts 4.2.3 Damage Taken per Second(Click title for burst)4,9262,1892,1792,1692,1672,163phial_of_corrupting_rage_3phial_of_tepid_versatility_3phial_of_elemental_chaos_3phial_of_static_empowerment_3phial_of_charged_isolation_3Base

Additional Raid Information

Base : 900448 dps, 164192 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
900448.3 900448.3 448.0 / 0.050% 84261.0 / 9.4% 65335.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.8 13.9 Astral Power 0.00% 56.4 100.0% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Base 900448
Astral Smolder 128553 14.3% 351.2 0.91s 109432 0 Periodic 710.0 54127 0 54127 0.0% 79.0%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 351.17 0.00 709.99 709.99 258.94 0.0000 2.0000 38429440.18 38429440.18 0.00% 27063.50 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 709.99 520 904 54126.64 4695 268420 54203.14 47074 63875 38429440 38429440 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Fury of Elune 27430 3.0% 5.1 65.18s 1601504 1656865 Direct 763.6 6918 14737 10737 48.8%

Stats Details: Fury Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.12 763.61 0.00 0.00 0.00 0.9667 0.0000 8198166.36 8198166.36 0.00% 1656864.66 1656864.66
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 51.16% 390.68 222 550 6917.75 3321 22203 6925.40 6057 7981 2702419 2702419 0.00%
crit 48.84% 372.93 243 552 14737.47 6774 45295 14750.17 13250 16964 5495748 5495748 0.00%

Action Details: Fury Of Elune

  • id:202770
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:astral_power
  • energize_amount:3.0

Spelldata

  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r

Action Details: Fury Of Elune Tick

  • id:211545
  • school:astral
  • range:105.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.149000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:211545
  • name:Fury of Elune
  • school:astral
  • tooltip:
  • description:{$@spelldesc202770=Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r}

Action Priority List

    aoe
    [P]:5.12
  • if_expr:target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Hungering Shadowflame 3690 0.4% 17.1 17.01s 64853 0 Direct 17.1 52131 106016 64870 23.6%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.05 17.05 0.00 0.00 0.00 0.0000 0.0000 1105846.98 1105846.98 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.35% 13.02 2 30 52130.93 34936 202233 51972.06 34936 147321 678707 678707 0.00%
crit 23.65% 4.03 0 13 106016.21 71270 412555 103646.33 0 407878 427140 427140 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:31299.68
  • base_dd_max:31299.68
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 6863 0.8% 34.3 8.65s 59900 0 Direct 34.2 48097 98026 60056 24.0%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.28 34.20 0.00 0.00 0.00 0.0000 0.0000 2053662.04 2053662.04 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.05% 26.00 10 48 48097.35 47503 54996 48097.32 47503 50019 1250755 1250755 0.00%
crit 23.95% 8.19 0 26 98026.17 96907 112191 98013.66 0 112191 802907 802907 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42559.30
  • base_dd_max:42559.30
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 74812 8.3% 3.0 1.08s 7462887 8103026 Direct 6.0 7015 14295 10203 43.8%
Periodic 1820.8 8787 18140 12263 37.2% 99.2%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.00 6.00 1820.79 1820.79 0.00 0.9210 0.9789 22388660.55 22388660.55 0.00% 12541.83 8103025.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.22% 3.37 0 6 7015.02 6922 8153 6967.99 0 8153 23665 23665 0.00%
crit 43.78% 2.63 0 6 14295.00 14121 16633 13889.13 0 16633 37547 37547 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 62.84% 1144.14 853 1443 8787.22 6693 14505 8787.20 8540 9067 10053634 10053634 0.00%
crit 37.16% 676.65 498 884 18139.52 13655 29591 18142.68 17519 18774 12273815 12273815 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    aoe
    [J]:3.00
  • if_expr:!fight_style.dungeonroute
  • target_if_expr:refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (79475) 0.0% (8.8%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 19647 2.2% 235.9 1.47s 24913 0 Direct 235.3 16236 34862 24978 46.9%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 235.95 235.34 0.00 0.00 0.00 0.0000 0.0000 5878202.58 5878202.58 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.07% 124.89 80 188 16236.33 11191 30548 16243.49 15098 17667 2027739 2027739 0.00%
crit 46.93% 110.45 68 159 34862.47 22829 62318 34892.08 32360 37755 3850463 3850463 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 19715 2.2% 237.5 1.47s 24835 0 Direct 236.9 16189 34739 24899 47.0%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 237.49 236.88 0.00 0.00 0.00 0.0000 0.0000 5898100.86 5898100.86 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.05% 125.66 75 179 16189.18 10069 30548 16195.86 15129 17505 2034261 2034261 0.00%
crit 46.95% 111.23 65 158 34738.89 20540 62318 34765.12 32023 38170 3863840 3863840 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 40112 4.5% 15.8 19.20s 760802 0 Direct 94.4 82550 178071 127146 46.7%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.77 94.38 0.00 0.00 0.00 0.0000 0.0000 11999628.65 11999628.65 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.31% 50.31 23 83 82549.90 41506 308463 82620.06 65729 102685 4153476 4153476 0.00%
crit 46.69% 44.06 23 72 178071.14 84672 619196 178212.93 133692 231807 7846153 7846153 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:enemy4
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfall 303309 33.7% 104.7 2.84s 865984 856074 Direct 1766.8 34902 75367 51326 40.6%

Stats Details: Starfall

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 104.71 1766.77 0.00 0.00 0.00 1.0116 0.0000 90680541.81 90680541.81 0.00% 856074.45 856074.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.41% 1049.65 769 1335 34901.86 7656 129878 34979.10 32043 38667 36633873 36633873 0.00%
crit 40.59% 717.12 522 936 75367.05 15618 264950 75510.51 69047 83153 54046669 54046669 0.00%

Action Details: Starfall

  • id:191034
  • school:astral
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:45.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]

Action Details: Starfall Damage

  • id:191037
  • school:astral
  • range:200.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy5
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.114000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.41

Spelldata

  • id:191037
  • name:Starfall
  • school:astral
  • tooltip:
  • description:{$@spelldesc191034=Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]}

Action Priority List

    aoe
    [L]:70.55
  • if_expr:variable.starfall_condition1
    aoe
    [Q]:34.16
  • if_expr:variable.starfall_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountLunar Shrapnel4151691PCT0.200
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 202753 22.5% 117.8 2.51s 514783 369104 Direct 712.7 54725 118013 85075 48.0%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.79 712.72 0.00 0.00 0.00 1.3947 0.0000 60634605.67 60634605.67 0.00% 369104.28 369104.28
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.04% 370.93 271 479 54725.18 7504 243254 54751.28 48688 61204 20298905 20298905 0.00%
crit 47.96% 341.79 244 452 118012.71 15308 498014 118070.50 106514 136178 40335701 40335701 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    aoe
    [M]:1.27
  • if_expr:buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
    aoe
    [R]:117.04
  • if_expr:spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Solar)4851710.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Sunfire16481550.283Mastery
Sunfire 62637 7.0% 1.0 0.00s 18731413 20184712 Direct 1.0 5507 11231 6782 22.3%
Periodic 1833.7 7400 15834 10212 33.3% 99.8%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 1833.67 1833.67 0.00 0.9285 0.9785 18731412.57 18731412.57 0.00% 10433.78 20184711.82
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.70% 0.78 0 1 5506.56 5472 5544 4278.53 0 5544 4279 4279 0.00%
crit 22.30% 0.22 0 1 11231.14 11163 11309 2504.66 0 11309 2505 2505 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 66.66% 1222.27 918 1527 7399.57 5532 12844 7403.29 7159 7672 9044114 9044114 0.00%
crit 33.34% 611.40 455 800 15833.57 11285 26202 15843.42 15230 16538 9680515 9680515 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    aoe
    [I]:1.00
  • target_if_expr:refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (6786) 0.0% (0.8%) 8.4 31.41s 241397 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.42 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 3547 0.4% 8.4 31.41s 126169 0 Direct 50.5 16859 34361 21027 23.8%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.42 50.50 0.00 0.00 0.00 0.0000 0.0000 1061944.43 1061944.43 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.18% 38.47 7 100 16859.02 16647 19272 16858.88 16647 18717 648585 648585 0.00%
crit 23.82% 12.03 0 38 34361.06 33959 39316 34363.81 0 38423 413359 413359 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:51134.41
  • base_dd_max:51134.41
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 3239 0.4% 16.2 15.32s 59986 0 Direct 97.0 8021 16348 9998 23.7%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.17 97.01 0.00 0.00 0.00 0.0000 0.0000 969860.70 969860.70 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.26% 73.98 14 196 8021.30 7921 9170 8021.06 7921 8686 593423 593423 0.00%
crit 23.74% 23.03 3 59 16348.12 16159 18707 16351.03 16159 17888 376438 376438 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24330.91
  • base_dd_max:24330.91
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 4142 0.5% 26.4 10.32s 47158 61247 Direct 26.3 34495 70629 47421 35.8%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.44 26.30 0.00 0.00 0.00 0.7700 0.0000 1246931.91 1246931.91 0.00% 61247.21 61247.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 64.23% 16.89 6 29 34494.88 15177 66264 34423.66 24540 43979 582645 582645 0.00%
crit 35.77% 9.41 1 20 70629.17 30962 135178 70471.50 30962 100241 664287 664287 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    aoe
    [O]:24.53
  • if_expr:!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.800Spell Data
Eclipse (Solar)4851710.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Lunar)4851810.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
Base
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Base
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Base
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 180.88s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    aoe
    [N]:2.00
  • if_expr:variable.cd_condition_aoe

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.40s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.73 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Base
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.73
Elemental Potion of Ultimate Power 1.4 306.88s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.44 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.44
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 17.4 6.0 17.7s 13.4s 9.6s 55.83% 57.84% 6.0 (20.6) 16.8

Buff Details

  • buff initial source:Base
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.2s
  • trigger_min/max:0.0s / 38.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.8s
  • uptime_min/max:51.63% / 59.71%

Stack Uptimes

  • balance_of_all_things_arcane_1:5.73%
  • balance_of_all_things_arcane_2:6.11%
  • balance_of_all_things_arcane_3:6.61%
  • balance_of_all_things_arcane_4:7.04%
  • balance_of_all_things_arcane_5:7.33%
  • balance_of_all_things_arcane_6:7.56%
  • balance_of_all_things_arcane_7:7.68%
  • balance_of_all_things_arcane_8:7.76%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 10.2 0.0 29.8s 29.7s 7.9s 27.19% 30.44% 0.0 (0.1) 10.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 46.6s
  • trigger_min/max:3.7s / 46.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:24.63% / 30.00%

Stack Uptimes

  • balance_of_all_things_nature_1:3.36%
  • balance_of_all_things_nature_2:3.37%
  • balance_of_all_things_nature_3:3.39%
  • balance_of_all_things_nature_4:3.40%
  • balance_of_all_things_nature_5:3.41%
  • balance_of_all_things_nature_6:3.41%
  • balance_of_all_things_nature_7:3.42%
  • balance_of_all_things_nature_8:3.43%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 15.1 86.4 20.2s 2.9s 17.5s 88.21% 0.00% 35.5 (35.5) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 59.3s
  • trigger_min/max:0.8s / 13.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:83.09% / 92.63%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:13.33%
  • balance_t31_4pc_buff_lunar_2:13.62%
  • balance_t31_4pc_buff_lunar_3:13.99%
  • balance_t31_4pc_buff_lunar_4:11.78%
  • balance_t31_4pc_buff_lunar_5:35.49%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 8.2 57.1 38.0s 4.4s 18.9s 52.01% 0.00% 26.5 (26.5) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.1s / 84.9s
  • trigger_min/max:0.8s / 39.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.37% / 59.38%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:7.41%
  • balance_t31_4pc_buff_solar_2:6.47%
  • balance_t31_4pc_buff_solar_3:6.30%
  • balance_t31_4pc_buff_solar_4:6.45%
  • balance_t31_4pc_buff_solar_5:25.38%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 69.8s 69.8s 10.8s 10.08% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 342.6s
  • trigger_min/max:12.0s / 342.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 33.90%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.90%
  • best_friends_with_aerwynn_2:0.90%
  • best_friends_with_aerwynn_3:0.91%
  • best_friends_with_aerwynn_4:0.91%
  • best_friends_with_aerwynn_5:0.91%
  • best_friends_with_aerwynn_6:0.92%
  • best_friends_with_aerwynn_7:0.92%
  • best_friends_with_aerwynn_8:0.92%
  • best_friends_with_aerwynn_9:0.93%
  • best_friends_with_aerwynn_10:0.93%
  • best_friends_with_aerwynn_11:0.93%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 112.9s 69.8s 44.9s 32.94% 0.00% 68.8 (68.8) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:13.0s / 348.9s
  • trigger_min/max:12.0s / 342.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 324.4s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:32.94%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 69.2s 69.2s 10.8s 10.26% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 333.3s
  • trigger_min/max:12.0s / 333.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 35.10%

Stack Uptimes

  • best_friends_with_pip_1:0.92%
  • best_friends_with_pip_2:0.92%
  • best_friends_with_pip_3:0.92%
  • best_friends_with_pip_4:0.93%
  • best_friends_with_pip_5:0.93%
  • best_friends_with_pip_6:0.93%
  • best_friends_with_pip_7:0.94%
  • best_friends_with_pip_8:0.94%
  • best_friends_with_pip_9:0.94%
  • best_friends_with_pip_10:0.95%
  • best_friends_with_pip_11:0.95%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 1.0 112.1s 69.2s 45.1s 33.59% 0.00% 70.0 (70.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 353.7s
  • trigger_min/max:12.0s / 333.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 338.9s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.59%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 69.6s 69.6s 10.8s 10.12% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 343.0s
  • trigger_min/max:12.0s / 343.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 37.58%

Stack Uptimes

  • best_friends_with_urctos_1:0.90%
  • best_friends_with_urctos_2:0.91%
  • best_friends_with_urctos_3:0.91%
  • best_friends_with_urctos_4:0.91%
  • best_friends_with_urctos_5:0.92%
  • best_friends_with_urctos_6:0.92%
  • best_friends_with_urctos_7:0.92%
  • best_friends_with_urctos_8:0.93%
  • best_friends_with_urctos_9:0.93%
  • best_friends_with_urctos_10:0.93%
  • best_friends_with_urctos_11:0.94%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 112.9s 69.6s 45.5s 33.47% 0.00% 69.5 (69.5) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 350.8s
  • trigger_min/max:12.0s / 343.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 297.3s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.47%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.54% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.54%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Dreamstate 15.3 0.0 20.3s 21.3s 2.1s 10.84% 20.61% 0.0 (0.1) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.6s / 55.1s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.3s
  • uptime_min/max:7.17% / 15.30%

Stack Uptimes

  • dreamstate_1:7.37%
  • dreamstate_2:3.47%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 13.2 8.1 23.6s 14.8s 21.0s 93.09% 93.80% 8.1 (8.1) 12.4

Buff Details

  • buff initial source:Base
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.6s / 71.7s
  • trigger_min/max:0.0s / 57.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.0s
  • uptime_min/max:90.11% / 96.27%

Stack Uptimes

  • eclipse_lunar_1:93.09%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 8.2 0.0 38.1s 38.1s 19.2s 52.76% 54.68% 0.0 (0.0) 7.9

Buff Details

  • buff initial source:Base
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 85.9s
  • trigger_min/max:12.0s / 85.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:47.01% / 59.75%

Stack Uptimes

  • eclipse_solar_1:52.76%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 305.9s 305.9s 27.4s 12.98% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 325.9s
  • trigger_min/max:300.0s / 325.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.76% / 17.84%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.98%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Fury of Elune 5.1 0.0 65.1s 65.1s 7.9s 13.50% 0.00% 75.7 (75.7) 4.9

Buff Details

  • buff initial source:Base
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:60.0s / 87.8s
  • trigger_min/max:60.0s / 87.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:10.85% / 15.69%

Stack Uptimes

  • fury_of_elune_1:13.50%

Spelldata

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 8.2 0.0 38.1s 38.1s 19.2s 52.76% 55.40% 0.0 (0.0) 7.9

Buff Details

  • buff initial source:Base
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 85.9s
  • trigger_min/max:12.0s / 85.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:47.01% / 59.75%

Stack Uptimes

  • incarnation_chosen_of_elune_1:52.76%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.7 0.0 90.9s 90.9s 19.6s 23.98% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:Base
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:65.76

Trigger Details

  • interval_min/max:90.0s / 123.4s
  • trigger_min/max:90.0s / 123.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:19.97% / 26.99%

Stack Uptimes

  • kindled_soul_5:1.17%
  • kindled_soul_10:1.18%
  • kindled_soul_15:1.18%
  • kindled_soul_20:1.18%
  • kindled_soul_25:1.18%
  • kindled_soul_30:1.19%
  • kindled_soul_35:1.19%
  • kindled_soul_40:1.19%
  • kindled_soul_45:1.19%
  • kindled_soul_50:1.20%
  • kindled_soul_55:1.20%
  • kindled_soul_60:1.20%
  • kindled_soul_65:1.21%
  • kindled_soul_70:1.21%
  • kindled_soul_75:1.21%
  • kindled_soul_80:1.22%
  • kindled_soul_85:1.22%
  • kindled_soul_90:1.22%
  • kindled_soul_95:1.22%
  • kindled_soul_100:1.23%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Vigil 3.7 0.0 90.4s 90.4s 14.8s 18.38% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:Base
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.5s
  • trigger_min/max:90.0s / 91.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.49% / 21.04%

Stack Uptimes

  • natures_vigil_1:18.38%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.0 68.7s 68.0s 0.9s 0.75% 1.17% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 346.3s
  • trigger_min/max:0.0s / 346.3s
  • trigger_pct:14.97%
  • duration_min/max:0.0s / 5.9s
  • uptime_min/max:0.00% / 4.57%

Stack Uptimes

  • owlkin_frenzy_1:0.75%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 9.2 96.5 34.0s 34.0s 29.8s 91.37% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:21.0s / 46.1s
  • trigger_min/max:21.0s / 46.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.0s
  • uptime_min/max:87.49% / 95.34%

Stack Uptimes

  • primordial_arcanic_pulsar_5:7.26%
  • primordial_arcanic_pulsar_10:6.73%
  • primordial_arcanic_pulsar_15:7.53%
  • primordial_arcanic_pulsar_20:8.31%
  • primordial_arcanic_pulsar_25:8.67%
  • primordial_arcanic_pulsar_30:8.41%
  • primordial_arcanic_pulsar_35:8.65%
  • primordial_arcanic_pulsar_40:9.03%
  • primordial_arcanic_pulsar_45:9.06%
  • primordial_arcanic_pulsar_50:8.82%
  • primordial_arcanic_pulsar_55:8.90%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 19.7 3.7 15.6s 13.4s 6.7s 43.98% 43.18% 3.7 (3.7) 19.2

Buff Details

  • buff initial source:Base
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 42.8s
  • trigger_min/max:0.0s / 38.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:39.78% / 47.05%

Stack Uptimes

  • solstice_1:43.98%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starfall 104.7 0.0 143.1s 2.8s 295.7s 98.88% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_starfall
  • max_stacks:20
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:asynchronous
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.8s / 357.8s
  • trigger_min/max:0.7s / 8.7s
  • trigger_pct:99.99%
  • duration_min/max:0.6s / 358.1s
  • uptime_min/max:98.44% / 99.49%

Stack Uptimes

  • starfall_1:5.27%
  • starfall_2:32.42%
  • starfall_3:42.30%
  • starfall_4:15.17%
  • starfall_5:3.35%
  • starfall_6:0.36%
  • starfall_7:0.00%

Spelldata

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]
  • max_stacks:20
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Starlord 21.0 83.8 14.5s 2.8s 13.9s 97.47% 0.00% 42.5 (42.5) 6.1

Buff Details

  • buff initial source:Base
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 19.2s
  • trigger_min/max:0.8s / 8.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:94.74% / 99.21%

Stack Uptimes

  • starlord_1:12.57%
  • starlord_2:17.68%
  • starlord_3:67.22%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Umbral Embrace 23.0 2.6 12.7s 11.4s 1.6s 12.41% 0.00% 2.6 (2.6) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_umbral_embrace
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 53.5s
  • trigger_min/max:0.0s / 52.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.2s
  • uptime_min/max:2.89% / 23.30%

Stack Uptimes

  • umbral_embrace_1:12.41%

Spelldata

  • id:393763
  • name:Umbral Embrace
  • tooltip:Your next Wrath or Starfire cast during an Eclipse deals Astral damage and deals {$=}w1% additional damage.
  • description:{$@spelldesc393760=Dealing Astral damage has a chance to cause your next Wrath or Starfire cast during an Eclipse to become Astral and deal {$s1=25}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Wafting Devotion 4.3 1.2 61.1s 45.6s 16.5s 23.59% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 237.3s
  • trigger_min/max:0.0s / 218.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 83.1s
  • uptime_min/max:5.09% / 58.18%

Stack Uptimes

  • wafting_devotion_1:23.59%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:Base
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:Base
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:Base
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:Base
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:Base
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:Base
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Primordial Arcanic Pulsar 8.3 6.0 10.0 35.2s 23.8s 46.6s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.05% 0.00% 0.60% 0.0s 0.0s 1.0s
Astral Smolder 72.07% 62.51% 81.17% 3.9s 0.0s 43.0s
Incarnation (Total) 52.76% 47.01% 59.75% 19.2s 0.0s 54.0s
Incarnation (Pulsar) 32.45% 28.83% 35.00% 11.8s 0.0s 12.0s
Lunar Eclipse Only 40.33% 32.59% 46.40% 9.2s 0.0s 15.0s
No Eclipse 6.87% 3.73% 9.89% 1.7s 0.0s 4.5s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Fury of Elune5.2230.00027.81326.7305.63672.355

Eclipse Utilization

NoneSolarLunarBoth
Wrath24.44100.0%0.000.0%0.000.0%0.000.0%
Starfire2.452.1%0.000.0%49.7941.9%66.5556.0%
Starfall20.867.1%0.000.0%117.7639.8%157.1353.1%
Fury of Elune16.232.1%0.000.0%142.3918.6%604.9979.2%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Base
Fury of EluneAstral Power80.65241.575.79%3.000.370.15%
MoonfireAstral Power3.0018.000.43%6.000.000.00%
Orbit BreakerAstral Power15.77471.0711.28%29.872.100.44%
Shooting Stars (Moonfire)Astral Power235.94471.5911.30%2.000.290.06%
Shooting Stars (Sunfire)Astral Power237.49474.6911.37%2.000.300.06%
StarfireAstral Power118.792227.7453.36%18.7535.311.56%
SunfireAstral Power1.006.000.14%6.000.000.00%
WrathAstral Power26.44264.416.33%10.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
Base
StarfallAstral Power 105.094136.11100.00%39.3639.5021924.12
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 896660.0 1880.75 2160.69 4119885.5 812797.5 374271.4 896660.0
Astral Power 20.0 13.94 13.76 38.4 53.6 0.0 100.0

Statistics & Data Analysis

Fight Length
Base Fight Length
Count 9022
Mean 299.58
Minimum 240.01
Maximum 359.95
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 34.9332
5th Percentile 245.99
95th Percentile 353.92
( 95th Percentile - 5th Percentile ) 107.94
Mean Distribution
Standard Deviation 0.3678
95.00% Confidence Interval ( 298.85 - 300.30 )
Normalized 95.00% Confidence Interval ( 99.76% - 100.24% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 523
0.1% Error 52235
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1042
DPS
Base Damage Per Second
Count 9022
Mean 900448.26
Minimum 837113.36
Maximum 995125.18
Spread ( max - min ) 158011.82
Range [ ( max - min ) / 2 * 100% ] 8.77%
Standard Deviation 21712.1716
5th Percentile 866866.91
95th Percentile 937873.31
( 95th Percentile - 5th Percentile ) 71006.40
Mean Distribution
Standard Deviation 228.5872
95.00% Confidence Interval ( 900000.24 - 900896.28 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2234
0.1 Scale Factor Error with Delta=300 4024299
0.05 Scale Factor Error with Delta=300 16097195
0.01 Scale Factor Error with Delta=300 402429856
Priority Target DPS
Base Priority Target Damage Per Second
Count 9022
Mean 164191.61
Minimum 148536.46
Maximum 186636.47
Spread ( max - min ) 38100.01
Range [ ( max - min ) / 2 * 100% ] 11.60%
Standard Deviation 5215.6814
5th Percentile 155985.61
95th Percentile 173068.16
( 95th Percentile - 5th Percentile ) 17082.55
Mean Distribution
Standard Deviation 54.9110
95.00% Confidence Interval ( 164083.99 - 164299.24 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3877
0.1 Scale Factor Error with Delta=300 232224
0.05 Scale Factor Error with Delta=300 928894
0.01 Scale Factor Error with Delta=300 23222329
DPS(e)
Base Damage Per Second (Effective)
Count 9022
Mean 900448.26
Minimum 837113.36
Maximum 995125.18
Spread ( max - min ) 158011.82
Range [ ( max - min ) / 2 * 100% ] 8.77%
Damage
Base Damage
Count 9022
Mean 269277005.28
Minimum 209098049.77
Maximum 329851724.89
Spread ( max - min ) 120753675.12
Range [ ( max - min ) / 2 * 100% ] 22.42%
DTPS
Base Damage Taken Per Second
Count 9022
Mean 2162.79
Minimum 733.78
Maximum 4324.90
Spread ( max - min ) 3591.12
Range [ ( max - min ) / 2 * 100% ] 83.02%
HPS
Base Healing Per Second
Count 9022
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Base Healing Per Second (Effective)
Count 9022
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Base Heal
Count 9022
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Base Healing Taken Per Second
Count 9022
Mean 1878.58
Minimum 590.49
Maximum 4178.22
Spread ( max - min ) 3587.73
Range [ ( max - min ) / 2 * 100% ] 95.49%
TMI
Base Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
BaseTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Base Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.44 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.68 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.73 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.aoe
# count action,conditions
0.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
0.00 variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
I 1.00 sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
J 3.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
0.00 variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
K 13.93 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
L 70.55 starfall,if=variable.starfall_condition1
M 1.27 starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
0.00 celestial_alignment,if=variable.cd_condition_aoe
N 2.00 incarnation,if=variable.cd_condition_aoe
0.00 warrior_of_elune
0.00 variable,name=enter_solar,value=spell_targets.starfire<3
0.00 starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
O 24.53 wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
0.00 wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
P 5.12 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
Q 34.16 starfall,if=variable.starfall_condition2
0.00 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+50
0.00 convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 new_moon,if=astral_power.deficit>variable.passive_asp+10
0.00 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
R 117.04 starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
0.00 wrath
S 0.00 run_action_list,name=fallthru

Sample Sequence

12456789ACFIJLJJMLNDEPQRRLRLLRLRKLQRQRRRRLRLRLLRKLQRQRRRLRRLRLRKLLQROORLRRLRKLQRLOOLRRLRLRQRRQOORQRRLRLPQFRQRLRELRLOOKLRQRQRRRLROOLLRQRRRLRLRKLOOLQRRRLRRKLRQOOQRRLRLRQPRQRQRLRRLOKLOQRQRFRRLRNERRLQQRRLRRLRLRKLQRQRRRRLRRKLLRPLRLRLRLRRKLQRQRRRLOOLRKLQRRQRRRLOORLQRRLRRFLRLRKLEQOORPLRLRLRKLRQOORQRLRLRRDLQRQRROOLRRLKLR

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 1 food Base 0.0/100: 0% astral_power
Pre precombat 2 augmentation Base 0.0/100: 0% astral_power
Pre precombat 4 no_cd_talent Base 0.0/100: 0% astral_power
Pre precombat 5 on_use_trinket Base 0.0/100: 0% astral_power
Pre precombat 6 on_use_trinket Base 0.0/100: 0% astral_power
Pre precombat 7 on_use_trinket Base 0.0/100: 0% astral_power
Pre precombat 8 moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power
Pre precombat 9 wrath Fluffy_Pillow 0.0/100: 0% astral_power
Pre precombat A wrath Fluffy_Pillow 10.0/100: 10% astral_power
Pre precombat C starfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice
0:00.000 default F natures_vigil Base 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate
0:00.000 aoe I sunfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate
0:00.929 aoe J moonfire Fluffy_Pillow 47.2/100: 47% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, wafting_devotion
0:01.788 aoe L starfall Fluffy_Pillow 55.2/100: 55% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, dreamstate, wafting_devotion
0:02.649 aoe J moonfire enemy2 12.2/100: 12% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, dreamstate, wafting_devotion
0:03.477 aoe J moonfire enemy4 52.2/100: 52% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, dreamstate, wafting_devotion
0:04.305 aoe M starfire Fluffy_Pillow 64.2/100: 64% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, wafting_devotion
0:05.060 aoe L starfall Fluffy_Pillow 91.4/100: 91% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, wafting_devotion
0:05.890 aoe N incarnation_chosen_of_elune Fluffy_Pillow 52.4/100: 52% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), wafting_devotion
0:05.890 default D potion Fluffy_Pillow 52.4/100: 52% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), wafting_devotion
0:05.890 default E use_items Fluffy_Pillow 52.4/100: 52% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), wafting_devotion, elemental_potion_of_ultimate_power
0:05.890 aoe P fury_of_elune Fluffy_Pillow 52.4/100: 52% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(100)
0:06.644 aoe Q starfall Fluffy_Pillow 61.4/100: 61% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(100)
0:07.398 aoe R starfire Fluffy_Pillow 36.4/100: 36% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(95)
0:08.153 aoe R starfire Fluffy_Pillow 62.6/100: 63% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(90)
0:08.907 aoe L starfall Fluffy_Pillow 93.8/100: 94% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(85)
0:09.663 aoe R starfire Fluffy_Pillow 67.8/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(85)
0:10.712 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(80)
0:11.465 aoe L starfall Fluffy_Pillow 75.0/100: 75% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(75)
0:12.220 aoe R starfire Fluffy_Pillow 77.0/100: 77% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(5), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(70)
0:13.268 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(65)
0:14.022 aoe R starfire Fluffy_Pillow 73.0/100: 73% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(60)
0:15.074 aoe K cancel_buff Fluffy_Pillow 94.2/100: 94% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(55)
0:15.074 aoe L starfall Fluffy_Pillow 94.2/100: 94% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(55)
0:15.858 aoe Q starfall Fluffy_Pillow 59.2/100: 59% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(5), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(55)
0:16.612 aoe R starfire Fluffy_Pillow 26.2/100: 26% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(6), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(50)
0:17.783 aoe Q starfall Fluffy_Pillow 47.4/100: 47% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(5), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(45)
0:18.564 aoe R starfire Fluffy_Pillow 14.4/100: 14% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(6), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(40)
0:19.692 aoe R starfire Fluffy_Pillow 33.6/100: 34% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(35)
0:20.819 aoe R starfire Fluffy_Pillow 56.8/100: 57% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(30)
0:21.949 aoe R starfire Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(20)
0:23.080 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(15)
0:23.835 aoe R starfire Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(15)
0:24.965 aoe L starfall Fluffy_Pillow 90.2/100: 90% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(5)
0:25.719 aoe R starfire Fluffy_Pillow 61.2/100: 61% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power, kindled_soul(5)
0:26.848 aoe L starfall Fluffy_Pillow 90.4/100: 90% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:27.601 aoe L starfall Fluffy_Pillow 61.4/100: 61% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:28.355 aoe R starfire Fluffy_Pillow 32.4/100: 32% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:29.485 aoe K cancel_buff Fluffy_Pillow 87.6/100: 88% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:29.485 aoe L starfall Fluffy_Pillow 87.6/100: 88% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:30.329 aoe Q starfall Fluffy_Pillow 56.6/100: 57% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), solstice, starfall(5), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:31.142 aoe R starfire Fluffy_Pillow 27.6/100: 28% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(5), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:32.312 aoe Q starfall Fluffy_Pillow 54.8/100: 55% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(5), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), elemental_potion_of_ultimate_power
0:33.095 aoe R starfire Fluffy_Pillow 23.8/100: 24% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, elemental_potion_of_ultimate_power
0:34.143 aoe R starfire Fluffy_Pillow 45.0/100: 45% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, elemental_potion_of_ultimate_power
0:35.190 aoe R starfire Fluffy_Pillow 66.2/100: 66% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion, elemental_potion_of_ultimate_power
0:36.239 aoe L starfall Fluffy_Pillow 87.4/100: 87% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion
0:36.995 aoe R starfire Fluffy_Pillow 56.4/100: 56% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion
0:38.043 aoe R starfire Fluffy_Pillow 77.6/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion
0:39.091 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion
0:39.846 aoe R starfire Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion
0:40.894 aoe L starfall Fluffy_Pillow 90.2/100: 90% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion
0:41.804 aoe R starfire Fluffy_Pillow 57.2/100: 57% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion
0:43.165 aoe K cancel_buff Fluffy_Pillow 82.4/100: 82% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion
0:43.165 aoe L starfall Fluffy_Pillow 82.4/100: 82% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion
0:44.184 aoe L starfall Fluffy_Pillow 49.4/100: 49% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion
0:45.161 aoe Q starfall Fluffy_Pillow 48.4/100: 48% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion
0:46.103 aoe R starfire Fluffy_Pillow 15.4/100: 15% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion
0:47.465 aoe O wrath Fluffy_Pillow 36.6/100: 37% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), wafting_devotion
0:48.375 aoe O wrath Fluffy_Pillow 50.6/100: 51% astral_power primordial_arcanic_pulsar(55), starfall(4), starlord(3), dreamstate
0:49.128 aoe R starfire Fluffy_Pillow 62.6/100: 63% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3)
0:50.098 aoe L starfall Fluffy_Pillow 85.8/100: 86% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3)
0:51.177 aoe R starfire Fluffy_Pillow 44.8/100: 45% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar
0:52.645 aoe R starfire Fluffy_Pillow 68.0/100: 68% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar
0:54.112 aoe L starfall Fluffy_Pillow 97.2/100: 97% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar
0:55.090 aoe R starfire Fluffy_Pillow 66.2/100: 66% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(11), best_friends_with_urctos_static
0:56.558 aoe K cancel_buff Fluffy_Pillow 91.4/100: 91% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(9), best_friends_with_urctos_static
0:56.558 aoe L starfall Fluffy_Pillow 91.4/100: 91% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(9), best_friends_with_urctos_static
0:57.655 aoe Q starfall Fluffy_Pillow 60.4/100: 60% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(8), best_friends_with_urctos_static
0:58.709 aoe R starfire Fluffy_Pillow 29.4/100: 29% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(7), best_friends_with_urctos_static
1:00.229 aoe L starfall Fluffy_Pillow 52.6/100: 53% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(6), best_friends_with_urctos_static
1:01.245 aoe O wrath Fluffy_Pillow 19.6/100: 20% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(5), best_friends_with_urctos_static
1:02.226 aoe O wrath Fluffy_Pillow 63.6/100: 64% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(3), dreamstate, best_friends_with_urctos(4), best_friends_with_urctos_static
1:02.982 aoe L starfall Fluffy_Pillow 73.6/100: 74% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), dreamstate, best_friends_with_urctos(3), best_friends_with_urctos_static
1:04.060 aoe R starfire Fluffy_Pillow 36.6/100: 37% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_urctos(2), best_friends_with_urctos_static
1:05.029 aoe R starfire Fluffy_Pillow 61.8/100: 62% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos, best_friends_with_urctos_static
1:06.644 aoe L starfall Fluffy_Pillow 89.0/100: 89% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static
1:07.721 aoe R starfire Fluffy_Pillow 48.0/100: 48% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static
1:09.334 aoe L starfall Fluffy_Pillow 73.2/100: 73% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static
1:10.411 aoe R starfire Fluffy_Pillow 30.2/100: 30% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static
1:12.026 aoe Q starfall Fluffy_Pillow 51.4/100: 51% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static
1:13.233 aoe R starfire Fluffy_Pillow 8.4/100: 8% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static
1:14.969 aoe R starfire Fluffy_Pillow 27.6/100: 28% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static
1:16.707 aoe Q starfall Fluffy_Pillow 50.8/100: 51% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, wafting_devotion
1:17.783 aoe O wrath Fluffy_Pillow 5.8/100: 6% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion
1:18.820 aoe O wrath Fluffy_Pillow 15.8/100: 16% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(2), dreamstate, best_friends_with_pip(11), best_friends_with_pip_static, wafting_devotion
1:19.575 aoe R starfire Fluffy_Pillow 27.8/100: 28% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), best_friends_with_pip(10), best_friends_with_pip_static, wafting_devotion
1:20.507 aoe Q starfall Fluffy_Pillow 51.0/100: 51% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(2), best_friends_with_pip(9), best_friends_with_pip_static, wafting_devotion
1:21.544 aoe R starfire Fluffy_Pillow 14.0/100: 14% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip(8), best_friends_with_pip_static, wafting_devotion
1:23.040 aoe R starfire Fluffy_Pillow 67.2/100: 67% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip(6), best_friends_with_pip_static, wafting_devotion
1:24.539 aoe L starfall Fluffy_Pillow 98.4/100: 98% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip(5), best_friends_with_pip_static, wafting_devotion
1:25.538 aoe R starfire Fluffy_Pillow 59.4/100: 59% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(4), best_friends_with_pip_static, wafting_devotion
1:27.035 aoe L starfall Fluffy_Pillow 80.6/100: 81% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(2), best_friends_with_pip_static, wafting_devotion
1:28.153 aoe P fury_of_elune Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip, best_friends_with_pip_static, wafting_devotion
1:29.132 aoe Q starfall Fluffy_Pillow 50.6/100: 51% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion
1:30.111 default F natures_vigil Base 25.6/100: 26% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(11), best_friends_with_urctos_static, wafting_devotion
1:30.111 aoe R starfire Fluffy_Pillow 25.6/100: 26% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(11), best_friends_with_urctos_static, wafting_devotion
1:31.523 aoe Q starfall Fluffy_Pillow 63.8/100: 64% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(10), best_friends_with_urctos_static, wafting_devotion
1:32.467 aoe R starfire Fluffy_Pillow 40.8/100: 41% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, wafting_devotion
1:33.827 aoe L starfall Fluffy_Pillow 71.0/100: 71% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, wafting_devotion
1:34.735 aoe R starfire Fluffy_Pillow 76.0/100: 76% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, wafting_devotion
1:36.097 default E use_items Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(5), best_friends_with_urctos_static
1:36.097 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(5), best_friends_with_urctos_static, kindled_soul(100)
1:37.077 aoe R starfire Fluffy_Pillow 68.0/100: 68% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(4), best_friends_with_urctos_static, kindled_soul(100)
1:38.544 aoe L starfall Fluffy_Pillow 91.2/100: 91% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(3), best_friends_with_urctos_static, kindled_soul(90)
1:39.522 aoe O wrath Fluffy_Pillow 58.2/100: 58% astral_power natures_vigil, primordial_arcanic_pulsar(25), starfall(4), starlord(3), dreamstate, best_friends_with_urctos(2), best_friends_with_urctos_static, kindled_soul(85)
1:40.275 aoe O wrath Fluffy_Pillow 68.2/100: 68% astral_power natures_vigil, primordial_arcanic_pulsar(25), starfall(3), starlord(3), best_friends_with_urctos, best_friends_with_urctos_static, kindled_soul(80)
1:41.029 aoe K cancel_buff Fluffy_Pillow 78.2/100: 78% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), best_friends_with_urctos, best_friends_with_urctos_static, kindled_soul(80)
1:41.029 aoe L starfall Fluffy_Pillow 78.2/100: 78% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), best_friends_with_urctos, best_friends_with_urctos_static, kindled_soul(80)
1:42.235 aoe R starfire Fluffy_Pillow 41.2/100: 41% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, kindled_soul(70)
1:43.971 aoe Q starfall Fluffy_Pillow 66.4/100: 66% astral_power natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, kindled_soul(65)
1:45.130 aoe R starfire Fluffy_Pillow 29.4/100: 29% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, kindled_soul(55)
1:46.804 aoe Q starfall Fluffy_Pillow 54.6/100: 55% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, kindled_soul(50)
1:47.922 aoe R starfire Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, kindled_soul(45)
1:49.537 aoe R starfire Fluffy_Pillow 34.8/100: 35% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, kindled_soul(35)
1:51.152 aoe R starfire Fluffy_Pillow 58.0/100: 58% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, kindled_soul(25)
1:52.765 aoe L starfall Fluffy_Pillow 79.2/100: 79% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, kindled_soul(20)
1:53.841 aoe R starfire Fluffy_Pillow 36.2/100: 36% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, kindled_soul(15)
1:55.455 aoe O wrath Fluffy_Pillow 55.4/100: 55% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall, starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, kindled_soul(5)
1:56.532 aoe O wrath Fluffy_Pillow 67.4/100: 67% astral_power primordial_arcanic_pulsar(45), starfall, dreamstate, best_friends_with_urctos_static
1:57.288 aoe L starfall Fluffy_Pillow 77.4/100: 77% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, dreamstate, best_friends_with_urctos_static
1:58.495 aoe L starfall Fluffy_Pillow 72.4/100: 72% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, umbral_embrace, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_urctos_static
1:59.652 aoe R starfire Fluffy_Pillow 33.4/100: 33% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), umbral_embrace, balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static
2:00.657 aoe Q starfall Fluffy_Pillow 56.6/100: 57% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static
2:01.774 aoe R starfire Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static
2:03.241 aoe R starfire Fluffy_Pillow 40.8/100: 41% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static
2:04.710 aoe R starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static
2:06.178 aoe L starfall Fluffy_Pillow 95.2/100: 95% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static
2:07.158 aoe R starfire Fluffy_Pillow 64.2/100: 64% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static
2:08.626 aoe L starfall Fluffy_Pillow 87.4/100: 87% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static
2:09.604 aoe R starfire Fluffy_Pillow 56.4/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static
2:11.071 aoe K cancel_buff Fluffy_Pillow 77.6/100: 78% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static
2:11.071 aoe L starfall Fluffy_Pillow 77.6/100: 78% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static
2:12.167 aoe O wrath Fluffy_Pillow 42.6/100: 43% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static
2:13.222 aoe O wrath Fluffy_Pillow 54.6/100: 55% astral_power primordial_arcanic_pulsar(15), starfall(3), starlord, dreamstate, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static
2:13.976 aoe L starfall Fluffy_Pillow 66.6/100: 67% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord, umbral_embrace, dreamstate, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static
2:15.137 aoe Q starfall Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(2), umbral_embrace, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_aerwynn(3), best_friends_with_aerwynn_static
2:16.256 aoe R starfire Fluffy_Pillow 14.6/100: 15% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static
2:17.226 aoe R starfire Fluffy_Pillow 39.8/100: 40% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn, best_friends_with_aerwynn_static
2:18.841 aoe R starfire Fluffy_Pillow 65.0/100: 65% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static
2:20.455 aoe L starfall Fluffy_Pillow 88.2/100: 88% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(25), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static
2:21.531 aoe R starfire Fluffy_Pillow 43.2/100: 43% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static
2:23.144 aoe R starfire Fluffy_Pillow 64.4/100: 64% astral_power eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static
2:24.758 aoe K cancel_buff Fluffy_Pillow 87.6/100: 88% astral_power eclipse_lunar, primordial_arcanic_pulsar(30), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static
2:24.758 aoe L starfall Fluffy_Pillow 87.6/100: 88% astral_power eclipse_lunar, primordial_arcanic_pulsar(30), starfall, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static
2:25.965 aoe R starfire Fluffy_Pillow 44.6/100: 45% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static
2:27.702 aoe Q starfall Fluffy_Pillow 67.8/100: 68% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static
2:28.860 aoe O wrath Fluffy_Pillow 24.8/100: 25% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static
2:29.979 aoe O wrath Fluffy_Pillow 38.8/100: 39% astral_power primordial_arcanic_pulsar(40), starfall(2), starlord(2), dreamstate, best_friends_with_aerwynn_static
2:30.733 aoe Q starfall Fluffy_Pillow 48.8/100: 49% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(40), solstice, starfall(2), starlord(2), dreamstate, best_friends_with_aerwynn_static
2:31.850 aoe R starfire Fluffy_Pillow 9.8/100: 10% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static
2:32.820 aoe R starfire Fluffy_Pillow 35.0/100: 35% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static
2:34.435 aoe L starfall Fluffy_Pillow 94.2/100: 94% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static
2:35.512 aoe R starfire Fluffy_Pillow 55.2/100: 55% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static
2:37.127 aoe L starfall Fluffy_Pillow 78.4/100: 78% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(50), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static
2:38.205 aoe R starfire Fluffy_Pillow 35.4/100: 35% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static
2:39.821 aoe Q starfall Fluffy_Pillow 56.6/100: 57% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static
2:41.027 aoe P fury_of_elune Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(4), best_friends_with_pip(10), best_friends_with_pip_static, wafting_devotion
2:42.004 aoe R starfire Fluffy_Pillow 24.6/100: 25% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(3), starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(4), best_friends_with_pip(9), best_friends_with_pip_static, wafting_devotion
2:43.469 aoe Q starfall Fluffy_Pillow 56.8/100: 57% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(4), best_friends_with_pip(8), best_friends_with_pip_static, wafting_devotion
2:44.448 aoe R starfire Fluffy_Pillow 33.8/100: 34% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(7), best_friends_with_pip_static, wafting_devotion
2:45.861 aoe Q starfall Fluffy_Pillow 68.0/100: 68% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), starfall(2), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(6), best_friends_with_pip_static, wafting_devotion
2:46.801 aoe R starfire Fluffy_Pillow 43.0/100: 43% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(5), best_friends_with_pip_static, wafting_devotion
2:48.161 aoe L starfall Fluffy_Pillow 75.2/100: 75% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(3), best_friends_with_pip_static, wafting_devotion
2:49.070 aoe R starfire Fluffy_Pillow 48.2/100: 48% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(2), best_friends_with_pip_static, wafting_devotion
2:50.430 aoe R starfire Fluffy_Pillow 69.4/100: 69% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip, best_friends_with_pip_static, wafting_devotion
2:51.791 aoe L starfall Fluffy_Pillow 88.6/100: 89% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion
2:52.700 aoe O wrath Fluffy_Pillow 55.6/100: 56% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(3), dreamstate, best_friends_with_pip_static, wafting_devotion
2:53.454 aoe K cancel_buff Fluffy_Pillow 67.6/100: 68% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(3), dreamstate, best_friends_with_pip_static, wafting_devotion
2:53.454 aoe L starfall Fluffy_Pillow 67.6/100: 68% astral_power primordial_arcanic_pulsar(20), starfall(3), dreamstate, best_friends_with_pip_static, wafting_devotion
2:54.574 aoe O wrath Fluffy_Pillow 56.6/100: 57% astral_power primordial_arcanic_pulsar(25), starfall(3), starlord, best_friends_with_pip_static, wafting_devotion
2:55.329 aoe Q starfall Fluffy_Pillow 68.6/100: 69% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord, umbral_embrace, best_friends_with_pip_static
2:56.489 aoe R starfire Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(2), umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_pip_static
2:58.161 aoe Q starfall Fluffy_Pillow 52.8/100: 53% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_pip_static
2:59.279 aoe R starfire Fluffy_Pillow 11.8/100: 12% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static
3:00.893 default F natures_vigil Base 39.0/100: 39% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static
3:00.893 aoe R starfire Fluffy_Pillow 39.0/100: 39% astral_power natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static
3:02.508 aoe R starfire Fluffy_Pillow 60.2/100: 60% astral_power natures_vigil, balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static
3:04.124 aoe L starfall Fluffy_Pillow 81.4/100: 81% astral_power natures_vigil, eclipse_lunar, primordial_arcanic_pulsar(35), starfall, starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static
3:05.203 aoe R starfire Fluffy_Pillow 36.4/100: 36% astral_power natures_vigil, eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static
3:06.817 aoe N incarnation_chosen_of_elune Fluffy_Pillow 59.6/100: 60% astral_power natures_vigil, eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static
3:06.817 default E use_items Fluffy_Pillow 59.6/100: 60% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starfall, starlord(3), dreamstate(2), best_friends_with_pip_static
3:06.817 aoe R starfire Fluffy_Pillow 59.6/100: 60% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starfall, starlord(3), dreamstate, best_friends_with_pip_static, kindled_soul(100)
3:07.699 aoe R starfire Fluffy_Pillow 80.8/100: 81% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starfall, starlord(3), best_friends_with_pip_static, kindled_soul(100)
3:08.579 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starfall, best_friends_with_pip_static, kindled_soul(95)
3:09.677 aoe Q starfall Fluffy_Pillow 71.0/100: 71% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, kindled_soul(90)
3:10.730 aoe Q starfall Fluffy_Pillow 40.0/100: 40% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, kindled_soul(85)
3:11.746 aoe R starfire Fluffy_Pillow 45.0/100: 45% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, kindled_soul(80)
3:13.216 aoe R starfire Fluffy_Pillow 68.2/100: 68% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, kindled_soul(70)
3:14.682 aoe L starfall Fluffy_Pillow 87.4/100: 87% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, kindled_soul(65)
3:15.662 aoe R starfire Fluffy_Pillow 56.4/100: 56% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, kindled_soul(60)
3:17.127 aoe R starfire Fluffy_Pillow 81.6/100: 82% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, kindled_soul(50)
3:18.594 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, kindled_soul(45)
3:19.573 aoe R starfire Fluffy_Pillow 69.0/100: 69% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(40)
3:21.039 aoe L starfall Fluffy_Pillow 96.2/100: 96% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(30)
3:22.017 aoe R starfire Fluffy_Pillow 61.2/100: 61% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(25)
3:23.483 aoe K cancel_buff Fluffy_Pillow 84.4/100: 84% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(20)
3:23.483 aoe L starfall Fluffy_Pillow 84.4/100: 84% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(20)
3:24.579 aoe Q starfall Fluffy_Pillow 49.4/100: 49% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(15), starfall(3), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(15)
3:25.633 aoe R starfire Fluffy_Pillow 16.4/100: 16% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(20), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(10)
3:26.649 aoe Q starfall Fluffy_Pillow 35.6/100: 36% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(11), best_friends_with_pip_static, kindled_soul(5)
3:27.664 aoe R starfire Fluffy_Pillow 0.6/100: 1% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(10), best_friends_with_pip_static
3:29.131 aoe R starfire Fluffy_Pillow 23.8/100: 24% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static
3:30.599 aoe R starfire Fluffy_Pillow 45.0/100: 45% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(7), best_friends_with_pip_static
3:32.066 aoe R starfire Fluffy_Pillow 64.2/100: 64% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(6), best_friends_with_pip_static
3:33.532 aoe L starfall Fluffy_Pillow 85.4/100: 85% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(4), best_friends_with_pip_static
3:34.512 aoe R starfire Fluffy_Pillow 52.4/100: 52% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(3), best_friends_with_pip_static
3:35.979 aoe R starfire Fluffy_Pillow 73.6/100: 74% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(2), best_friends_with_pip_static
3:37.447 aoe K cancel_buff Fluffy_Pillow 94.8/100: 95% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip, best_friends_with_pip_static
3:37.447 aoe L starfall Fluffy_Pillow 94.8/100: 95% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip, best_friends_with_pip_static
3:38.543 aoe L starfall Fluffy_Pillow 63.8/100: 64% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static
3:39.596 aoe R starfire Fluffy_Pillow 30.8/100: 31% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static
3:41.118 aoe P fury_of_elune Fluffy_Pillow 82.0/100: 82% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion
3:42.059 aoe L starfall Fluffy_Pillow 85.0/100: 85% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(40), starfall(2), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion
3:43.002 aoe R starfire Fluffy_Pillow 60.0/100: 60% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion
3:44.363 aoe L starfall Fluffy_Pillow 90.2/100: 90% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion
3:45.272 aoe R starfire Fluffy_Pillow 63.2/100: 63% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion
3:46.635 aoe L starfall Fluffy_Pillow 91.4/100: 91% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion
3:47.545 aoe R starfire Fluffy_Pillow 61.4/100: 61% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion
3:48.906 aoe L starfall Fluffy_Pillow 84.4/100: 84% astral_power fury_of_elune, primordial_arcanic_pulsar(55), starfall(3), starlord(3), umbral_embrace, dreamstate(2), best_friends_with_pip_static, wafting_devotion
3:49.906 aoe R starfire Fluffy_Pillow 46.4/100: 46% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_pip_static, wafting_devotion
3:50.723 aoe R starfire Fluffy_Pillow 71.6/100: 72% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, wafting_devotion
3:51.541 aoe K cancel_buff Fluffy_Pillow 94.8/100: 95% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, wafting_devotion
3:51.541 aoe L starfall Fluffy_Pillow 94.8/100: 95% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, wafting_devotion
3:52.558 aoe Q starfall Fluffy_Pillow 63.8/100: 64% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion
3:53.538 aoe R starfire Fluffy_Pillow 32.8/100: 33% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion
3:54.949 aoe Q starfall Fluffy_Pillow 58.0/100: 58% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion
3:55.893 aoe R starfire Fluffy_Pillow 23.0/100: 23% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static
3:57.359 aoe R starfire Fluffy_Pillow 42.2/100: 42% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static
3:58.827 aoe R starfire Fluffy_Pillow 63.4/100: 63% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static
4:00.294 aoe L starfall Fluffy_Pillow 86.6/100: 87% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static
4:01.274 aoe O wrath Fluffy_Pillow 53.6/100: 54% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), dreamstate, best_friends_with_pip_static
4:02.030 aoe O wrath Fluffy_Pillow 65.6/100: 66% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), best_friends_with_pip_static
4:02.787 aoe L starfall Fluffy_Pillow 75.6/100: 76% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), best_friends_with_pip_static
4:03.864 aoe R starfire Fluffy_Pillow 36.6/100: 37% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static
4:05.480 aoe K cancel_buff Fluffy_Pillow 95.8/100: 96% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static
4:05.480 aoe L starfall Fluffy_Pillow 95.8/100: 96% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), balance_t31_4pc_buff_lunar, best_friends_with_pip_static
4:06.685 aoe Q starfall Fluffy_Pillow 54.8/100: 55% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static
4:07.846 aoe R starfire Fluffy_Pillow 15.8/100: 16% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(4), starlord(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(11), best_friends_with_pip_static
4:09.519 aoe R starfire Fluffy_Pillow 39.0/100: 39% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(10), best_friends_with_pip_static
4:11.194 aoe Q starfall Fluffy_Pillow 58.2/100: 58% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(8), best_friends_with_pip_static
4:12.311 aoe R starfire Fluffy_Pillow 15.2/100: 15% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(7), best_friends_with_pip_static
4:13.926 aoe R starfire Fluffy_Pillow 36.4/100: 36% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(5), best_friends_with_pip_static
4:15.541 aoe R starfire Fluffy_Pillow 59.6/100: 60% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(4), best_friends_with_pip_static
4:17.155 aoe L starfall Fluffy_Pillow 82.8/100: 83% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(2), best_friends_with_pip_static
4:18.233 aoe O wrath Fluffy_Pillow 37.8/100: 38% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(3), dreamstate, best_friends_with_pip, best_friends_with_pip_static
4:18.987 aoe O wrath Fluffy_Pillow 47.8/100: 48% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_pip_static
4:19.742 aoe R starfire Fluffy_Pillow 59.8/100: 60% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), best_friends_with_pip_static
4:21.356 aoe L starfall Fluffy_Pillow 87.0/100: 87% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, best_friends_with_pip_static
4:22.563 aoe Q starfall Fluffy_Pillow 46.0/100: 46% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, best_friends_with_pip_static
4:23.723 aoe R starfire Fluffy_Pillow 5.0/100: 5% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static
4:25.396 aoe R starfire Fluffy_Pillow 30.2/100: 30% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static
4:27.068 aoe L starfall Fluffy_Pillow 83.4/100: 83% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static
4:28.183 aoe R starfire Fluffy_Pillow 42.4/100: 42% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static
4:29.650 aoe R starfire Fluffy_Pillow 67.6/100: 68% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static
4:31.115 default F natures_vigil Base 92.8/100: 93% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static
4:31.115 aoe L starfall Fluffy_Pillow 92.8/100: 93% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static
4:32.095 aoe R starfire Fluffy_Pillow 63.8/100: 64% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static
4:33.563 aoe L starfall Fluffy_Pillow 87.0/100: 87% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static
4:34.543 aoe R starfire Fluffy_Pillow 56.0/100: 56% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static
4:36.012 aoe K cancel_buff Fluffy_Pillow 79.2/100: 79% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static
4:36.012 aoe L starfall Fluffy_Pillow 79.2/100: 79% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static
4:37.109 default E use_items Fluffy_Pillow 46.2/100: 46% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static
4:37.109 aoe Q starfall Fluffy_Pillow 46.2/100: 46% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(100)
4:38.165 aoe O wrath Fluffy_Pillow 15.2/100: 15% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(95)
4:39.181 aoe O wrath Fluffy_Pillow 27.2/100: 27% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(3), starlord(2), dreamstate, best_friends_with_pip_static, kindled_soul(90)
4:39.934 aoe R starfire Fluffy_Pillow 37.2/100: 37% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(2), best_friends_with_pip_static, kindled_soul(90)
4:40.941 aoe P fury_of_elune Fluffy_Pillow 60.4/100: 60% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(2), best_friends_with_pip_static, kindled_soul(85)
4:42.237 aoe L starfall Fluffy_Pillow 74.4/100: 74% astral_power natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(2), umbral_embrace, best_friends_with_pip_static, kindled_soul(75)
4:43.353 aoe R starfire Fluffy_Pillow 71.4/100: 71% astral_power natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, kindled_soul(70)
4:44.968 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, kindled_soul(65)
4:46.046 aoe R starfire Fluffy_Pillow 67.0/100: 67% astral_power natures_vigil, balance_of_all_things_arcane(2), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, kindled_soul(60)
4:47.658 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane, eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, kindled_soul(50)
4:48.735 aoe R starfire Fluffy_Pillow 61.0/100: 61% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, kindled_soul(45)
4:50.349 aoe K cancel_buff Fluffy_Pillow 87.2/100: 87% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, kindled_soul(35)
4:50.349 aoe L starfall Fluffy_Pillow 87.2/100: 87% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, kindled_soul(35)
4:51.555 aoe R starfire Fluffy_Pillow 42.2/100: 42% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, kindled_soul(30)
4:53.291 aoe Q starfall Fluffy_Pillow 61.4/100: 61% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, kindled_soul(20)
4:54.452 aoe O wrath Fluffy_Pillow 18.4/100: 18% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(3), starlord(2), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(15)
4:55.570 aoe O wrath Fluffy_Pillow 32.4/100: 32% astral_power primordial_arcanic_pulsar(45), starfall(3), starlord(2), dreamstate, best_friends_with_pip_static, kindled_soul(10)
4:56.325 aoe R starfire Fluffy_Pillow 44.4/100: 44% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), best_friends_with_pip_static, kindled_soul(5)
4:57.330 aoe Q starfall Fluffy_Pillow 69.6/100: 70% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), best_friends_with_pip_static
4:58.447 aoe R starfire Fluffy_Pillow 28.6/100: 29% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static
5:00.062 aoe L starfall Fluffy_Pillow 57.8/100: 58% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static
5:01.139 aoe R starfire Fluffy_Pillow 18.8/100: 19% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static
5:02.752 aoe L starfall Fluffy_Pillow 74.0/100: 74% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static
5:03.828 aoe R starfire Fluffy_Pillow 33.0/100: 33% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static
5:05.296 aoe R starfire Fluffy_Pillow 62.2/100: 62% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static
5:06.765 default D potion Fluffy_Pillow 85.4/100: 85% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static
5:06.765 aoe L starfall Fluffy_Pillow 85.4/100: 85% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, elemental_potion_of_ultimate_power
5:07.862 aoe Q starfall Fluffy_Pillow 54.4/100: 54% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, elemental_potion_of_ultimate_power
5:08.916 aoe R starfire Fluffy_Pillow 25.4/100: 25% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, elemental_potion_of_ultimate_power
5:10.438 aoe Q starfall Fluffy_Pillow 48.6/100: 49% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, elemental_potion_of_ultimate_power
5:11.455 aoe R starfire Fluffy_Pillow 13.6/100: 14% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, wafting_devotion, elemental_potion_of_ultimate_power
5:12.817 aoe R starfire Fluffy_Pillow 32.8/100: 33% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, wafting_devotion, elemental_potion_of_ultimate_power
5:14.180 aoe O wrath Fluffy_Pillow 56.0/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, wafting_devotion, elemental_potion_of_ultimate_power
5:15.089 aoe O wrath Fluffy_Pillow 66.0/100: 66% astral_power primordial_arcanic_pulsar(15), starfall(2), starlord(3), dreamstate, best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, wafting_devotion, elemental_potion_of_ultimate_power
5:15.841 aoe L starfall Fluffy_Pillow 76.0/100: 76% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(15), solstice, starfall(2), starlord(3), dreamstate, best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, wafting_devotion, elemental_potion_of_ultimate_power
5:16.840 aoe R starfire Fluffy_Pillow 35.0/100: 35% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, wafting_devotion, elemental_potion_of_ultimate_power
5:17.738 aoe R starfire Fluffy_Pillow 60.2/100: 60% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, wafting_devotion, elemental_potion_of_ultimate_power
5:19.234 aoe L starfall Fluffy_Pillow 87.4/100: 87% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, wafting_devotion, elemental_potion_of_ultimate_power
5:20.233 aoe K cancel_buff Fluffy_Pillow 78.4/100: 78% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(11), best_friends_with_pip_static, wafting_devotion, elemental_potion_of_ultimate_power
5:20.233 aoe L starfall Fluffy_Pillow 78.4/100: 78% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(11), best_friends_with_pip_static, wafting_devotion, elemental_potion_of_ultimate_power
5:21.352 aoe R starfire Fluffy_Pillow 37.4/100: 37% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar(3), best_friends_with_pip(10), best_friends_with_pip_static, wafting_devotion, elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (tauren) Raid-Buffed Unbuffed Gear Amount
Strength 898 2 986 900 0
Agility 2089 -2 2173 2087 0
Stamina 3848 2 44833 42698 38825
Intellect 2089 -2 15807 14885 12090 (7538)
Spirit 0 0 0 0 0
Health 896660 896660 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 15807 14885 0
Crit 22.30% 22.30% 3114
Haste 24.78% 24.78% 4212
Versatility 6.30% 1.30% 267
Mana Regen 2560 2560 0
Attack Power 16439 15480 0
Mastery 30.74% 30.74% 8152
Armor 5324 5324 5324
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 489.00
Local Head Benevolent Embersage's Casque
ilevel: 489, stats: { 673 Armor, +3966 Sta, +704 Crit, +330 Haste, +938 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }, enchant: incandescent_essence
Local Neck Eye of the Rising Flame
ilevel: 489, stats: { +2231 Sta, +256 Haste, +1537 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Life-Bound Shoulderpads
ilevel: 486, stats: { 603 Armor, +2875 Sta, +383 Mastery, +383 Haste, +684 AgiInt }
item effects: { equip: Toxified }
Local Chest Benevolent Embersage's Robe
ilevel: 489, stats: { 897 Armor, +3966 Sta, +715 Crit, +318 Mastery, +938 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 489, stats: { 505 Armor, +2975 Sta, +535 Haste, +241 Mastery, +704 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 489, stats: { 785 Armor, +3966 Sta, +705 Haste, +328 Mastery, +938 AgiInt }, enchant: { +155 StrAgiInt, +41 Vers (lambent_armor_kit_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 486, stats: { 548 Armor, +2875 Sta, +274 Crit, +438 Haste, +684 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Thermal Bindings
ilevel: 489, stats: { 449 Armor, +2231 Sta, +191 Crit, +390 Mastery, +528 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Benevolent Embersage's Talons
ilevel: 489, stats: { 505 Armor, +2975 Sta, +226 Vers, +549 Mastery, +704 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 489, stats: { +2231 Sta, +512 Haste, +1281 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 489, stats: { +2231 Sta, +1230 Crit, +564 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 489, stats: { +892 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 489, stats: { +738 Mastery }
item effects: { use: Balefire Branch }
Local Back Drape of the Loyal Vassal
ilevel: 489, stats: { 359 Armor, +2231 Sta, +328 Haste, +253 Mastery, +528 StrAgiInt }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 489, weapon: { 606 - 781, 2.6 }, stats: { +469 Int, +2264 Int, +1983 Sta, +156 Haste, +361 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 489, stats: { +1439 Int, +1983 Sta, +174 Haste, +343 Mastery }

Profile

druid="Base"
source=default
spec=balance
level=70
race=tauren
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=disabled
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:hissing_rune_3

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=489,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=489,gem_id=192961/192961/192961
shoulders=lifebound_shoulderpads,id=193406,bonus_id=8836/1576/8797/8960,ilevel=486,crafted_stats=49/36
back=drape_of_the_loyal_vassal,id=158375,bonus_id=4795,ilevel=489
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=489,enchant_id=6625
wrists=thermal_bindings,id=134461,bonus_id=4795,ilevel=489,gem_id=192961
hands=benevolent_embersages_talons,id=207255,bonus_id=4795,ilevel=489
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=489,enchant_id=6830
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=486
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=489
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=489
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=489,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=489

# Gear Summary
# gear_ilvl=488.63
# gear_stamina=38825
# gear_intellect=12090
# gear_crit_rating=3114
# gear_haste_rating=4212
# gear_mastery_rating=8152
# gear_versatility_rating=267
# gear_armor=5324
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

phial_of_charged_isolation_3 : 933913 dps, 170291 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
933912.7 933912.7 465.3 / 0.050% 87465.3 / 9.4% 67768.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.8 13.9 Astral Power 0.00% 56.4 100.0% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
phial_of_charged_isolation_3 933913
Astral Smolder 133403 14.3% 351.1 0.91s 113604 0 Periodic 710.1 56163 0 56163 0.0% 79.0%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 351.07 0.00 710.12 710.12 258.80 0.0000 2.0000 39883191.51 39883191.51 0.00% 28081.99 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 710.12 512 916 56163.33 4890 288669 56243.87 48096 65097 39883192 39883192 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Fury of Elune 28369 3.0% 5.1 64.88s 1656606 1713462 Direct 763.8 7165 15231 11102 48.8%

Stats Details: Fury Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.12 763.84 0.00 0.00 0.00 0.9669 0.0000 8479925.04 8479925.04 0.00% 1713462.32 1713462.32
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 51.19% 390.99 239 561 7164.88 3459 22838 7172.96 6197 8206 2801264 2801264 0.00%
crit 48.81% 372.85 238 549 15230.69 7056 46590 15243.12 13611 17582 5678661 5678661 0.00%

Action Details: Fury Of Elune

  • id:202770
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:astral_power
  • energize_amount:3.0

Spelldata

  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r

Action Details: Fury Of Elune Tick

  • id:211545
  • school:astral
  • range:105.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.149000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:211545
  • name:Fury of Elune
  • school:astral
  • tooltip:
  • description:{$@spelldesc202770=Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r}

Action Priority List

    aoe
    [P]:5.12
  • if_expr:target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Hungering Shadowflame 3695 0.4% 17.1 16.63s 64886 0 Direct 17.1 51984 106378 64892 23.7%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.08 17.08 0.00 0.00 0.00 0.0000 0.0000 1108059.81 1108059.81 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.27% 13.02 3 26 51983.72 34936 202233 51785.39 34936 133217 677029 677029 0.00%
crit 23.73% 4.05 0 14 106378.47 71270 412555 104798.32 0 407878 431030 431030 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:31299.68
  • base_dd_max:31299.68
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 6861 0.7% 34.3 8.55s 59818 0 Direct 34.2 48103 98015 59986 23.8%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.34 34.24 0.00 0.00 0.00 0.0000 0.0000 2054057.22 2054057.22 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.18% 26.09 9 52 48102.78 47503 54996 48100.59 47503 50398 1254761 1254761 0.00%
crit 23.82% 8.15 0 21 98015.07 96907 112191 98001.33 0 112191 799296 799296 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy3
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42559.30
  • base_dd_max:42559.30
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 77709 8.3% 3.0 1.07s 7752771 8417775 Direct 6.0 7312 14897 10604 43.4%
Periodic 1820.9 9128 18837 12738 37.2% 99.2%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.00 6.00 1820.94 1820.94 0.00 0.9210 0.9789 23258313.48 23258313.48 0.00% 13027.60 8417775.42
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.60% 3.40 0 6 7311.94 7211 8493 7260.74 0 8493 24833 24833 0.00%
crit 43.40% 2.60 0 6 14897.28 14710 17326 14405.50 0 17326 38791 38791 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 62.82% 1143.89 864 1426 9128.13 6972 14532 9128.16 8877 9378 10441440 10441440 0.00%
crit 37.18% 677.05 496 862 18836.73 14224 29646 18840.24 18287 19520 12753250 12753250 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy3
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    aoe
    [J]:3.00
  • if_expr:!fight_style.dungeonroute
  • target_if_expr:refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (82428) 0.0% (8.8%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 20371 2.2% 235.8 1.47s 25854 0 Direct 235.2 16865 36177 25921 46.9%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 235.77 235.16 0.00 0.00 0.00 0.0000 0.0000 6095661.41 6095661.41 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.11% 124.89 75 192 16865.31 11657 31421 16872.69 15416 18207 2106176 2106176 0.00%
crit 46.89% 110.28 67 165 36176.74 23781 64100 36206.43 33624 39146 3989485 3989485 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 20459 2.2% 237.4 1.46s 25784 0 Direct 236.8 16814 36063 25850 46.9%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 237.43 236.81 0.00 0.00 0.00 0.0000 0.0000 6121751.67 6121751.67 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.05% 125.64 76 187 16814.00 10488 31421 16820.96 15664 18002 2112448 2112448 0.00%
crit 46.95% 111.17 71 167 36063.40 21396 64100 36091.82 33525 39193 4009303 4009303 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 41598 4.5% 15.8 19.17s 789011 0 Direct 94.3 85830 184525 131923 46.7%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.78 94.35 0.00 0.00 0.00 0.0000 0.0000 12446851.88 12446851.88 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.29% 50.28 26 80 85830.14 43236 317280 85891.35 67835 107975 4315154 4315154 0.00%
crit 46.71% 44.07 21 75 184524.51 88202 618722 184661.04 141833 250522 8131697 8131697 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfall 314874 33.7% 104.7 2.84s 899083 888757 Direct 1767.0 36246 78228 53284 40.6%

Stats Details: Starfall

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 104.72 1766.98 0.00 0.00 0.00 1.0116 0.0000 94148736.98 94148736.98 0.00% 888757.39 888757.39
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.42% 1049.87 753 1341 36245.51 7975 133793 36325.26 32733 40010 38051880 38051880 0.00%
crit 40.58% 717.11 507 932 78228.24 16270 273376 78372.30 70890 86820 56096857 56096857 0.00%

Action Details: Starfall

  • id:191034
  • school:astral
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:45.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]

Action Details: Starfall Damage

  • id:191037
  • school:astral
  • range:200.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.114000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.41

Spelldata

  • id:191037
  • name:Starfall
  • school:astral
  • tooltip:
  • description:{$@spelldesc191034=Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]}

Action Priority List

    aoe
    [L]:70.58
  • if_expr:variable.starfall_condition1
    aoe
    [Q]:34.14
  • if_expr:variable.starfall_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountLunar Shrapnel4151691PCT0.200
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 210457 22.5% 117.8 2.50s 534406 383124 Direct 712.7 56837 122498 88318 47.9%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.78 712.71 0.00 0.00 0.00 1.3949 0.0000 62944519.54 62944519.54 0.00% 383123.56 383123.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.05% 370.98 266 486 56837.46 7817 251026 56862.56 50562 64686 21085119 21085119 0.00%
crit 47.95% 341.72 247 449 122497.87 15947 517966 122566.13 110439 140235 41859400 41859400 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    aoe
    [M]:1.27
  • if_expr:buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
    aoe
    [R]:117.03
  • if_expr:spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Solar)4851710.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Sunfire16481550.283Mastery
Sunfire 65047 7.0% 1.0 0.00s 19454039 20963404 Direct 1.0 5737 11702 7087 22.7%
Periodic 1833.8 7686 16438 10605 33.3% 99.8%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 1833.82 1833.82 0.00 0.9285 0.9786 19454038.90 19454038.90 0.00% 10835.22 20963403.99
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.33% 0.77 0 1 5736.69 5700 5775 4436.43 0 5775 4436 4436 0.00%
crit 22.67% 0.23 0 1 11701.93 11628 11781 2652.37 0 11781 2652 2652 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 66.65% 1222.29 931 1524 7686.11 5762 13211 7690.03 7432 7979 9394515 9394515 0.00%
crit 33.35% 611.54 446 816 16438.10 11755 26951 16448.45 15809 17202 10052435 10052435 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    aoe
    [I]:1.00
  • target_if_expr:refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (6764) 0.0% (0.7%) 8.4 33.14s 241421 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.39 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy3
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 3535 0.4% 8.4 33.14s 126174 0 Direct 50.3 16859 34357 21028 23.8%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.39 50.32 0.00 0.00 0.00 0.0000 0.0000 1058276.45 1058276.45 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.17% 38.33 7 96 16859.07 16647 19272 16857.10 16647 18272 646230 646230 0.00%
crit 23.83% 11.99 0 36 34357.02 33959 39316 34343.14 0 39316 412047 412047 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:51134.41
  • base_dd_max:51134.41
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 3228 0.3% 16.1 16.16s 60026 0 Direct 96.6 8021 16346 10004 23.8%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.10 96.62 0.00 0.00 0.00 0.0000 0.0000 966629.77 966629.77 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.17% 73.60 16 182 8020.51 7921 9170 8019.97 7921 8605 590273 590273 0.00%
crit 23.83% 23.02 3 66 16346.20 16159 18707 16348.00 16159 18070 376357 376357 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24330.91
  • base_dd_max:24330.91
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 4306 0.5% 26.5 10.35s 48986 63617 Direct 26.3 35888 73444 49279 35.7%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.46 26.30 0.00 0.00 0.00 0.7700 0.0000 1296069.57 1296069.57 0.00% 63617.02 63617.02
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 64.34% 16.92 6 28 35887.85 15810 68191 35807.35 24663 47328 607203 607203 0.00%
crit 35.66% 9.38 0 21 73444.16 32253 136947 73279.44 0 102376 688867 688867 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    aoe
    [O]:24.54
  • if_expr:!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.800Spell Data
Eclipse (Solar)4851710.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Lunar)4851810.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
phial_of_charged_isolation_3
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_charged_isolation_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Phial of Charged Isolation 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371386
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_charged_isolation_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_charged_isolation_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 180.90s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    aoe
    [N]:2.00
  • if_expr:variable.cd_condition_aoe

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.41s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.73 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_charged_isolation_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.73
Elemental Potion of Ultimate Power 1.4 304.75s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.44 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.44
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 17.4 6.0 17.7s 13.4s 9.6s 55.83% 57.85% 6.0 (20.5) 16.8

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.4s
  • trigger_min/max:0.0s / 37.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.7s
  • uptime_min/max:51.15% / 59.16%

Stack Uptimes

  • balance_of_all_things_arcane_1:5.73%
  • balance_of_all_things_arcane_2:6.12%
  • balance_of_all_things_arcane_3:6.61%
  • balance_of_all_things_arcane_4:7.04%
  • balance_of_all_things_arcane_5:7.33%
  • balance_of_all_things_arcane_6:7.56%
  • balance_of_all_things_arcane_7:7.69%
  • balance_of_all_things_arcane_8:7.76%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 10.2 0.0 29.8s 29.7s 7.9s 27.17% 30.43% 0.0 (0.0) 10.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 47.9s
  • trigger_min/max:4.5s / 46.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:24.64% / 30.00%

Stack Uptimes

  • balance_of_all_things_nature_1:3.36%
  • balance_of_all_things_nature_2:3.37%
  • balance_of_all_things_nature_3:3.38%
  • balance_of_all_things_nature_4:3.40%
  • balance_of_all_things_nature_5:3.40%
  • balance_of_all_things_nature_6:3.41%
  • balance_of_all_things_nature_7:3.42%
  • balance_of_all_things_nature_8:3.43%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 15.1 86.4 20.2s 2.9s 17.5s 88.21% 0.00% 35.5 (35.5) 0.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 59.3s
  • trigger_min/max:0.8s / 13.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:82.62% / 92.64%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:13.36%
  • balance_t31_4pc_buff_lunar_2:13.63%
  • balance_t31_4pc_buff_lunar_3:13.96%
  • balance_t31_4pc_buff_lunar_4:11.78%
  • balance_t31_4pc_buff_lunar_5:35.47%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 8.2 57.1 38.0s 4.4s 18.9s 51.97% 0.00% 26.5 (26.5) 0.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.1s / 83.4s
  • trigger_min/max:0.8s / 41.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:45.99% / 59.23%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:7.41%
  • balance_t31_4pc_buff_solar_2:6.46%
  • balance_t31_4pc_buff_solar_3:6.29%
  • balance_t31_4pc_buff_solar_4:6.43%
  • balance_t31_4pc_buff_solar_5:25.37%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 69.8s 69.8s 10.8s 10.09% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 329.0s
  • trigger_min/max:12.0s / 329.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 34.32%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.90%
  • best_friends_with_aerwynn_2:0.90%
  • best_friends_with_aerwynn_3:0.91%
  • best_friends_with_aerwynn_4:0.91%
  • best_friends_with_aerwynn_5:0.91%
  • best_friends_with_aerwynn_6:0.92%
  • best_friends_with_aerwynn_7:0.92%
  • best_friends_with_aerwynn_8:0.92%
  • best_friends_with_aerwynn_9:0.93%
  • best_friends_with_aerwynn_10:0.93%
  • best_friends_with_aerwynn_11:0.93%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 113.0s 69.8s 45.5s 33.43% 0.00% 69.4 (69.4) 0.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 335.7s
  • trigger_min/max:12.0s / 329.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 329.8s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.43%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 69.2s 69.2s 10.8s 10.15% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 339.5s
  • trigger_min/max:12.0s / 339.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 37.89%

Stack Uptimes

  • best_friends_with_pip_1:0.91%
  • best_friends_with_pip_2:0.91%
  • best_friends_with_pip_3:0.91%
  • best_friends_with_pip_4:0.92%
  • best_friends_with_pip_5:0.92%
  • best_friends_with_pip_6:0.92%
  • best_friends_with_pip_7:0.93%
  • best_friends_with_pip_8:0.93%
  • best_friends_with_pip_9:0.93%
  • best_friends_with_pip_10:0.94%
  • best_friends_with_pip_11:0.94%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 112.6s 69.2s 45.0s 33.08% 0.00% 68.8 (68.8) 0.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 351.6s
  • trigger_min/max:12.0s / 339.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.7s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.08%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 70.0s 70.0s 10.8s 10.16% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 318.2s
  • trigger_min/max:12.0s / 318.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 35.41%

Stack Uptimes

  • best_friends_with_urctos_1:0.91%
  • best_friends_with_urctos_2:0.91%
  • best_friends_with_urctos_3:0.91%
  • best_friends_with_urctos_4:0.92%
  • best_friends_with_urctos_5:0.92%
  • best_friends_with_urctos_6:0.92%
  • best_friends_with_urctos_7:0.93%
  • best_friends_with_urctos_8:0.93%
  • best_friends_with_urctos_9:0.93%
  • best_friends_with_urctos_10:0.94%
  • best_friends_with_urctos_11:0.94%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 113.6s 70.0s 45.1s 33.50% 0.00% 69.7 (69.7) 0.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 359.4s
  • trigger_min/max:12.0s / 318.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 310.7s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.50%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.54% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.54%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Dreamstate 15.3 0.0 20.3s 21.3s 2.1s 10.83% 20.62% 0.0 (0.1) 0.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 55.5s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.5s
  • uptime_min/max:7.51% / 15.06%

Stack Uptimes

  • dreamstate_1:7.37%
  • dreamstate_2:3.46%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 13.3 8.1 23.6s 14.8s 21.0s 93.09% 93.81% 8.1 (8.1) 12.4

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.6s / 71.7s
  • trigger_min/max:0.0s / 57.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.0s
  • uptime_min/max:89.91% / 95.98%

Stack Uptimes

  • eclipse_lunar_1:93.09%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 8.2 0.0 38.1s 38.1s 19.1s 52.72% 54.64% 0.0 (0.0) 7.9

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 84.4s
  • trigger_min/max:12.0s / 84.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.97% / 59.78%

Stack Uptimes

  • eclipse_solar_1:52.72%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 306.1s 306.1s 27.3s 12.94% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 325.9s
  • trigger_min/max:300.0s / 325.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.75% / 17.86%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.94%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Fury of Elune 5.1 0.0 65.1s 65.1s 7.9s 13.51% 0.00% 75.8 (75.8) 4.9

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:60.0s / 90.5s
  • trigger_min/max:60.0s / 90.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:10.87% / 15.62%

Stack Uptimes

  • fury_of_elune_1:13.51%

Spelldata

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 8.2 0.0 38.1s 38.1s 19.1s 52.72% 55.36% 0.0 (0.0) 7.9

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 84.4s
  • trigger_min/max:12.0s / 84.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.97% / 59.78%

Stack Uptimes

  • incarnation_chosen_of_elune_1:52.72%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.7 0.0 90.9s 90.9s 19.6s 23.98% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:65.76

Trigger Details

  • interval_min/max:90.0s / 122.4s
  • trigger_min/max:90.0s / 122.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.60% / 26.99%

Stack Uptimes

  • kindled_soul_5:1.17%
  • kindled_soul_10:1.18%
  • kindled_soul_15:1.18%
  • kindled_soul_20:1.18%
  • kindled_soul_25:1.18%
  • kindled_soul_30:1.19%
  • kindled_soul_35:1.19%
  • kindled_soul_40:1.19%
  • kindled_soul_45:1.19%
  • kindled_soul_50:1.20%
  • kindled_soul_55:1.20%
  • kindled_soul_60:1.20%
  • kindled_soul_65:1.21%
  • kindled_soul_70:1.21%
  • kindled_soul_75:1.21%
  • kindled_soul_80:1.21%
  • kindled_soul_85:1.22%
  • kindled_soul_90:1.22%
  • kindled_soul_95:1.22%
  • kindled_soul_100:1.23%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Vigil 3.7 0.0 90.4s 90.4s 14.7s 18.38% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.5s
  • trigger_min/max:90.0s / 91.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.53% / 21.03%

Stack Uptimes

  • natures_vigil_1:18.38%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.0 69.7s 69.2s 0.9s 0.76% 1.16% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 335.2s
  • trigger_min/max:0.1s / 335.2s
  • trigger_pct:14.89%
  • duration_min/max:0.0s / 6.2s
  • uptime_min/max:0.00% / 4.40%

Stack Uptimes

  • owlkin_frenzy_1:0.76%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 9.2 96.5 34.0s 34.0s 29.9s 91.37% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.9s / 45.9s
  • trigger_min/max:20.9s / 45.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.6s
  • uptime_min/max:87.16% / 95.44%

Stack Uptimes

  • primordial_arcanic_pulsar_5:7.26%
  • primordial_arcanic_pulsar_10:6.71%
  • primordial_arcanic_pulsar_15:7.53%
  • primordial_arcanic_pulsar_20:8.35%
  • primordial_arcanic_pulsar_25:8.65%
  • primordial_arcanic_pulsar_30:8.40%
  • primordial_arcanic_pulsar_35:8.65%
  • primordial_arcanic_pulsar_40:9.03%
  • primordial_arcanic_pulsar_45:9.06%
  • primordial_arcanic_pulsar_50:8.85%
  • primordial_arcanic_pulsar_55:8.89%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 19.7 3.7 15.6s 13.4s 6.7s 43.99% 43.18% 3.7 (3.7) 19.3

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 43.2s
  • trigger_min/max:0.0s / 37.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:39.50% / 47.17%

Stack Uptimes

  • solstice_1:43.99%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starfall 104.7 0.0 143.1s 2.8s 295.9s 98.88% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_starfall
  • max_stacks:20
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:asynchronous
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.8s / 357.2s
  • trigger_min/max:0.7s / 8.6s
  • trigger_pct:99.99%
  • duration_min/max:5.0s / 358.0s
  • uptime_min/max:98.44% / 99.49%

Stack Uptimes

  • starfall_1:5.25%
  • starfall_2:32.48%
  • starfall_3:42.28%
  • starfall_4:15.16%
  • starfall_5:3.35%
  • starfall_6:0.36%
  • starfall_7:0.00%

Spelldata

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]
  • max_stacks:20
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Starlord 21.0 83.7 14.5s 2.8s 13.9s 97.49% 0.00% 42.4 (42.4) 6.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 19.2s
  • trigger_min/max:0.8s / 8.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:94.67% / 99.31%

Stack Uptimes

  • starlord_1:12.59%
  • starlord_2:17.68%
  • starlord_3:67.22%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Umbral Embrace 23.0 2.6 12.7s 11.4s 1.6s 12.41% 0.00% 2.6 (2.6) 0.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_umbral_embrace
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 53.8s
  • trigger_min/max:0.0s / 53.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.1s
  • uptime_min/max:4.51% / 23.47%

Stack Uptimes

  • umbral_embrace_1:12.41%

Spelldata

  • id:393763
  • name:Umbral Embrace
  • tooltip:Your next Wrath or Starfire cast during an Eclipse deals Astral damage and deals {$=}w1% additional damage.
  • description:{$@spelldesc393760=Dealing Astral damage has a chance to cause your next Wrath or Starfire cast during an Eclipse to become Astral and deal {$s1=25}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Wafting Devotion 4.3 1.2 61.3s 45.8s 16.5s 23.57% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 214.2s
  • trigger_min/max:0.0s / 214.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 88.9s
  • uptime_min/max:4.91% / 64.64%

Stack Uptimes

  • wafting_devotion_1:23.57%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Charged Isolation

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_phial_of_charged_isolation
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Spelldata

  • id:371386
  • name:Phial of Charged Isolation
  • tooltip:Primary stat is increased by {$=}w1 while at least {$371385=}A1 yds from allies. {$=}w2% of this stat will linger for {$384713d=2.500 seconds} after being near an ally.
  • description:Primary stat is increased by {$s1=303} while at least {$371385=}A1 yds from allies. You will retain {$=}M2% of this stat for {$384713d=2.500 seconds} after being near an ally. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Charged Isolation (_stats)

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_phial_of_charged_isolation_stats
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:598.00

Spelldata

  • id:371387
  • name:Phial of Charged Isolation
  • tooltip:Primary stat is increased by {$=}w1.
  • description:{$@spelldesc371386=Primary stat is increased by {$s1=303} while at least {$371385=}A1 yds from allies. You will retain {$=}M2% of this stat for {$384713d=2.500 seconds} after being near an ally. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Primordial Arcanic Pulsar 8.3 6.0 10.0 35.2s 21.6s 46.4s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.05% 0.00% 0.63% 0.0s 0.0s 1.0s
Astral Smolder 72.11% 61.05% 82.58% 3.9s 0.0s 46.0s
Incarnation (Total) 52.72% 46.97% 59.78% 19.1s 0.0s 54.0s
Incarnation (Pulsar) 32.42% 29.40% 34.88% 11.8s 0.0s 12.0s
Lunar Eclipse Only 40.37% 32.03% 46.36% 9.2s 0.0s 15.0s
No Eclipse 6.87% 4.02% 10.09% 1.7s 0.0s 4.7s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Fury of Elune5.2370.00030.46926.8085.99874.680

Eclipse Utilization

NoneSolarLunarBoth
Wrath24.46100.0%0.000.0%0.000.0%0.000.0%
Starfire2.462.1%0.000.0%49.8241.9%66.5056.0%
Starfall20.837.0%0.000.0%117.9039.9%157.0653.1%
Fury of Elune15.462.0%0.000.0%144.4518.9%603.9379.1%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
phial_of_charged_isolation_3
Fury of EluneAstral Power80.71241.765.79%3.000.360.15%
MoonfireAstral Power3.0018.000.43%6.000.000.00%
Orbit BreakerAstral Power15.78471.1411.28%29.872.120.45%
Shooting Stars (Moonfire)Astral Power235.78471.2711.29%2.000.280.06%
Shooting Stars (Sunfire)Astral Power237.43474.5911.37%2.000.270.06%
StarfireAstral Power118.782227.8353.36%18.7635.101.55%
SunfireAstral Power1.006.000.14%6.000.000.00%
WrathAstral Power26.46264.586.34%10.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
phial_of_charged_isolation_3
StarfallAstral Power 105.104136.56100.00%39.3639.5022760.14
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 896660.0 1890.25 2165.87 4265327.2 814080.3 309930.5 896660.0
Astral Power 20.0 13.94 13.76 38.2 53.5 0.6 100.0

Statistics & Data Analysis

Fight Length
phial_of_charged_isolation_3 Fight Length
Count 8868
Mean 299.61
Minimum 240.00
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 34.8927
5th Percentile 245.54
95th Percentile 354.24
( 95th Percentile - 5th Percentile ) 108.70
Mean Distribution
Standard Deviation 0.3705
95.00% Confidence Interval ( 298.88 - 300.33 )
Normalized 95.00% Confidence Interval ( 99.76% - 100.24% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 522
0.1% Error 52103
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1040
DPS
phial_of_charged_isolation_3 Damage Per Second
Count 8868
Mean 933912.71
Minimum 866089.62
Maximum 1030451.92
Spread ( max - min ) 164362.29
Range [ ( max - min ) / 2 * 100% ] 8.80%
Standard Deviation 22357.0635
5th Percentile 899076.91
95th Percentile 972969.44
( 95th Percentile - 5th Percentile ) 73892.53
Mean Distribution
Standard Deviation 237.4116
95.00% Confidence Interval ( 933447.39 - 934378.03 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2202
0.1 Scale Factor Error with Delta=300 4266908
0.05 Scale Factor Error with Delta=300 17067629
0.01 Scale Factor Error with Delta=300 426690711
Priority Target DPS
phial_of_charged_isolation_3 Priority Target Damage Per Second
Count 8868
Mean 170291.01
Minimum 151489.93
Maximum 191621.08
Spread ( max - min ) 40131.15
Range [ ( max - min ) / 2 * 100% ] 11.78%
Standard Deviation 5435.3852
5th Percentile 161698.89
95th Percentile 179454.63
( 95th Percentile - 5th Percentile ) 17755.73
Mean Distribution
Standard Deviation 57.7188
95.00% Confidence Interval ( 170177.89 - 170404.14 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3914
0.1 Scale Factor Error with Delta=300 252200
0.05 Scale Factor Error with Delta=300 1008799
0.01 Scale Factor Error with Delta=300 25219957
DPS(e)
phial_of_charged_isolation_3 Damage Per Second (Effective)
Count 8868
Mean 933912.71
Minimum 866089.62
Maximum 1030451.92
Spread ( max - min ) 164362.29
Range [ ( max - min ) / 2 * 100% ] 8.80%
Damage
phial_of_charged_isolation_3 Damage
Count 8868
Mean 279316083.21
Minimum 219736509.34
Maximum 342460502.82
Spread ( max - min ) 122723993.48
Range [ ( max - min ) / 2 * 100% ] 21.97%
DTPS
phial_of_charged_isolation_3 Damage Taken Per Second
Count 8868
Mean 2166.77
Minimum 829.71
Maximum 4352.01
Spread ( max - min ) 3522.30
Range [ ( max - min ) / 2 * 100% ] 81.28%
HPS
phial_of_charged_isolation_3 Healing Per Second
Count 8868
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
phial_of_charged_isolation_3 Healing Per Second (Effective)
Count 8868
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
phial_of_charged_isolation_3 Heal
Count 8868
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
phial_of_charged_isolation_3 Healing Taken Per Second
Count 8868
Mean 1887.27
Minimum 567.11
Maximum 4276.31
Spread ( max - min ) 3709.20
Range [ ( max - min ) / 2 * 100% ] 98.27%
TMI
phial_of_charged_isolation_3 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
phial_of_charged_isolation_3Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
phial_of_charged_isolation_3 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.44 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.67 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.73 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.aoe
# count action,conditions
0.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
0.00 variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
I 1.00 sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
J 3.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
0.00 variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
K 14.01 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
L 70.58 starfall,if=variable.starfall_condition1
M 1.27 starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
0.00 celestial_alignment,if=variable.cd_condition_aoe
N 2.00 incarnation,if=variable.cd_condition_aoe
0.00 warrior_of_elune
0.00 variable,name=enter_solar,value=spell_targets.starfire<3
0.00 starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
O 24.54 wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
0.00 wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
P 5.12 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
Q 34.14 starfall,if=variable.starfall_condition2
0.00 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+50
0.00 convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 new_moon,if=astral_power.deficit>variable.passive_asp+10
0.00 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
R 117.03 starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
0.00 wrath
S 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFIJLJJLMNDEPQRRLRLLRLRKLQRQRRRRLRLRLRRKLQQRRRRLRLRRLRKLQOORQRRLRLRRLQRQPROOLLRLRKQRQRRQOORRLFKRLQRQERRRLRLROOLRLQRRRLRRKLOOQRQRRLRRKLPQQRRLRLROLOKLRQRQRRRRKLOOQRQRRLRRKLQQRFRRLOOMLNERLRKLQRQRPRRLRLRKLQQRRLRRLRLRRLQRQRROLORRKLLRQRRRLRLRKLOOQRLRPLRRKLQROOLRFRLRRKLRQERQRRLRLRKLOOQRQRRLRLRDRLOOQRRQRRRLKLPQQRRLRLO

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask phial_of_charged_isolation_3 0.0/100: 0% astral_power
Pre precombat 1 food phial_of_charged_isolation_3 0.0/100: 0% astral_power
Pre precombat 2 augmentation phial_of_charged_isolation_3 0.0/100: 0% astral_power
Pre precombat 4 no_cd_talent phial_of_charged_isolation_3 0.0/100: 0% astral_power
Pre precombat 5 on_use_trinket phial_of_charged_isolation_3 0.0/100: 0% astral_power
Pre precombat 6 on_use_trinket phial_of_charged_isolation_3 0.0/100: 0% astral_power
Pre precombat 7 on_use_trinket phial_of_charged_isolation_3 0.0/100: 0% astral_power
Pre precombat 8 moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power
Pre precombat 9 wrath Fluffy_Pillow 0.0/100: 0% astral_power
Pre precombat A wrath Fluffy_Pillow 10.0/100: 10% astral_power
Pre precombat C starfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice
0:00.000 default F natures_vigil phial_of_charged_isolation_3 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate
0:00.000 aoe I sunfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate
0:00.927 aoe J moonfire Fluffy_Pillow 49.2/100: 49% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate
0:01.856 aoe L starfall Fluffy_Pillow 59.2/100: 59% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, dreamstate, best_friends_with_urctos(11), best_friends_with_urctos_static
0:02.785 aoe J moonfire enemy2 50.2/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_urctos(10), best_friends_with_urctos_static
0:03.678 aoe J moonfire enemy5 62.2/100: 62% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_urctos(9), best_friends_with_urctos_static
0:04.573 aoe L starfall Fluffy_Pillow 72.2/100: 72% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_urctos(8), best_friends_with_urctos_static
0:05.466 aoe M starfire Fluffy_Pillow 33.2/100: 33% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(8), best_friends_with_urctos_static
0:06.240 aoe N incarnation_chosen_of_elune Fluffy_Pillow 54.4/100: 54% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(10), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(7), best_friends_with_urctos_static
0:06.240 default D potion Fluffy_Pillow 54.4/100: 54% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), best_friends_with_urctos(7), best_friends_with_urctos_static
0:06.240 default E use_items Fluffy_Pillow 54.4/100: 54% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), best_friends_with_urctos(7), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:06.240 aoe P fury_of_elune Fluffy_Pillow 54.4/100: 54% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), best_friends_with_urctos(7), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(100)
0:07.022 aoe Q starfall Fluffy_Pillow 59.4/100: 59% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), best_friends_with_urctos(6), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(100)
0:07.804 aoe R starfire Fluffy_Pillow 38.4/100: 38% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_urctos(5), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(95)
0:08.559 aoe R starfire Fluffy_Pillow 64.6/100: 65% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_urctos(4), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(90)
0:09.313 aoe L starfall Fluffy_Pillow 93.8/100: 94% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_urctos(4), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(85)
0:10.068 aoe R starfire Fluffy_Pillow 67.8/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(3), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(85)
0:11.196 aoe L starfall Fluffy_Pillow 99.0/100: 99% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(2), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(80)
0:11.950 aoe L starfall Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos, best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(75)
0:12.706 aoe R starfire Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(70)
0:13.835 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(65)
0:14.588 aoe R starfire Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(11), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(60)
0:15.718 aoe K cancel_buff Fluffy_Pillow 89.2/100: 89% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(10), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(55)
0:15.718 aoe L starfall Fluffy_Pillow 89.2/100: 89% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(10), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(55)
0:16.563 aoe Q starfall Fluffy_Pillow 58.2/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(5), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(50)
0:17.375 aoe R starfire Fluffy_Pillow 23.2/100: 23% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(5), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(45)
0:18.546 aoe Q starfall Fluffy_Pillow 44.4/100: 44% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(5), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(40)
0:19.328 aoe R starfire Fluffy_Pillow 13.4/100: 13% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(6), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(35)
0:20.456 aoe R starfire Fluffy_Pillow 32.6/100: 33% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(5), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(30)
0:21.586 aoe R starfire Fluffy_Pillow 53.8/100: 54% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(4), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(25)
0:22.716 aoe R starfire Fluffy_Pillow 77.0/100: 77% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(3), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(20)
0:23.846 aoe L starfall Fluffy_Pillow 98.2/100: 98% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(2), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(15)
0:24.600 aoe R starfire Fluffy_Pillow 65.2/100: 65% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos, best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(10)
0:25.730 aoe L starfall Fluffy_Pillow 84.4/100: 84% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(5)
0:26.485 aoe R starfire Fluffy_Pillow 53.4/100: 53% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:27.615 aoe L starfall Fluffy_Pillow 80.6/100: 81% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:28.369 aoe R starfire Fluffy_Pillow 51.6/100: 52% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:29.499 aoe R starfire Fluffy_Pillow 74.8/100: 75% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:30.627 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:30.627 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:31.472 aoe Q starfall Fluffy_Pillow 71.0/100: 71% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:32.283 aoe Q starfall Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:33.064 aoe R starfire Fluffy_Pillow 3.0/100: 3% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(5), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:34.192 aoe R starfire Fluffy_Pillow 24.2/100: 24% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:35.321 aoe R starfire Fluffy_Pillow 45.4/100: 45% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:36.451 aoe R starfire Fluffy_Pillow 66.6/100: 67% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
0:37.579 aoe L starfall Fluffy_Pillow 91.8/100: 92% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
0:38.334 aoe R starfire Fluffy_Pillow 58.8/100: 59% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
0:39.465 aoe L starfall Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
0:40.221 aoe R starfire Fluffy_Pillow 49.0/100: 49% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
0:41.688 aoe R starfire Fluffy_Pillow 72.2/100: 72% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
0:43.155 aoe L starfall Fluffy_Pillow 91.4/100: 91% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
0:44.134 aoe R starfire Fluffy_Pillow 56.4/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
0:45.603 aoe K cancel_buff Fluffy_Pillow 77.6/100: 78% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
0:45.603 aoe L starfall Fluffy_Pillow 77.6/100: 78% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
0:46.698 aoe Q starfall Fluffy_Pillow 44.6/100: 45% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord, umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
0:47.753 aoe O wrath Fluffy_Pillow 11.6/100: 12% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(2), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
0:48.771 aoe O wrath Fluffy_Pillow 21.6/100: 22% astral_power primordial_arcanic_pulsar(45), starfall(3), starlord(2), umbral_embrace, dreamstate, best_friends_with_urctos_static
0:49.526 aoe R starfire Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(3), starlord(2), umbral_embrace, best_friends_with_urctos_static
0:50.531 aoe Q starfall Fluffy_Pillow 56.8/100: 57% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(3), starlord(2), best_friends_with_urctos_static
0:51.652 aoe R starfire Fluffy_Pillow 17.8/100: 18% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static
0:53.266 aoe R starfire Fluffy_Pillow 43.0/100: 43% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static
0:54.878 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static
0:55.954 aoe R starfire Fluffy_Pillow 59.0/100: 59% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static
0:57.568 aoe L starfall Fluffy_Pillow 78.2/100: 78% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static
0:58.647 aoe R starfire Fluffy_Pillow 37.2/100: 37% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static
1:00.113 aoe R starfire Fluffy_Pillow 66.4/100: 66% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static
1:01.580 aoe L starfall Fluffy_Pillow 89.6/100: 90% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static
1:02.678 aoe Q starfall Fluffy_Pillow 60.6/100: 61% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static
1:03.732 aoe R starfire Fluffy_Pillow 31.6/100: 32% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
1:05.254 aoe Q starfall Fluffy_Pillow 54.8/100: 55% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
1:06.271 aoe P fury_of_elune Fluffy_Pillow 21.8/100: 22% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
1:07.251 aoe R starfire Fluffy_Pillow 26.8/100: 27% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
1:08.720 aoe O wrath Fluffy_Pillow 55.0/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
1:09.699 aoe O wrath Fluffy_Pillow 71.0/100: 71% astral_power fury_of_elune, primordial_arcanic_pulsar(15), starfall(2), starlord(3), dreamstate, best_friends_with_urctos_static
1:10.454 aoe L starfall Fluffy_Pillow 87.0/100: 87% astral_power balance_of_all_things_arcane(8), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(2), starlord(3), dreamstate, best_friends_with_urctos_static
1:11.531 aoe L starfall Fluffy_Pillow 52.0/100: 52% astral_power balance_of_all_things_arcane(7), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_urctos_static
1:12.609 aoe R starfire Fluffy_Pillow 49.0/100: 49% astral_power balance_of_all_things_arcane(6), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static
1:13.580 aoe L starfall Fluffy_Pillow 78.2/100: 78% astral_power balance_of_all_things_arcane(5), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static
1:14.658 aoe R starfire Fluffy_Pillow 45.2/100: 45% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static
1:16.273 aoe K cancel_buff Fluffy_Pillow 72.4/100: 72% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static
1:16.273 aoe Q starfall Fluffy_Pillow 72.4/100: 72% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static
1:17.481 aoe R starfire Fluffy_Pillow 31.4/100: 31% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(4), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static
1:19.218 aoe Q starfall Fluffy_Pillow 54.6/100: 55% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static
1:20.377 aoe R starfire Fluffy_Pillow 9.6/100: 10% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
1:22.050 aoe R starfire Fluffy_Pillow 32.8/100: 33% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
1:23.723 aoe Q starfall Fluffy_Pillow 54.0/100: 54% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
1:24.841 aoe O wrath Fluffy_Pillow 11.0/100: 11% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
1:25.919 aoe O wrath Fluffy_Pillow 25.0/100: 25% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(3), dreamstate, best_friends_with_urctos_static
1:26.673 aoe R starfire Fluffy_Pillow 39.0/100: 39% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), best_friends_with_urctos_static
1:27.645 aoe R starfire Fluffy_Pillow 62.2/100: 62% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), best_friends_with_urctos_static
1:29.260 aoe L starfall Fluffy_Pillow 85.4/100: 85% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), best_friends_with_urctos_static
1:30.337 default F natures_vigil phial_of_charged_isolation_3 44.4/100: 44% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static
1:30.337 aoe K cancel_buff Fluffy_Pillow 44.4/100: 44% astral_power natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static
1:30.337 aoe R starfire Fluffy_Pillow 44.4/100: 44% astral_power natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static
1:32.144 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, balance_t31_4pc_buff_lunar, best_friends_with_urctos_static
1:33.350 aoe Q starfall Fluffy_Pillow 55.0/100: 55% astral_power natures_vigil, balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static
1:34.510 aoe R starfire Fluffy_Pillow 14.0/100: 14% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static
1:35.525 aoe Q starfall Fluffy_Pillow 37.2/100: 37% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(2), umbral_embrace, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static
1:36.543 default E use_items Fluffy_Pillow 6.2/100: 6% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static
1:36.543 aoe R starfire Fluffy_Pillow 6.2/100: 6% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, kindled_soul(100)
1:38.010 aoe R starfire Fluffy_Pillow 35.4/100: 35% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, kindled_soul(95)
1:39.478 aoe R starfire Fluffy_Pillow 62.6/100: 63% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, kindled_soul(90)
1:40.945 aoe L starfall Fluffy_Pillow 83.8/100: 84% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, kindled_soul(80)
1:41.925 aoe R starfire Fluffy_Pillow 50.8/100: 51% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, kindled_soul(75)
1:43.391 aoe L starfall Fluffy_Pillow 74.0/100: 74% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, kindled_soul(70)
1:44.371 aoe R starfire Fluffy_Pillow 41.0/100: 41% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, kindled_soul(65)
1:45.838 aoe O wrath Fluffy_Pillow 57.0/100: 57% astral_power primordial_arcanic_pulsar(15), starfall(2), starlord(3), dreamstate, best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, kindled_soul(55)
1:46.591 aoe O wrath Fluffy_Pillow 69.0/100: 69% astral_power primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, kindled_soul(50)
1:47.345 aoe L starfall Fluffy_Pillow 83.0/100: 83% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(15), solstice, starfall(2), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, kindled_soul(50)
1:48.552 aoe R starfire Fluffy_Pillow 44.0/100: 44% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn, best_friends_with_aerwynn_static, kindled_soul(40)
1:50.289 aoe L starfall Fluffy_Pillow 99.2/100: 99% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, best_friends_with_urctos(11), best_friends_with_urctos_static, kindled_soul(35)
1:51.449 aoe Q starfall Fluffy_Pillow 60.2/100: 60% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(2), umbral_embrace, balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(10), best_friends_with_urctos_static, kindled_soul(30)
1:52.567 aoe R starfire Fluffy_Pillow 19.2/100: 19% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(9), best_friends_with_urctos_static, kindled_soul(20)
1:54.182 aoe R starfire Fluffy_Pillow 42.4/100: 42% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(7), best_friends_with_urctos_static, kindled_soul(15)
1:55.796 aoe R starfire Fluffy_Pillow 63.6/100: 64% astral_power eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(5), best_friends_with_urctos_static, kindled_soul(5)
1:57.411 aoe L starfall Fluffy_Pillow 84.8/100: 85% astral_power eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(4), best_friends_with_urctos_static
1:58.490 aoe R starfire Fluffy_Pillow 39.8/100: 40% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(3), best_friends_with_urctos_static
2:00.102 aoe R starfire Fluffy_Pillow 63.0/100: 63% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos, best_friends_with_urctos_static
2:01.716 aoe K cancel_buff Fluffy_Pillow 82.2/100: 82% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static
2:01.716 aoe L starfall Fluffy_Pillow 82.2/100: 82% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static
2:02.925 aoe O wrath Fluffy_Pillow 39.2/100: 39% astral_power primordial_arcanic_pulsar(40), starfall(2), starlord, dreamstate, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static
2:03.680 aoe O wrath Fluffy_Pillow 49.2/100: 49% astral_power primordial_arcanic_pulsar(40), starfall(2), starlord, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static
2:04.436 aoe Q starfall Fluffy_Pillow 63.2/100: 63% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(40), solstice, starfall(2), starlord, best_friends_with_aerwynn(9), best_friends_with_aerwynn_static
2:05.596 aoe R starfire Fluffy_Pillow 22.2/100: 22% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(8), best_friends_with_aerwynn_static
2:07.269 aoe Q starfall Fluffy_Pillow 47.4/100: 47% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static
2:08.387 aoe R starfire Fluffy_Pillow 6.4/100: 6% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static
2:10.000 aoe R starfire Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static
2:11.615 aoe L starfall Fluffy_Pillow 88.8/100: 89% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(50), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static
2:12.692 aoe R starfire Fluffy_Pillow 45.8/100: 46% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static
2:14.305 aoe R starfire Fluffy_Pillow 69.0/100: 69% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static
2:15.920 aoe K cancel_buff Fluffy_Pillow 90.2/100: 90% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static
2:15.920 aoe L starfall Fluffy_Pillow 90.2/100: 90% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static
2:17.125 aoe P fury_of_elune Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static
2:18.178 aoe Q starfall Fluffy_Pillow 63.2/100: 63% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static
2:19.231 aoe Q starfall Fluffy_Pillow 40.2/100: 40% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static
2:20.246 aoe R starfire Fluffy_Pillow 17.2/100: 17% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static
2:21.714 aoe R starfire Fluffy_Pillow 53.4/100: 53% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static
2:23.181 aoe L starfall Fluffy_Pillow 83.6/100: 84% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static
2:24.158 aoe R starfire Fluffy_Pillow 56.6/100: 57% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static
2:25.626 aoe L starfall Fluffy_Pillow 85.8/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static
2:26.606 aoe R starfire Fluffy_Pillow 50.8/100: 51% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static
2:28.073 aoe O wrath Fluffy_Pillow 64.8/100: 65% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), dreamstate, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static
2:28.827 aoe L starfall Fluffy_Pillow 78.8/100: 79% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), dreamstate, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static
2:29.906 aoe O wrath Fluffy_Pillow 33.8/100: 34% astral_power primordial_arcanic_pulsar(25), starfall(3), starlord(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static
2:30.660 aoe K cancel_buff Fluffy_Pillow 47.8/100: 48% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static
2:30.660 aoe L starfall Fluffy_Pillow 47.8/100: 48% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static
2:31.866 aoe R starfire Fluffy_Pillow 36.8/100: 37% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(8), best_friends_with_aerwynn_static
2:33.605 aoe Q starfall Fluffy_Pillow 62.0/100: 62% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static
2:34.763 aoe R starfire Fluffy_Pillow 25.0/100: 25% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static
2:36.438 aoe Q starfall Fluffy_Pillow 52.2/100: 52% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static
2:37.555 aoe R starfire Fluffy_Pillow 9.2/100: 9% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static
2:39.169 aoe R starfire Fluffy_Pillow 28.4/100: 28% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static
2:40.783 aoe R starfire Fluffy_Pillow 49.6/100: 50% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static
2:42.398 aoe R starfire Fluffy_Pillow 68.8/100: 69% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static
2:44.012 aoe K cancel_buff Fluffy_Pillow 90.0/100: 90% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static
2:44.012 aoe L starfall Fluffy_Pillow 90.0/100: 90% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static
2:45.220 aoe O wrath Fluffy_Pillow 47.0/100: 47% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall, starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static
2:46.381 aoe O wrath Fluffy_Pillow 57.0/100: 57% astral_power primordial_arcanic_pulsar(45), starfall, starlord, dreamstate, best_friends_with_aerwynn_static
2:47.136 aoe Q starfall Fluffy_Pillow 71.0/100: 71% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord, dreamstate, best_friends_with_aerwynn_static
2:48.297 aoe R starfire Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static
2:49.302 aoe Q starfall Fluffy_Pillow 55.2/100: 55% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, wafting_devotion
2:50.338 aoe R starfire Fluffy_Pillow 12.2/100: 12% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, wafting_devotion
2:51.836 aoe R starfire Fluffy_Pillow 39.4/100: 39% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, wafting_devotion
2:53.334 aoe L starfall Fluffy_Pillow 92.6/100: 93% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, wafting_devotion
2:54.333 aoe R starfire Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, wafting_devotion
2:55.694 aoe R starfire Fluffy_Pillow 78.8/100: 79% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, wafting_devotion
2:57.056 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, wafting_devotion
2:57.056 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, wafting_devotion
2:58.072 aoe Q starfall Fluffy_Pillow 69.0/100: 69% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, wafting_devotion
2:59.050 aoe Q starfall Fluffy_Pillow 40.0/100: 40% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion
2:59.991 aoe R starfire Fluffy_Pillow 5.0/100: 5% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion
3:01.355 default F natures_vigil phial_of_charged_isolation_3 24.2/100: 24% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion
3:01.355 aoe R starfire Fluffy_Pillow 24.2/100: 24% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion
3:02.716 aoe R starfire Fluffy_Pillow 49.4/100: 49% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion
3:04.077 aoe L starfall Fluffy_Pillow 70.6/100: 71% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion
3:04.988 aoe O wrath Fluffy_Pillow 37.6/100: 38% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static
3:05.968 aoe O wrath Fluffy_Pillow 47.6/100: 48% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(3), starlord(3), dreamstate, best_friends_with_aerwynn_static
3:06.722 aoe M starfire Fluffy_Pillow 57.6/100: 58% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static
3:07.693 aoe L starfall Fluffy_Pillow 82.8/100: 83% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall, starlord(3), best_friends_with_aerwynn_static
3:08.769 aoe N incarnation_chosen_of_elune Fluffy_Pillow 41.8/100: 42% astral_power natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static
3:08.769 default E use_items Fluffy_Pillow 41.8/100: 42% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), dreamstate(2), best_friends_with_aerwynn_static
3:08.769 aoe R starfire Fluffy_Pillow 41.8/100: 42% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), dreamstate, best_friends_with_aerwynn_static, kindled_soul(100)
3:09.651 aoe L starfall Fluffy_Pillow 69.0/100: 69% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), dreamstate, best_friends_with_aerwynn_static, kindled_soul(100)
3:10.629 aoe R starfire Fluffy_Pillow 68.0/100: 68% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, kindled_soul(95)
3:11.510 aoe K cancel_buff Fluffy_Pillow 93.2/100: 93% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, kindled_soul(90)
3:11.510 aoe L starfall Fluffy_Pillow 93.2/100: 93% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, kindled_soul(90)
3:12.606 aoe Q starfall Fluffy_Pillow 64.2/100: 64% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, kindled_soul(85)
3:13.660 aoe R starfire Fluffy_Pillow 33.2/100: 33% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starfall(4), starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, kindled_soul(80)
3:15.180 aoe Q starfall Fluffy_Pillow 58.4/100: 58% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, kindled_soul(70)
3:16.195 aoe R starfire Fluffy_Pillow 23.4/100: 23% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, kindled_soul(65)
3:17.663 aoe P fury_of_elune Fluffy_Pillow 44.6/100: 45% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, kindled_soul(60)
3:18.642 aoe R starfire Fluffy_Pillow 47.6/100: 48% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, kindled_soul(55)
3:20.110 aoe R starfire Fluffy_Pillow 77.8/100: 78% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, kindled_soul(45)
3:21.578 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), starfall, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, kindled_soul(40)
3:22.559 aoe R starfire Fluffy_Pillow 73.0/100: 73% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, kindled_soul(35)
3:24.026 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, kindled_soul(25)
3:25.006 aoe R starfire Fluffy_Pillow 73.0/100: 73% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, kindled_soul(20)
3:26.473 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, kindled_soul(15)
3:26.473 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, kindled_soul(15)
3:27.567 aoe Q starfall Fluffy_Pillow 69.0/100: 69% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, kindled_soul(10)
3:28.621 aoe Q starfall Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, kindled_soul(5)
3:29.636 aoe R starfire Fluffy_Pillow 7.0/100: 7% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(11), best_friends_with_urctos_static
3:31.103 aoe R starfire Fluffy_Pillow 62.2/100: 62% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(10), best_friends_with_urctos_static
3:32.570 aoe L starfall Fluffy_Pillow 93.4/100: 93% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static
3:33.549 aoe R starfire Fluffy_Pillow 58.4/100: 58% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(7), best_friends_with_urctos_static
3:35.017 aoe R starfire Fluffy_Pillow 79.6/100: 80% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(6), best_friends_with_urctos_static
3:36.485 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(4), best_friends_with_urctos_static
3:37.464 aoe R starfire Fluffy_Pillow 65.0/100: 65% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(3), best_friends_with_urctos_static
3:38.931 aoe L starfall Fluffy_Pillow 84.2/100: 84% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(2), best_friends_with_urctos_static
3:39.911 aoe R starfire Fluffy_Pillow 49.2/100: 49% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos, best_friends_with_urctos_static
3:41.379 aoe R starfire Fluffy_Pillow 70.4/100: 70% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:42.846 aoe L starfall Fluffy_Pillow 93.6/100: 94% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:43.943 aoe Q starfall Fluffy_Pillow 58.6/100: 59% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:44.996 aoe R starfire Fluffy_Pillow 25.6/100: 26% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(2), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:46.517 aoe Q starfall Fluffy_Pillow 48.8/100: 49% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:47.533 aoe R starfire Fluffy_Pillow 15.8/100: 16% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:49.001 aoe R starfire Fluffy_Pillow 35.0/100: 35% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(11), best_friends_with_urctos_static
3:50.469 aoe O wrath Fluffy_Pillow 58.2/100: 58% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(10), best_friends_with_urctos_static
3:51.448 aoe L starfall Fluffy_Pillow 72.2/100: 72% astral_power primordial_arcanic_pulsar(40), starfall(2), starlord(3), dreamstate(2), best_friends_with_urctos(9), best_friends_with_urctos_static
3:52.526 aoe O wrath Fluffy_Pillow 29.2/100: 29% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(3), dreamstate, best_friends_with_urctos(8), best_friends_with_urctos_static
3:53.282 aoe R starfire Fluffy_Pillow 41.2/100: 41% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), best_friends_with_urctos(7), best_friends_with_urctos_static
3:54.252 aoe R starfire Fluffy_Pillow 64.4/100: 64% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(3), best_friends_with_urctos(6), best_friends_with_urctos_static
3:55.866 aoe K cancel_buff Fluffy_Pillow 89.6/100: 90% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), best_friends_with_urctos(4), best_friends_with_urctos_static
3:55.866 aoe L starfall Fluffy_Pillow 89.6/100: 90% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, best_friends_with_urctos(4), best_friends_with_urctos_static
3:57.074 aoe L starfall Fluffy_Pillow 48.6/100: 49% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, best_friends_with_urctos(3), best_friends_with_urctos_static
3:58.233 aoe R starfire Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(2), best_friends_with_urctos_static
3:59.903 aoe Q starfall Fluffy_Pillow 64.8/100: 65% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static
4:01.021 aoe R starfire Fluffy_Pillow 25.8/100: 26% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static
4:02.489 aoe R starfire Fluffy_Pillow 51.0/100: 51% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static
4:03.957 aoe R starfire Fluffy_Pillow 78.2/100: 78% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static
4:05.425 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static
4:06.404 aoe R starfire Fluffy_Pillow 69.0/100: 69% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static
4:07.871 aoe L starfall Fluffy_Pillow 94.2/100: 94% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static
4:08.851 aoe R starfire Fluffy_Pillow 59.2/100: 59% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
4:10.318 aoe K cancel_buff Fluffy_Pillow 78.4/100: 78% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
4:10.318 aoe L starfall Fluffy_Pillow 78.4/100: 78% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
4:11.416 aoe O wrath Fluffy_Pillow 43.4/100: 43% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
4:12.470 aoe O wrath Fluffy_Pillow 55.4/100: 55% astral_power primordial_arcanic_pulsar(15), starfall(3), starlord, dreamstate, best_friends_with_pip(11), best_friends_with_pip_static
4:13.225 aoe Q starfall Fluffy_Pillow 65.4/100: 65% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord, dreamstate, best_friends_with_pip(10), best_friends_with_pip_static
4:14.384 aoe R starfire Fluffy_Pillow 28.4/100: 28% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_pip(9), best_friends_with_pip_static
4:15.389 aoe L starfall Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_pip(8), best_friends_with_pip_static
4:16.505 aoe R starfire Fluffy_Pillow 40.6/100: 41% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(7), best_friends_with_pip_static
4:18.119 aoe P fury_of_elune Fluffy_Pillow 63.8/100: 64% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(5), best_friends_with_pip_static
4:19.198 aoe L starfall Fluffy_Pillow 73.8/100: 74% astral_power balance_of_all_things_arcane(2), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(4), best_friends_with_pip_static
4:20.276 aoe R starfire Fluffy_Pillow 38.8/100: 39% astral_power balance_of_all_things_arcane, eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(3), best_friends_with_pip_static
4:21.890 aoe R starfire Fluffy_Pillow 71.0/100: 71% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip, best_friends_with_pip_static
4:23.505 aoe K cancel_buff Fluffy_Pillow 99.2/100: 99% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static
4:23.505 aoe L starfall Fluffy_Pillow 99.2/100: 99% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), starfall, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static
4:24.711 aoe Q starfall Fluffy_Pillow 65.2/100: 65% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(35), starfall(2), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static
4:25.869 aoe R starfire Fluffy_Pillow 28.2/100: 28% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(40), starfall(3), starlord(2), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static
4:27.543 aoe O wrath Fluffy_Pillow 52.4/100: 52% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static
4:28.659 aoe O wrath Fluffy_Pillow 62.4/100: 62% astral_power primordial_arcanic_pulsar(40), starfall(2), starlord(2), dreamstate, best_friends_with_pip_static
4:29.413 aoe L starfall Fluffy_Pillow 72.4/100: 72% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(40), solstice, starfall(2), starlord(2), umbral_embrace, dreamstate, best_friends_with_pip_static
4:30.530 aoe R starfire Fluffy_Pillow 33.4/100: 33% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_pip_static
4:31.500 default F natures_vigil phial_of_charged_isolation_3 58.6/100: 59% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static
4:31.500 aoe R starfire Fluffy_Pillow 58.6/100: 59% astral_power natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static
4:33.113 aoe L starfall Fluffy_Pillow 83.8/100: 84% astral_power natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static
4:34.191 aoe R starfire Fluffy_Pillow 42.8/100: 43% astral_power natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static
4:35.806 aoe R starfire Fluffy_Pillow 66.0/100: 66% astral_power natures_vigil, balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(50), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static
4:37.421 aoe K cancel_buff Fluffy_Pillow 85.2/100: 85% astral_power natures_vigil, eclipse_lunar, primordial_arcanic_pulsar(50), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static
4:37.421 aoe L starfall Fluffy_Pillow 85.2/100: 85% astral_power natures_vigil, eclipse_lunar, primordial_arcanic_pulsar(50), starfall(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static
4:38.627 aoe R starfire Fluffy_Pillow 40.2/100: 40% astral_power natures_vigil, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static
4:40.364 aoe Q starfall Fluffy_Pillow 63.4/100: 63% astral_power natures_vigil, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static
4:41.524 default E use_items Fluffy_Pillow 22.4/100: 22% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static
4:41.524 aoe R starfire Fluffy_Pillow 22.4/100: 22% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, kindled_soul(100)
4:43.046 aoe Q starfall Fluffy_Pillow 77.6/100: 78% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, kindled_soul(95)
4:44.062 aoe R starfire Fluffy_Pillow 46.6/100: 47% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(90)
4:45.530 aoe R starfire Fluffy_Pillow 75.8/100: 76% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(80)
4:46.996 aoe L starfall Fluffy_Pillow 99.0/100: 99% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(75)
4:47.975 aoe R starfire Fluffy_Pillow 68.0/100: 68% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(70)
4:49.441 aoe L starfall Fluffy_Pillow 89.2/100: 89% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(65)
4:50.420 aoe R starfire Fluffy_Pillow 54.2/100: 54% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(60)
4:51.889 aoe K cancel_buff Fluffy_Pillow 77.4/100: 77% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(50)
4:51.889 aoe L starfall Fluffy_Pillow 77.4/100: 77% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, kindled_soul(50)
4:52.984 aoe O wrath Fluffy_Pillow 44.4/100: 44% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord, dreamstate, best_friends_with_pip_static, kindled_soul(45)
4:53.737 aoe O wrath Fluffy_Pillow 56.4/100: 56% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord, best_friends_with_pip_static, kindled_soul(40)
4:54.491 aoe Q starfall Fluffy_Pillow 70.4/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord, best_friends_with_pip_static, wafting_devotion, kindled_soul(40)
4:55.567 aoe R starfire Fluffy_Pillow 29.4/100: 29% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, wafting_devotion, kindled_soul(30)
4:57.119 aoe Q starfall Fluffy_Pillow 52.6/100: 53% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, wafting_devotion, kindled_soul(25)
4:58.154 aoe R starfire Fluffy_Pillow 11.6/100: 12% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion, kindled_soul(20)
4:59.652 aoe R starfire Fluffy_Pillow 70.8/100: 71% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion, kindled_soul(10)
5:01.150 aoe L starfall Fluffy_Pillow 92.0/100: 92% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion, kindled_soul(5)
5:02.150 aoe R starfire Fluffy_Pillow 49.0/100: 49% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion
5:03.648 aoe L starfall Fluffy_Pillow 72.2/100: 72% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion
5:04.647 aoe R starfire Fluffy_Pillow 29.2/100: 29% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, wafting_devotion
5:06.145 default D potion Fluffy_Pillow 48.4/100: 48% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, wafting_devotion
5:06.240 aoe R starfire Fluffy_Pillow 48.4/100: 48% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, wafting_devotion, elemental_potion_of_ultimate_power
5:07.737 aoe L starfall Fluffy_Pillow 73.6/100: 74% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, wafting_devotion, elemental_potion_of_ultimate_power
5:08.859 aoe O wrath Fluffy_Pillow 30.6/100: 31% astral_power eclipse_lunar, owlkin_frenzy, primordial_arcanic_pulsar(45), starfall(3), starlord, balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, elemental_potion_of_ultimate_power
5:09.934 aoe O wrath Fluffy_Pillow 42.6/100: 43% astral_power owlkin_frenzy, primordial_arcanic_pulsar(45), starfall(2), starlord, dreamstate, best_friends_with_pip_static, elemental_potion_of_ultimate_power
5:10.690 aoe Q starfall Fluffy_Pillow 52.6/100: 53% astral_power balance_of_all_things_arcane(8), eclipse_lunar, owlkin_frenzy, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord, dreamstate, best_friends_with_pip_static, elemental_potion_of_ultimate_power
5:11.850 aoe R starfire Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_arcane(7), eclipse_lunar, owlkin_frenzy, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, elemental_potion_of_ultimate_power
5:12.604 aoe R starfire Fluffy_Pillow 36.8/100: 37% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, elemental_potion_of_ultimate_power
5:14.277 aoe Q starfall Fluffy_Pillow 64.0/100: 64% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, elemental_potion_of_ultimate_power
5:15.393 aoe R starfire Fluffy_Pillow 23.0/100: 23% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, elemental_potion_of_ultimate_power
5:17.006 aoe R starfire Fluffy_Pillow 46.2/100: 46% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, elemental_potion_of_ultimate_power
5:18.619 aoe R starfire Fluffy_Pillow 71.4/100: 71% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, elemental_potion_of_ultimate_power
5:20.232 aoe L starfall Fluffy_Pillow 90.6/100: 91% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall, starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, elemental_potion_of_ultimate_power
5:21.309 aoe K cancel_buff Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, elemental_potion_of_ultimate_power
5:21.309 aoe L starfall Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, elemental_potion_of_ultimate_power
5:22.404 aoe P fury_of_elune Fluffy_Pillow 50.6/100: 51% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn, best_friends_with_aerwynn_static, elemental_potion_of_ultimate_power
5:23.460 aoe Q starfall Fluffy_Pillow 60.6/100: 61% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, elemental_potion_of_ultimate_power
5:24.514 aoe Q starfall Fluffy_Pillow 35.6/100: 36% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_potion_of_ultimate_power
5:25.529 aoe R starfire Fluffy_Pillow 10.6/100: 11% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_potion_of_ultimate_power
5:26.996 aoe R starfire Fluffy_Pillow 44.8/100: 45% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_potion_of_ultimate_power
5:28.464 aoe L starfall Fluffy_Pillow 75.0/100: 75% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_potion_of_ultimate_power
5:29.444 aoe R starfire Fluffy_Pillow 48.0/100: 48% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, owlkin_frenzy, primordial_arcanic_pulsar(20), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_potion_of_ultimate_power
5:30.425 aoe L starfall Fluffy_Pillow 75.2/100: 75% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_potion_of_ultimate_power
5:31.404 aoe O wrath Fluffy_Pillow 42.2/100: 42% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (tauren) Raid-Buffed Unbuffed Gear Amount
Strength 898 2 986 900 0
Agility 2089 -2 2173 2087 0
Stamina 3848 2 44833 42698 38825
Intellect 2089 -2 16466 14885 12090 (7538)
Spirit 0 0 0 0 0
Health 896660 896660 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 16466 14885 0
Crit 22.30% 22.30% 3114
Haste 24.78% 24.78% 4212
Versatility 6.30% 1.30% 267
Mana Regen 2560 2560 0
Attack Power 17125 15480 0
Mastery 30.74% 30.74% 8152
Armor 5324 5324 5324
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 489.00
Local Head Benevolent Embersage's Casque
ilevel: 489, stats: { 673 Armor, +3966 Sta, +704 Crit, +330 Haste, +938 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }, enchant: incandescent_essence
Local Neck Eye of the Rising Flame
ilevel: 489, stats: { +2231 Sta, +256 Haste, +1537 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Life-Bound Shoulderpads
ilevel: 486, stats: { 603 Armor, +2875 Sta, +383 Mastery, +383 Haste, +684 AgiInt }
item effects: { equip: Toxified }
Local Chest Benevolent Embersage's Robe
ilevel: 489, stats: { 897 Armor, +3966 Sta, +715 Crit, +318 Mastery, +938 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 489, stats: { 505 Armor, +2975 Sta, +535 Haste, +241 Mastery, +704 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 489, stats: { 785 Armor, +3966 Sta, +705 Haste, +328 Mastery, +938 AgiInt }, enchant: { +155 StrAgiInt, +41 Vers (lambent_armor_kit_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 486, stats: { 548 Armor, +2875 Sta, +274 Crit, +438 Haste, +684 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Thermal Bindings
ilevel: 489, stats: { 449 Armor, +2231 Sta, +191 Crit, +390 Mastery, +528 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Benevolent Embersage's Talons
ilevel: 489, stats: { 505 Armor, +2975 Sta, +226 Vers, +549 Mastery, +704 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 489, stats: { +2231 Sta, +512 Haste, +1281 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 489, stats: { +2231 Sta, +1230 Crit, +564 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 489, stats: { +892 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 489, stats: { +738 Mastery }
item effects: { use: Balefire Branch }
Local Back Drape of the Loyal Vassal
ilevel: 489, stats: { 359 Armor, +2231 Sta, +328 Haste, +253 Mastery, +528 StrAgiInt }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 489, weapon: { 606 - 781, 2.6 }, stats: { +469 Int, +2264 Int, +1983 Sta, +156 Haste, +361 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 489, stats: { +1439 Int, +1983 Sta, +174 Haste, +343 Mastery }

Profile

druid="phial_of_charged_isolation_3"
source=default
spec=balance
level=70
race=tauren
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_charged_isolation_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:hissing_rune_3

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=489,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=489,gem_id=192961/192961/192961
shoulders=lifebound_shoulderpads,id=193406,bonus_id=8836/1576/8797/8960,ilevel=486,crafted_stats=49/36
back=drape_of_the_loyal_vassal,id=158375,bonus_id=4795,ilevel=489
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=489,enchant_id=6625
wrists=thermal_bindings,id=134461,bonus_id=4795,ilevel=489,gem_id=192961
hands=benevolent_embersages_talons,id=207255,bonus_id=4795,ilevel=489
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=489,enchant_id=6830
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=486
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=489
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=489
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=489,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=489

# Gear Summary
# gear_ilvl=488.63
# gear_stamina=38825
# gear_intellect=12090
# gear_crit_rating=3114
# gear_haste_rating=4212
# gear_mastery_rating=8152
# gear_versatility_rating=267
# gear_armor=5324
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

phial_of_corrupting_rage_3 : 940742 dps, 171685 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
940741.8 940741.8 468.1 / 0.050% 87811.7 / 9.3% 68263.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.8 13.9 Astral Power 0.00% 56.4 100.1% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
phial_of_corrupting_rage_3 940742
Astral Smolder 141443 15.0% 387.6 0.83s 109177 0 Periodic 748.0 56576 0 56576 0.0% 83.2%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 387.62 0.00 748.01 748.01 302.99 0.0000 2.0000 42319243.33 42319243.33 0.00% 28288.02 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 748.01 548 945 56576.28 4695 279511 56656.10 48884 68449 42319243 42319243 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Fury of Elune 28427 3.0% 5.1 65.10s 1659879 1717691 Direct 764.5 6908 14726 11123 53.9%

Stats Details: Fury Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.12 764.48 0.00 0.00 0.00 0.9665 0.0000 8502568.21 8502568.21 0.00% 1717690.55 1717690.55
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 46.09% 352.36 214 519 6908.13 3321 22203 6915.68 5902 8024 2433886 2433886 0.00%
crit 53.91% 412.12 276 608 14726.36 6774 45295 14738.34 13146 16690 6068682 6068682 0.00%

Action Details: Fury Of Elune

  • id:202770
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:astral_power
  • energize_amount:3.0

Spelldata

  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r

Action Details: Fury Of Elune Tick

  • id:211545
  • school:astral
  • range:105.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.149000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:211545
  • name:Fury of Elune
  • school:astral
  • tooltip:
  • description:{$@spelldesc202770=Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r}

Action Priority List

    aoe
    [P]:5.12
  • if_expr:target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Hungering Shadowflame 3852 0.4% 17.1 16.55s 67510 0 Direct 17.1 51988 105997 67518 28.8%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.10 17.10 0.00 0.00 0.00 0.0000 0.0000 1154158.70 1154158.70 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.25% 12.18 3 27 51987.82 34936 202233 51858.68 34936 129781 633134 633134 0.00%
crit 28.75% 4.92 0 15 105997.00 71270 412555 104436.37 0 384444 521025 521025 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:31299.68
  • base_dd_max:31299.68
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 7087 0.8% 34.1 8.55s 62276 0 Direct 34.0 48097 98031 62456 28.8%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.09 33.99 0.00 0.00 0.00 0.0000 0.0000 2123131.34 2123131.34 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.24% 24.22 9 46 48097.20 47503 54996 48097.12 47503 50263 1164718 1164718 0.00%
crit 28.76% 9.78 1 24 98031.00 96907 112191 98029.72 96907 104367 958413 958413 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42559.30
  • base_dd_max:42559.30
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 77574 8.3% 3.0 1.07s 7744230 8408502 Direct 6.0 7016 14300 10636 49.7%
Periodic 1821.9 8784 18127 12717 42.1% 99.2%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.00 6.00 1821.90 1821.90 0.00 0.9211 0.9790 23232689.71 23232689.71 0.00% 13005.68 8408501.52
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 50.31% 3.02 0 6 7016.01 6922 8153 6913.73 0 8153 21176 21176 0.00%
crit 49.69% 2.98 0 6 14299.55 14121 16633 14067.55 0 16633 42637 42637 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 57.90% 1054.92 778 1341 8783.64 6693 14129 8783.51 8554 9055 9265921 9265921 0.00%
crit 42.10% 766.98 563 997 18127.13 13655 28822 18130.15 17552 18727 13902955 13902955 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    aoe
    [J]:3.00
  • if_expr:!fight_style.dungeonroute
  • target_if_expr:refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (82135) 0.0% (8.7%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 20299 2.2% 235.9 1.47s 25758 0 Direct 235.3 16201 34763 25824 51.8%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 235.94 235.34 0.00 0.00 0.00 0.0000 0.0000 6077375.58 6077375.58 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.16% 113.33 64 167 16200.53 11191 30548 16207.74 15102 17560 1835936 1835936 0.00%
crit 51.84% 122.01 75 172 34763.49 22829 62318 34791.71 32788 37509 4241440 4241440 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy5
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 20382 2.2% 237.7 1.47s 25671 0 Direct 237.1 16145 34658 25737 51.8%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 237.68 237.07 0.00 0.00 0.00 0.0000 0.0000 6101399.91 6101399.91 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.19% 114.23 64 168 16145.00 10069 30548 16151.04 15059 17441 1844283 1844283 0.00%
crit 51.81% 122.83 72 175 34657.72 20540 62318 34685.39 32358 37468 4257117 4257117 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 41454 4.4% 15.8 19.26s 786192 0 Direct 94.4 82408 177299 131421 51.6%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.78 94.43 0.00 0.00 0.00 0.0000 0.0000 12409737.55 12409737.55 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.35% 45.66 20 75 82407.67 41506 303527 82468.57 62824 105662 3762862 3762862 0.00%
crit 51.65% 48.77 22 81 177298.88 84672 619384 177431.71 131803 226416 8646876 8646876 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:enemy5
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfall 314156 33.4% 104.8 2.84s 897042 886733 Direct 1768.1 34828 75082 53158 45.5%

Stats Details: Starfall

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 104.78 1768.10 0.00 0.00 0.00 1.0116 0.0000 93989221.82 93989221.82 0.00% 886732.60 886732.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.46% 962.93 679 1260 34827.89 7656 132157 34905.95 31933 38745 33536256 33536256 0.00%
crit 45.54% 805.17 591 1033 75082.10 15618 264950 75220.75 69333 83871 60452966 60452966 0.00%

Action Details: Starfall

  • id:191034
  • school:astral
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:45.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]

Action Details: Starfall Damage

  • id:191037
  • school:astral
  • range:200.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.114000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.41

Spelldata

  • id:191037
  • name:Starfall
  • school:astral
  • tooltip:
  • description:{$@spelldesc191034=Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]}

Action Priority List

    aoe
    [L]:70.59
  • if_expr:variable.starfall_condition1
    aoe
    [Q]:34.19
  • if_expr:variable.starfall_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountLunar Shrapnel4151691PCT0.200
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 209710 22.3% 117.9 2.50s 532581 381861 Direct 713.1 54593 117832 88019 52.9%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.85 713.11 0.00 0.00 0.00 1.3947 0.0000 62765353.12 62765353.12 0.00% 381861.04 381861.04
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 47.14% 336.19 236 480 54593.48 7504 244124 54612.39 48225 63700 18352809 18352809 0.00%
crit 52.86% 376.92 263 491 117832.28 15308 503724 117893.87 104799 133967 44412544 44412544 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    aoe
    [M]:1.27
  • if_expr:buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
    aoe
    [R]:117.11
  • if_expr:spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Solar)4851710.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Sunfire16481550.283Mastery
Sunfire 65009 6.9% 1.0 0.00s 19454975 20964413 Direct 1.0 5507 11233 7212 29.8%
Periodic 1834.8 7390 15771 10600 38.3% 99.9%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 1834.78 1834.78 0.00 0.9285 0.9786 19454975.26 19454975.26 0.00% 10829.44 20964412.99
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 70.22% 0.70 0 1 5506.51 5472 5544 3866.61 0 5544 3867 3867 0.00%
crit 29.78% 0.30 0 1 11233.26 11163 11309 3345.36 0 11309 3345 3345 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 61.70% 1132.12 847 1432 7389.67 5532 12844 7393.36 7137 7667 8365852 8365852 0.00%
crit 38.30% 702.66 506 911 15771.43 11285 26202 15780.68 15183 16456 11081912 11081912 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    aoe
    [I]:1.00
  • target_if_expr:refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (7051) 0.0% (0.8%) 8.4 33.33s 251265 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.41 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 3686 0.4% 8.4 33.33s 131334 0 Direct 50.4 16860 34361 21889 28.7%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.41 50.44 0.00 0.00 0.00 0.0000 0.0000 1104062.86 1104062.86 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.26% 35.95 7 93 16860.23 16647 19272 16859.05 16647 18166 606042 606042 0.00%
crit 28.74% 14.49 0 42 34361.05 33959 39316 34359.16 0 38423 498021 498021 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:51134.41
  • base_dd_max:51134.41
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 3365 0.4% 16.1 16.27s 62442 0 Direct 96.9 8021 16351 10407 28.6%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.15 96.88 0.00 0.00 0.00 0.0000 0.0000 1008198.42 1008198.42 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.36% 69.13 11 178 8021.06 7921 9170 8020.33 7921 8738 554480 554480 0.00%
crit 28.64% 27.75 3 71 16351.00 16159 18707 16352.46 16159 17943 453718 453718 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24330.91
  • base_dd_max:24330.91
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 4298 0.5% 26.5 10.33s 48893 63474 Direct 26.3 34552 70408 49162 40.7%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.48 26.33 0.00 0.00 0.00 0.7703 0.0000 1294496.75 1294496.75 0.00% 63474.39 63474.39
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.25% 15.60 4 27 34551.58 15177 67321 34475.32 22362 42860 539076 539076 0.00%
crit 40.75% 10.73 1 23 70408.04 30962 134215 70249.93 38137 102320 755420 755420 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    aoe
    [O]:24.55
  • if_expr:!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.800Spell Data
Eclipse (Solar)4851710.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Lunar)4851810.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
phial_of_corrupting_rage_3
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_corrupting_rage_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_corrupting_rage_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_corrupting_rage_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 180.95s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    aoe
    [N]:2.00
  • if_expr:variable.cd_condition_aoe

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.2 67.82s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.22 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_corrupting_rage_3
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:70932.17
  • base_dd_max:70932.17
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.43s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_corrupting_rage_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.74
Elemental Potion of Ultimate Power 1.4 305.68s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.44 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.44
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 17.4 6.0 17.7s 13.4s 9.6s 55.86% 57.87% 6.0 (20.6) 16.8

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.3s
  • trigger_min/max:0.0s / 37.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.6s
  • uptime_min/max:51.01% / 59.27%

Stack Uptimes

  • balance_of_all_things_arcane_1:5.73%
  • balance_of_all_things_arcane_2:6.12%
  • balance_of_all_things_arcane_3:6.62%
  • balance_of_all_things_arcane_4:7.04%
  • balance_of_all_things_arcane_5:7.33%
  • balance_of_all_things_arcane_6:7.56%
  • balance_of_all_things_arcane_7:7.69%
  • balance_of_all_things_arcane_8:7.77%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 10.2 0.0 29.8s 29.7s 7.9s 27.19% 30.45% 0.0 (0.0) 10.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 46.8s
  • trigger_min/max:3.7s / 46.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:24.60% / 30.00%

Stack Uptimes

  • balance_of_all_things_nature_1:3.36%
  • balance_of_all_things_nature_2:3.37%
  • balance_of_all_things_nature_3:3.39%
  • balance_of_all_things_nature_4:3.40%
  • balance_of_all_things_nature_5:3.41%
  • balance_of_all_things_nature_6:3.41%
  • balance_of_all_things_nature_7:3.42%
  • balance_of_all_things_nature_8:3.43%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 15.1 86.4 20.2s 2.9s 17.5s 88.20% 0.00% 35.4 (35.4) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 60.5s
  • trigger_min/max:0.8s / 13.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:82.38% / 92.83%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:13.36%
  • balance_t31_4pc_buff_lunar_2:13.65%
  • balance_t31_4pc_buff_lunar_3:13.96%
  • balance_t31_4pc_buff_lunar_4:11.78%
  • balance_t31_4pc_buff_lunar_5:35.46%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 8.2 57.1 38.0s 4.4s 18.9s 51.98% 0.00% 26.4 (26.4) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.3s / 84.6s
  • trigger_min/max:0.8s / 39.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:45.88% / 59.61%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:7.43%
  • balance_t31_4pc_buff_solar_2:6.46%
  • balance_t31_4pc_buff_solar_3:6.30%
  • balance_t31_4pc_buff_solar_4:6.43%
  • balance_t31_4pc_buff_solar_5:25.36%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 70.1s 70.1s 10.8s 10.05% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 316.1s
  • trigger_min/max:12.0s / 316.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 34.26%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.90%
  • best_friends_with_aerwynn_2:0.90%
  • best_friends_with_aerwynn_3:0.90%
  • best_friends_with_aerwynn_4:0.91%
  • best_friends_with_aerwynn_5:0.91%
  • best_friends_with_aerwynn_6:0.91%
  • best_friends_with_aerwynn_7:0.92%
  • best_friends_with_aerwynn_8:0.92%
  • best_friends_with_aerwynn_9:0.92%
  • best_friends_with_aerwynn_10:0.93%
  • best_friends_with_aerwynn_11:0.93%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 113.6s 70.1s 45.0s 32.96% 0.00% 68.9 (68.9) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 346.9s
  • trigger_min/max:12.0s / 316.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 288.2s
  • uptime_min/max:0.00% / 98.98%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:32.96%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.0s 70.0s 10.8s 10.16% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 337.7s
  • trigger_min/max:12.0s / 337.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 35.45%

Stack Uptimes

  • best_friends_with_pip_1:0.91%
  • best_friends_with_pip_2:0.91%
  • best_friends_with_pip_3:0.91%
  • best_friends_with_pip_4:0.92%
  • best_friends_with_pip_5:0.92%
  • best_friends_with_pip_6:0.92%
  • best_friends_with_pip_7:0.93%
  • best_friends_with_pip_8:0.93%
  • best_friends_with_pip_9:0.93%
  • best_friends_with_pip_10:0.94%
  • best_friends_with_pip_11:0.94%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 114.2s 70.0s 45.6s 33.66% 0.00% 70.4 (70.4) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 345.0s
  • trigger_min/max:12.0s / 337.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 356.7s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.66%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 69.6s 69.6s 10.8s 10.10% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 324.7s
  • trigger_min/max:12.0s / 324.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 36.48%

Stack Uptimes

  • best_friends_with_urctos_1:0.90%
  • best_friends_with_urctos_2:0.91%
  • best_friends_with_urctos_3:0.91%
  • best_friends_with_urctos_4:0.91%
  • best_friends_with_urctos_5:0.92%
  • best_friends_with_urctos_6:0.92%
  • best_friends_with_urctos_7:0.92%
  • best_friends_with_urctos_8:0.92%
  • best_friends_with_urctos_9:0.93%
  • best_friends_with_urctos_10:0.93%
  • best_friends_with_urctos_11:0.93%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 112.8s 69.6s 45.3s 33.38% 0.00% 69.9 (69.9) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.1s / 350.9s
  • trigger_min/max:12.0s / 324.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 305.9s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.38%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 61.9s 58.2s 50.0s 80.16% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 335.0s
  • trigger_min/max:15.0s / 301.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 355.4s
  • uptime_min/max:39.36% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.16%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dreamstate 15.3 0.0 20.2s 21.3s 2.1s 10.83% 20.62% 0.0 (0.1) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 55.7s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.7s
  • uptime_min/max:7.18% / 15.25%

Stack Uptimes

  • dreamstate_1:7.37%
  • dreamstate_2:3.46%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 13.3 8.1 23.6s 14.8s 21.0s 93.10% 93.81% 8.1 (8.1) 12.4

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.6s / 71.9s
  • trigger_min/max:0.0s / 58.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.0s
  • uptime_min/max:89.49% / 95.97%

Stack Uptimes

  • eclipse_lunar_1:93.10%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 8.2 0.0 38.1s 38.1s 19.1s 52.73% 54.66% 0.0 (0.0) 7.9

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 84.6s
  • trigger_min/max:12.0s / 84.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.87% / 59.94%

Stack Uptimes

  • eclipse_solar_1:52.73%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 305.9s 305.9s 27.4s 12.93% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 325.7s
  • trigger_min/max:300.0s / 325.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.76% / 17.86%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.93%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Fury of Elune 5.1 0.0 65.1s 65.1s 7.9s 13.51% 0.00% 75.8 (75.8) 4.9

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:60.0s / 89.0s
  • trigger_min/max:60.0s / 89.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:10.82% / 15.69%

Stack Uptimes

  • fury_of_elune_1:13.51%

Spelldata

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 8.2 0.0 38.1s 38.1s 19.1s 52.73% 55.37% 0.0 (0.0) 7.9

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 84.6s
  • trigger_min/max:12.0s / 84.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.87% / 59.94%

Stack Uptimes

  • incarnation_chosen_of_elune_1:52.73%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.7 0.0 90.9s 90.9s 19.5s 23.99% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:65.76

Trigger Details

  • interval_min/max:90.0s / 123.1s
  • trigger_min/max:90.0s / 123.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:19.93% / 27.01%

Stack Uptimes

  • kindled_soul_5:1.17%
  • kindled_soul_10:1.18%
  • kindled_soul_15:1.18%
  • kindled_soul_20:1.18%
  • kindled_soul_25:1.18%
  • kindled_soul_30:1.19%
  • kindled_soul_35:1.19%
  • kindled_soul_40:1.19%
  • kindled_soul_45:1.19%
  • kindled_soul_50:1.20%
  • kindled_soul_55:1.20%
  • kindled_soul_60:1.20%
  • kindled_soul_65:1.21%
  • kindled_soul_70:1.21%
  • kindled_soul_75:1.21%
  • kindled_soul_80:1.22%
  • kindled_soul_85:1.22%
  • kindled_soul_90:1.22%
  • kindled_soul_95:1.23%
  • kindled_soul_100:1.23%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Vigil 3.7 0.0 90.4s 90.4s 14.7s 18.41% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.5s
  • trigger_min/max:90.0s / 91.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.52% / 21.03%

Stack Uptimes

  • natures_vigil_1:18.41%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.0 69.8s 69.1s 0.9s 0.76% 1.17% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 339.3s
  • trigger_min/max:0.0s / 339.3s
  • trigger_pct:14.97%
  • duration_min/max:0.0s / 6.4s
  • uptime_min/max:0.00% / 5.63%

Stack Uptimes

  • owlkin_frenzy_1:0.76%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 9.2 96.5 34.0s 34.0s 29.8s 91.36% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:21.0s / 46.5s
  • trigger_min/max:21.0s / 46.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.9s
  • uptime_min/max:87.45% / 94.55%

Stack Uptimes

  • primordial_arcanic_pulsar_5:7.25%
  • primordial_arcanic_pulsar_10:6.74%
  • primordial_arcanic_pulsar_15:7.53%
  • primordial_arcanic_pulsar_20:8.33%
  • primordial_arcanic_pulsar_25:8.64%
  • primordial_arcanic_pulsar_30:8.39%
  • primordial_arcanic_pulsar_35:8.66%
  • primordial_arcanic_pulsar_40:9.05%
  • primordial_arcanic_pulsar_45:9.06%
  • primordial_arcanic_pulsar_50:8.85%
  • primordial_arcanic_pulsar_55:8.87%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 19.8 3.7 15.6s 13.4s 6.7s 44.01% 43.21% 3.7 (3.7) 19.3

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 43.3s
  • trigger_min/max:0.0s / 37.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:40.36% / 46.99%

Stack Uptimes

  • solstice_1:44.01%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starfall 104.8 0.0 143.1s 2.8s 295.9s 98.88% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_starfall
  • max_stacks:20
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:asynchronous
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.8s / 357.2s
  • trigger_min/max:0.7s / 8.4s
  • trigger_pct:99.99%
  • duration_min/max:42.4s / 357.9s
  • uptime_min/max:98.40% / 99.49%

Stack Uptimes

  • starfall_1:5.24%
  • starfall_2:32.50%
  • starfall_3:42.27%
  • starfall_4:15.17%
  • starfall_5:3.34%
  • starfall_6:0.37%
  • starfall_7:0.00%

Spelldata

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]
  • max_stacks:20
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Starlord 21.0 83.8 14.5s 2.8s 13.9s 97.48% 0.00% 42.5 (42.5) 6.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 19.2s
  • trigger_min/max:0.8s / 8.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:94.84% / 99.44%

Stack Uptimes

  • starlord_1:12.60%
  • starlord_2:17.67%
  • starlord_3:67.21%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Umbral Embrace 23.1 2.7 12.7s 11.3s 1.6s 12.42% 0.00% 2.7 (2.7) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_umbral_embrace
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 53.0s
  • trigger_min/max:0.0s / 53.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.8s
  • uptime_min/max:3.63% / 23.79%

Stack Uptimes

  • umbral_embrace_1:12.42%

Spelldata

  • id:393763
  • name:Umbral Embrace
  • tooltip:Your next Wrath or Starfire cast during an Eclipse deals Astral damage and deals {$=}w1% additional damage.
  • description:{$@spelldesc393760=Dealing Astral damage has a chance to cause your next Wrath or Starfire cast during an Eclipse to become Astral and deal {$s1=25}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Wafting Devotion 4.3 1.2 61.1s 45.3s 16.5s 23.59% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 243.8s
  • trigger_min/max:0.0s / 243.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 73.8s
  • uptime_min/max:5.33% / 58.45%

Stack Uptimes

  • wafting_devotion_1:23.59%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Primordial Arcanic Pulsar 8.3 6.0 10.0 35.2s 23.4s 46.6s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.05% 0.00% 0.61% 0.0s 0.0s 1.1s
Astral Smolder 74.98% 63.25% 85.91% 4.3s 0.0s 49.0s
Incarnation (Total) 52.73% 46.87% 59.94% 19.1s 0.0s 54.0s
Incarnation (Pulsar) 32.45% 29.45% 34.97% 11.8s 0.0s 12.0s
Lunar Eclipse Only 40.36% 33.05% 46.84% 9.2s 0.0s 15.0s
No Eclipse 6.87% 3.92% 10.51% 1.7s 0.0s 4.6s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Fury of Elune5.2630.00028.98426.9586.40874.821

Eclipse Utilization

NoneSolarLunarBoth
Wrath24.48100.0%0.000.0%0.000.0%0.000.0%
Starfire2.452.1%0.000.0%49.8742.0%66.5356.0%
Starfall20.847.0%0.000.0%117.9539.8%157.1953.1%
Fury of Elune15.692.1%0.000.0%142.5718.6%606.2279.3%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
phial_of_corrupting_rage_3
Fury of EluneAstral Power80.75241.885.79%3.000.370.15%
MoonfireAstral Power3.0018.000.43%6.000.000.00%
Orbit BreakerAstral Power15.78471.5211.29%29.872.020.43%
Shooting Stars (Moonfire)Astral Power235.94471.6111.29%2.000.270.06%
Shooting Stars (Sunfire)Astral Power237.68475.0811.37%2.000.270.06%
StarfireAstral Power118.852229.3553.36%18.7634.961.54%
SunfireAstral Power1.006.000.14%6.000.000.00%
WrathAstral Power26.47264.756.34%10.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
phial_of_corrupting_rage_3
StarfallAstral Power 105.154139.08100.00%39.3639.5022707.75
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 896660.0 4265.63 4925.77 3599083.1 698757.3 -38481.5 896660.0
Astral Power 20.0 13.94 13.76 37.9 54.0 0.0 100.0

Statistics & Data Analysis

Fight Length
phial_of_corrupting_rage_3 Fight Length
Count 8905
Mean 299.79
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 34.5409
5th Percentile 245.78
95th Percentile 353.77
( 95th Percentile - 5th Percentile ) 107.99
Mean Distribution
Standard Deviation 0.3660
95.00% Confidence Interval ( 299.07 - 300.50 )
Normalized 95.00% Confidence Interval ( 99.76% - 100.24% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 510
0.1% Error 50997
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1019
DPS
phial_of_corrupting_rage_3 Damage Per Second
Count 8905
Mean 940741.76
Minimum 868479.53
Maximum 1036999.23
Spread ( max - min ) 168519.70
Range [ ( max - min ) / 2 * 100% ] 8.96%
Standard Deviation 22537.3975
5th Percentile 905558.62
95th Percentile 980016.57
( 95th Percentile - 5th Percentile ) 74457.95
Mean Distribution
Standard Deviation 238.8289
95.00% Confidence Interval ( 940273.66 - 941209.85 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2205
0.1 Scale Factor Error with Delta=300 4336020
0.05 Scale Factor Error with Delta=300 17344077
0.01 Scale Factor Error with Delta=300 433601921
Priority Target DPS
phial_of_corrupting_rage_3 Priority Target Damage Per Second
Count 8905
Mean 171685.28
Minimum 151912.65
Maximum 191711.57
Spread ( max - min ) 39798.92
Range [ ( max - min ) / 2 * 100% ] 11.59%
Standard Deviation 5364.3004
5th Percentile 163069.28
95th Percentile 180762.19
( 95th Percentile - 5th Percentile ) 17692.92
Mean Distribution
Standard Deviation 56.8455
95.00% Confidence Interval ( 171573.86 - 171796.69 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3751
0.1 Scale Factor Error with Delta=300 245647
0.05 Scale Factor Error with Delta=300 982585
0.01 Scale Factor Error with Delta=300 24564609
DPS(e)
phial_of_corrupting_rage_3 Damage Per Second (Effective)
Count 8905
Mean 940741.76
Minimum 868479.53
Maximum 1036999.23
Spread ( max - min ) 168519.70
Range [ ( max - min ) / 2 * 100% ] 8.96%
Damage
phial_of_corrupting_rage_3 Damage
Count 8905
Mean 281536612.56
Minimum 221464333.39
Maximum 346321866.06
Spread ( max - min ) 124857532.67
Range [ ( max - min ) / 2 * 100% ] 22.17%
DTPS
phial_of_corrupting_rage_3 Damage Taken Per Second
Count 8905
Mean 4926.39
Minimum 1157.29
Maximum 10556.08
Spread ( max - min ) 9398.79
Range [ ( max - min ) / 2 * 100% ] 95.39%
HPS
phial_of_corrupting_rage_3 Healing Per Second
Count 8905
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
phial_of_corrupting_rage_3 Healing Per Second (Effective)
Count 8905
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
phial_of_corrupting_rage_3 Heal
Count 8905
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
phial_of_corrupting_rage_3 Healing Taken Per Second
Count 8905
Mean 4256.09
Minimum 581.06
Maximum 9814.74
Spread ( max - min ) 9233.67
Range [ ( max - min ) / 2 * 100% ] 108.48%
TMI
phial_of_corrupting_rage_3 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
phial_of_corrupting_rage_3Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
phial_of_corrupting_rage_3 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.44 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.69 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.74 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.aoe
# count action,conditions
0.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
0.00 variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
I 1.00 sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
J 3.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
0.00 variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
K 13.98 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
L 70.59 starfall,if=variable.starfall_condition1
M 1.27 starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
0.00 celestial_alignment,if=variable.cd_condition_aoe
N 2.00 incarnation,if=variable.cd_condition_aoe
0.00 warrior_of_elune
0.00 variable,name=enter_solar,value=spell_targets.starfire<3
0.00 starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
O 24.55 wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
0.00 wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
P 5.12 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
Q 34.19 starfall,if=variable.starfall_condition2
0.00 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+50
0.00 convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 new_moon,if=astral_power.deficit>variable.passive_asp+10
0.00 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
R 117.11 starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
0.00 wrath
S 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFIJJJLMNDEPLLRLRLRLRLRRKLQRQRRRLRLRLRLRKLQRQRRLRLRRLRKLQROOQRRLRLRKLQRQRROOLPRLRRLLRLRRLOORLRQFRQRLRERLRLOORLQRRQRRRLOKLOQRRQRRRLPRLLQRLRLOOLRRKLQRRQRRROLOKRLQRQRRRRLRLOOKLRFLQRRNRRELRLRKLPQQRRLRLRLRKLQRQRRRRLRRKLQRQRLROOLRRKLQRQRRLRLOOLRRLRQRQRRROLOKRLQRQFPRRLRELLKLROORLQRRRKLRQROORL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask phial_of_corrupting_rage_3 0.0/100: 0% astral_power
Pre precombat 1 food phial_of_corrupting_rage_3 0.0/100: 0% astral_power corrupting_rage
Pre precombat 2 augmentation phial_of_corrupting_rage_3 0.0/100: 0% astral_power corrupting_rage
Pre precombat 4 no_cd_talent phial_of_corrupting_rage_3 0.0/100: 0% astral_power corrupting_rage
Pre precombat 5 on_use_trinket phial_of_corrupting_rage_3 0.0/100: 0% astral_power corrupting_rage
Pre precombat 6 on_use_trinket phial_of_corrupting_rage_3 0.0/100: 0% astral_power corrupting_rage
Pre precombat 7 on_use_trinket phial_of_corrupting_rage_3 0.0/100: 0% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 0.0/100: 0% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 10.0/100: 10% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil phial_of_corrupting_rage_3 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.000 aoe I sunfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:00.928 aoe J moonfire Fluffy_Pillow 45.2/100: 45% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:01.858 aoe J moonfire enemy2 55.2/100: 55% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:02.787 aoe J moonfire enemy4 67.2/100: 67% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:03.716 aoe L starfall Fluffy_Pillow 79.2/100: 79% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, solstice, dreamstate, corrupting_rage
0:04.645 aoe M starfire Fluffy_Pillow 40.2/100: 40% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, corrupting_rage
0:05.449 aoe N incarnation_chosen_of_elune Fluffy_Pillow 61.4/100: 61% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, corrupting_rage
0:05.449 default D potion Fluffy_Pillow 61.4/100: 61% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), corrupting_rage
0:05.449 default E use_items Fluffy_Pillow 61.4/100: 61% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power
0:05.449 aoe P fury_of_elune Fluffy_Pillow 61.4/100: 61% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:06.263 aoe L starfall Fluffy_Pillow 70.4/100: 70% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:07.077 aoe L starfall Fluffy_Pillow 45.4/100: 45% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:07.858 aoe R starfire Fluffy_Pillow 51.4/100: 51% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:08.614 aoe L starfall Fluffy_Pillow 82.6/100: 83% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:09.367 aoe R starfire Fluffy_Pillow 54.6/100: 55% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:10.121 aoe L starfall Fluffy_Pillow 85.8/100: 86% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
0:10.877 aoe R starfire Fluffy_Pillow 59.8/100: 60% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(5), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:12.007 aoe L starfall Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
0:12.763 aoe R starfire Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:13.891 aoe L starfall Fluffy_Pillow 89.2/100: 89% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:14.645 aoe R starfire Fluffy_Pillow 54.2/100: 54% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:15.774 aoe R starfire Fluffy_Pillow 73.4/100: 73% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:16.905 aoe K cancel_buff Fluffy_Pillow 96.6/100: 97% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:16.905 aoe L starfall Fluffy_Pillow 96.6/100: 97% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:17.750 aoe Q starfall Fluffy_Pillow 61.6/100: 62% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:18.561 aoe R starfire Fluffy_Pillow 30.6/100: 31% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:19.734 aoe Q starfall Fluffy_Pillow 51.8/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:20.517 aoe R starfire Fluffy_Pillow 20.8/100: 21% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(11), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:21.646 aoe R starfire Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:22.776 aoe R starfire Fluffy_Pillow 63.2/100: 63% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:23.904 aoe L starfall Fluffy_Pillow 84.4/100: 84% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:24.658 aoe R starfire Fluffy_Pillow 49.4/100: 49% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:25.787 aoe L starfall Fluffy_Pillow 70.6/100: 71% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:26.541 aoe R starfire Fluffy_Pillow 69.6/100: 70% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:27.669 aoe L starfall Fluffy_Pillow 98.8/100: 99% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:28.425 aoe R starfire Fluffy_Pillow 69.8/100: 70% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:29.554 aoe L starfall Fluffy_Pillow 93.0/100: 93% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:30.310 aoe R starfire Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:31.439 aoe K cancel_buff Fluffy_Pillow 95.2/100: 95% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:31.439 aoe L starfall Fluffy_Pillow 95.2/100: 95% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:32.281 aoe Q starfall Fluffy_Pillow 64.2/100: 64% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:33.094 aoe R starfire Fluffy_Pillow 33.2/100: 33% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(5), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:34.264 aoe Q starfall Fluffy_Pillow 54.4/100: 54% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:35.046 aoe R starfire Fluffy_Pillow 21.4/100: 21% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
0:36.175 aoe R starfire Fluffy_Pillow 42.6/100: 43% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:37.223 aoe L starfall Fluffy_Pillow 65.8/100: 66% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:37.980 aoe R starfire Fluffy_Pillow 30.8/100: 31% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(11), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:39.027 aoe L starfall Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(10), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:39.781 aoe R starfire Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:40.832 aoe R starfire Fluffy_Pillow 70.2/100: 70% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(8), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:42.194 aoe L starfall Fluffy_Pillow 93.4/100: 93% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(7), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:43.104 aoe R starfire Fluffy_Pillow 62.4/100: 62% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(6), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:44.467 aoe K cancel_buff Fluffy_Pillow 83.6/100: 84% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:44.467 aoe L starfall Fluffy_Pillow 83.6/100: 84% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:45.483 aoe Q starfall Fluffy_Pillow 50.6/100: 51% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:46.461 aoe R starfire Fluffy_Pillow 17.6/100: 18% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:47.872 aoe O wrath Fluffy_Pillow 33.6/100: 34% astral_power primordial_arcanic_pulsar(50), starfall(3), starlord(2), dreamstate, best_friends_with_pip, best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:48.628 aoe O wrath Fluffy_Pillow 45.6/100: 46% astral_power primordial_arcanic_pulsar(50), starfall(3), starlord(2), best_friends_with_pip, best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:49.383 aoe Q starfall Fluffy_Pillow 59.6/100: 60% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:50.420 aoe R starfire Fluffy_Pillow 18.6/100: 19% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip(11), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:51.916 aoe R starfire Fluffy_Pillow 45.8/100: 46% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip(9), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:53.413 aoe L starfall Fluffy_Pillow 73.0/100: 73% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip(8), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:54.413 aoe R starfire Fluffy_Pillow 32.0/100: 32% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip(7), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:55.774 aoe L starfall Fluffy_Pillow 55.2/100: 55% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip(6), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:56.682 aoe R starfire Fluffy_Pillow 24.2/100: 24% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:58.043 aoe K cancel_buff Fluffy_Pillow 83.4/100: 83% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:58.043 aoe L starfall Fluffy_Pillow 83.4/100: 83% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
0:59.061 aoe Q starfall Fluffy_Pillow 54.4/100: 54% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:00.038 aoe R starfire Fluffy_Pillow 21.4/100: 21% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip, best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:01.449 aoe Q starfall Fluffy_Pillow 42.6/100: 43% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:02.394 aoe R starfire Fluffy_Pillow 9.6/100: 10% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:03.756 aoe R starfire Fluffy_Pillow 30.8/100: 31% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:05.118 aoe O wrath Fluffy_Pillow 52.0/100: 52% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:06.028 aoe O wrath Fluffy_Pillow 66.0/100: 66% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(3), dreamstate, best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:06.783 aoe L starfall Fluffy_Pillow 76.0/100: 76% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), dreamstate, best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:07.782 aoe P fury_of_elune Fluffy_Pillow 35.0/100: 35% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:08.779 aoe R starfire Fluffy_Pillow 42.0/100: 42% astral_power balance_of_all_things_arcane(6), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:09.678 aoe L starfall Fluffy_Pillow 71.2/100: 71% astral_power balance_of_all_things_arcane(5), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:10.678 aoe R starfire Fluffy_Pillow 36.2/100: 36% astral_power balance_of_all_things_arcane(4), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:12.175 aoe R starfire Fluffy_Pillow 70.4/100: 70% astral_power balance_of_all_things_arcane(3), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
1:13.672 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane, eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
1:14.879 aoe L starfall Fluffy_Pillow 66.0/100: 66% astral_power eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(35), starfall(2), starlord, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
1:16.038 aoe R starfire Fluffy_Pillow 29.0/100: 29% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
1:17.712 aoe L starfall Fluffy_Pillow 80.2/100: 80% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
1:18.828 aoe R starfire Fluffy_Pillow 39.2/100: 39% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
1:20.443 aoe R starfire Fluffy_Pillow 58.4/100: 58% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
1:22.058 aoe L starfall Fluffy_Pillow 74.4/100: 74% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(3), dreamstate(2), best_friends_with_pip_static, corrupting_rage
1:23.135 aoe O wrath Fluffy_Pillow 33.4/100: 33% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage
1:23.891 aoe O wrath Fluffy_Pillow 43.4/100: 43% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
1:24.646 aoe R starfire Fluffy_Pillow 53.4/100: 53% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage
1:26.260 aoe L starfall Fluffy_Pillow 78.6/100: 79% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), best_friends_with_pip_static, corrupting_rage
1:27.338 aoe R starfire Fluffy_Pillow 39.6/100: 40% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
1:28.953 aoe Q starfall Fluffy_Pillow 64.8/100: 65% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage
1:30.160 default F natures_vigil phial_of_corrupting_rage_3 25.8/100: 26% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
1:30.160 aoe R starfire Fluffy_Pillow 25.8/100: 26% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
1:31.742 aoe Q starfall Fluffy_Pillow 57.0/100: 57% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
1:32.797 aoe R starfire Fluffy_Pillow 26.0/100: 26% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
1:34.318 aoe L starfall Fluffy_Pillow 49.2/100: 49% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
1:35.333 aoe R starfire Fluffy_Pillow 50.2/100: 50% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
1:36.801 default E use_items Fluffy_Pillow 69.4/100: 69% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
1:36.801 aoe R starfire Fluffy_Pillow 69.4/100: 69% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
1:38.269 aoe L starfall Fluffy_Pillow 88.6/100: 89% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage, kindled_soul(95)
1:39.249 aoe R starfire Fluffy_Pillow 55.6/100: 56% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(90)
1:40.717 aoe L starfall Fluffy_Pillow 76.8/100: 77% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, kindled_soul(85)
1:41.697 aoe O wrath Fluffy_Pillow 43.8/100: 44% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(3), starlord(3), dreamstate, best_friends_with_pip_static, corrupting_rage, kindled_soul(80)
1:42.451 aoe O wrath Fluffy_Pillow 55.8/100: 56% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(75)
1:43.206 aoe R starfire Fluffy_Pillow 67.8/100: 68% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(70)
1:44.820 aoe L starfall Fluffy_Pillow 95.0/100: 95% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(60)
1:46.028 aoe Q starfall Fluffy_Pillow 58.0/100: 58% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, corrupting_rage, kindled_soul(55)
1:47.188 aoe R starfire Fluffy_Pillow 17.0/100: 17% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(50)
1:48.862 aoe R starfire Fluffy_Pillow 42.2/100: 42% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(40)
1:50.535 aoe Q starfall Fluffy_Pillow 65.4/100: 65% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage, kindled_soul(35)
1:51.652 aoe R starfire Fluffy_Pillow 22.4/100: 22% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(30)
1:53.266 aoe R starfire Fluffy_Pillow 43.6/100: 44% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(20)
1:54.881 aoe R starfire Fluffy_Pillow 66.8/100: 67% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(10)
1:56.494 aoe L starfall Fluffy_Pillow 86.0/100: 86% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(5)
1:57.572 aoe O wrath Fluffy_Pillow 45.0/100: 45% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, corrupting_rage
1:58.649 aoe K cancel_buff Fluffy_Pillow 57.0/100: 57% astral_power primordial_arcanic_pulsar(40), starfall, starlord(3), dreamstate(2), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, corrupting_rage
1:58.649 aoe L starfall Fluffy_Pillow 57.0/100: 57% astral_power primordial_arcanic_pulsar(40), starfall, dreamstate(2), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, corrupting_rage
1:59.856 aoe O wrath Fluffy_Pillow 14.0/100: 14% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord, umbral_embrace, dreamstate, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, corrupting_rage
2:00.611 aoe Q starfall Fluffy_Pillow 56.0/100: 56% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord, umbral_embrace, dreamstate, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, corrupting_rage
2:01.770 aoe R starfire Fluffy_Pillow 17.0/100: 17% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(2), umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, corrupting_rage
2:02.776 aoe R starfire Fluffy_Pillow 40.2/100: 40% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, corrupting_rage
2:04.449 aoe Q starfall Fluffy_Pillow 67.4/100: 67% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn, best_friends_with_aerwynn_static, corrupting_rage
2:05.567 aoe R starfire Fluffy_Pillow 26.4/100: 26% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, corrupting_rage
2:07.179 aoe R starfire Fluffy_Pillow 47.6/100: 48% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, corrupting_rage
2:08.792 aoe R starfire Fluffy_Pillow 68.8/100: 69% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall, starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, corrupting_rage
2:10.407 aoe L starfall Fluffy_Pillow 92.0/100: 92% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall, starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, corrupting_rage
2:11.484 aoe P fury_of_elune Fluffy_Pillow 53.0/100: 53% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, corrupting_rage
2:12.465 aoe R starfire Fluffy_Pillow 62.0/100: 62% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, corrupting_rage
2:13.933 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, corrupting_rage
2:15.030 aoe L starfall Fluffy_Pillow 78.0/100: 78% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, corrupting_rage
2:16.085 aoe Q starfall Fluffy_Pillow 83.0/100: 83% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
2:17.102 aoe R starfire Fluffy_Pillow 58.0/100: 58% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
2:18.570 aoe L starfall Fluffy_Pillow 88.2/100: 88% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
2:19.550 aoe R starfire Fluffy_Pillow 61.2/100: 61% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
2:21.018 aoe L starfall Fluffy_Pillow 84.4/100: 84% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
2:21.996 aoe O wrath Fluffy_Pillow 49.4/100: 49% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
2:22.975 aoe O wrath Fluffy_Pillow 63.4/100: 63% astral_power primordial_arcanic_pulsar(25), starfall(4), starlord(3), umbral_embrace, dreamstate, best_friends_with_aerwynn_static, corrupting_rage
2:23.729 aoe L starfall Fluffy_Pillow 73.4/100: 73% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), umbral_embrace, dreamstate, best_friends_with_aerwynn_static, corrupting_rage
2:24.805 aoe R starfire Fluffy_Pillow 34.4/100: 34% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, corrupting_rage
2:25.775 aoe R starfire Fluffy_Pillow 59.6/100: 60% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, corrupting_rage
2:27.390 aoe K cancel_buff Fluffy_Pillow 86.8/100: 87% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, corrupting_rage
2:27.390 aoe L starfall Fluffy_Pillow 86.8/100: 87% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, corrupting_rage
2:28.596 aoe Q starfall Fluffy_Pillow 45.8/100: 46% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, corrupting_rage
2:29.755 aoe R starfire Fluffy_Pillow 4.8/100: 5% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, corrupting_rage
2:31.429 aoe R starfire Fluffy_Pillow 24.0/100: 24% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage
2:33.103 aoe Q starfall Fluffy_Pillow 47.2/100: 47% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, corrupting_rage
2:34.220 aoe R starfire Fluffy_Pillow 2.2/100: 2% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, corrupting_rage
2:35.836 aoe R starfire Fluffy_Pillow 25.4/100: 25% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, corrupting_rage
2:37.450 aoe R starfire Fluffy_Pillow 44.6/100: 45% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall, starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, corrupting_rage
2:39.064 aoe O wrath Fluffy_Pillow 58.6/100: 59% astral_power primordial_arcanic_pulsar(45), starfall, starlord(3), dreamstate, best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, corrupting_rage
2:39.818 aoe L starfall Fluffy_Pillow 70.6/100: 71% astral_power primordial_arcanic_pulsar(45), starfall, starlord(3), dreamstate, best_friends_with_aerwynn, best_friends_with_aerwynn_static, corrupting_rage
2:40.894 aoe O wrath Fluffy_Pillow 27.6/100: 28% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:41.648 aoe K cancel_buff Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), best_friends_with_aerwynn_static, corrupting_rage
2:41.648 aoe R starfire Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, best_friends_with_aerwynn_static, corrupting_rage
2:43.455 aoe L starfall Fluffy_Pillow 90.8/100: 91% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, best_friends_with_urctos(10), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:44.575 aoe Q starfall Fluffy_Pillow 51.8/100: 52% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, best_friends_with_urctos(9), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:45.650 aoe R starfire Fluffy_Pillow 12.8/100: 13% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(8), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:47.062 aoe Q starfall Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(6), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:48.004 aoe R starfire Fluffy_Pillow 7.0/100: 7% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:49.366 aoe R starfire Fluffy_Pillow 34.2/100: 34% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:50.728 aoe R starfire Fluffy_Pillow 59.4/100: 59% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:52.090 aoe R starfire Fluffy_Pillow 80.6/100: 81% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:53.449 aoe L starfall Fluffy_Pillow 99.8/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall, starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:54.358 aoe R starfire Fluffy_Pillow 64.8/100: 65% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, wafting_devotion
2:55.719 aoe L starfall Fluffy_Pillow 86.0/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, wafting_devotion
2:56.628 aoe O wrath Fluffy_Pillow 53.0/100: 53% astral_power primordial_arcanic_pulsar(15), starfall(2), starlord(3), dreamstate, best_friends_with_urctos_static, wafting_devotion
2:57.385 aoe O wrath Fluffy_Pillow 63.0/100: 63% astral_power primordial_arcanic_pulsar(15), starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion
2:58.139 aoe K cancel_buff Fluffy_Pillow 73.0/100: 73% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(15), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion
2:58.139 aoe L starfall Fluffy_Pillow 73.0/100: 73% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(15), solstice, starfall(2), best_friends_with_urctos_static, wafting_devotion
2:59.258 aoe R starfire Fluffy_Pillow 32.0/100: 32% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, wafting_devotion
3:00.869 default F natures_vigil phial_of_corrupting_rage_3 61.2/100: 61% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, wafting_devotion
3:00.869 aoe L starfall Fluffy_Pillow 61.2/100: 61% astral_power natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, wafting_devotion
3:01.945 aoe Q starfall Fluffy_Pillow 50.2/100: 50% astral_power natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, wafting_devotion
3:02.981 aoe R starfire Fluffy_Pillow 11.2/100: 11% astral_power natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, wafting_devotion
3:04.479 aoe R starfire Fluffy_Pillow 34.4/100: 34% astral_power natures_vigil, balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, wafting_devotion
3:05.976 aoe N incarnation_chosen_of_elune Fluffy_Pillow 57.6/100: 58% astral_power natures_vigil, balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, wafting_devotion
3:05.976 aoe R starfire Fluffy_Pillow 57.6/100: 58% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), dreamstate, best_friends_with_urctos_static, wafting_devotion
3:06.795 aoe R starfire Fluffy_Pillow 80.8/100: 81% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion
3:07.613 default E use_items Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion
3:07.613 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion, kindled_soul(100)
3:08.523 aoe R starfire Fluffy_Pillow 69.0/100: 69% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, wafting_devotion, kindled_soul(100)
3:09.886 aoe L starfall Fluffy_Pillow 98.2/100: 98% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(90)
3:10.796 aoe R starfire Fluffy_Pillow 69.2/100: 69% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(85)
3:12.157 aoe K cancel_buff Fluffy_Pillow 94.4/100: 94% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, wafting_devotion, kindled_soul(80)
3:12.157 aoe L starfall Fluffy_Pillow 94.4/100: 94% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, wafting_devotion, kindled_soul(80)
3:13.176 aoe P fury_of_elune Fluffy_Pillow 63.4/100: 63% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, wafting_devotion, kindled_soul(75)
3:14.154 aoe Q starfall Fluffy_Pillow 66.4/100: 66% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), starfall(3), starlord, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, wafting_devotion, kindled_soul(70)
3:15.133 aoe Q starfall Fluffy_Pillow 37.4/100: 37% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(4), starlord(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, wafting_devotion, kindled_soul(65)
3:16.076 aoe R starfire Fluffy_Pillow 8.4/100: 8% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, kindled_soul(60)
3:17.439 aoe R starfire Fluffy_Pillow 38.6/100: 39% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, kindled_soul(55)
3:18.801 aoe L starfall Fluffy_Pillow 68.8/100: 69% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, kindled_soul(45)
3:19.712 aoe R starfire Fluffy_Pillow 77.8/100: 78% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, kindled_soul(40)
3:21.073 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(35)
3:21.980 aoe R starfire Fluffy_Pillow 74.0/100: 74% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(30)
3:23.341 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(25)
3:24.251 aoe R starfire Fluffy_Pillow 69.0/100: 69% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(20)
3:25.612 aoe K cancel_buff Fluffy_Pillow 90.2/100: 90% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(15)
3:25.612 aoe L starfall Fluffy_Pillow 90.2/100: 90% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(15)
3:26.630 aoe Q starfall Fluffy_Pillow 57.2/100: 57% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(5)
3:27.608 aoe R starfire Fluffy_Pillow 22.2/100: 22% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(5)
3:29.020 aoe Q starfall Fluffy_Pillow 45.4/100: 45% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
3:29.963 aoe R starfire Fluffy_Pillow 10.4/100: 10% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
3:31.324 aoe R starfire Fluffy_Pillow 29.6/100: 30% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn, best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
3:32.685 aoe R starfire Fluffy_Pillow 50.8/100: 51% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
3:34.046 aoe R starfire Fluffy_Pillow 70.0/100: 70% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:35.513 aoe L starfall Fluffy_Pillow 93.2/100: 93% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:36.491 aoe R starfire Fluffy_Pillow 58.2/100: 58% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:37.961 aoe R starfire Fluffy_Pillow 77.4/100: 77% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:39.429 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:39.429 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:40.525 aoe Q starfall Fluffy_Pillow 65.0/100: 65% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:41.578 aoe R starfire Fluffy_Pillow 34.0/100: 34% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:43.103 aoe Q starfall Fluffy_Pillow 53.2/100: 53% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static
3:44.119 aoe R starfire Fluffy_Pillow 22.2/100: 22% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static
3:45.586 aoe L starfall Fluffy_Pillow 75.4/100: 75% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static
3:46.565 aoe R starfire Fluffy_Pillow 40.4/100: 40% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static
3:48.033 aoe O wrath Fluffy_Pillow 54.4/100: 54% astral_power primordial_arcanic_pulsar(50), starfall(3), starlord(3), dreamstate, best_friends_with_aerwynn_static
3:48.787 aoe O wrath Fluffy_Pillow 66.4/100: 66% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord(3), best_friends_with_aerwynn_static
3:49.543 aoe L starfall Fluffy_Pillow 80.4/100: 80% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static
3:50.620 aoe R starfire Fluffy_Pillow 39.4/100: 39% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static
3:52.235 aoe R starfire Fluffy_Pillow 64.6/100: 65% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static
3:53.848 aoe K cancel_buff Fluffy_Pillow 93.8/100: 94% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static
3:53.848 aoe L starfall Fluffy_Pillow 93.8/100: 94% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static
3:55.055 aoe Q starfall Fluffy_Pillow 54.8/100: 55% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static
3:56.108 aoe R starfire Fluffy_Pillow 25.8/100: 26% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static
3:57.628 aoe Q starfall Fluffy_Pillow 51.0/100: 51% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static
3:58.644 aoe R starfire Fluffy_Pillow 24.0/100: 24% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, corrupting_rage
4:00.112 aoe R starfire Fluffy_Pillow 81.2/100: 81% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, corrupting_rage
4:01.580 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, corrupting_rage
4:02.559 aoe R starfire Fluffy_Pillow 65.0/100: 65% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, corrupting_rage
4:04.027 aoe L starfall Fluffy_Pillow 86.2/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, corrupting_rage
4:05.004 aoe O wrath Fluffy_Pillow 51.2/100: 51% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, corrupting_rage
4:05.983 aoe O wrath Fluffy_Pillow 63.2/100: 63% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), dreamstate, best_friends_with_aerwynn, best_friends_with_aerwynn_static, corrupting_rage
4:06.737 aoe L starfall Fluffy_Pillow 73.2/100: 73% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), dreamstate, best_friends_with_aerwynn_static, corrupting_rage
4:07.815 aoe R starfire Fluffy_Pillow 34.2/100: 34% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, corrupting_rage
4:08.785 aoe R starfire Fluffy_Pillow 57.4/100: 57% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static
4:10.399 aoe L starfall Fluffy_Pillow 80.6/100: 81% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static
4:11.605 aoe R starfire Fluffy_Pillow 39.6/100: 40% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static
4:13.343 aoe Q starfall Fluffy_Pillow 64.8/100: 65% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static
4:14.502 aoe R starfire Fluffy_Pillow 21.8/100: 22% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(2), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static
4:16.177 aoe Q starfall Fluffy_Pillow 45.0/100: 45% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static
4:17.295 aoe R starfire Fluffy_Pillow 2.0/100: 2% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static
4:18.909 aoe R starfire Fluffy_Pillow 27.2/100: 27% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static
4:20.525 aoe R starfire Fluffy_Pillow 48.4/100: 48% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static
4:22.139 aoe O wrath Fluffy_Pillow 62.4/100: 62% astral_power primordial_arcanic_pulsar(40), starfall, starlord(3), dreamstate, best_friends_with_aerwynn_static
4:22.894 aoe L starfall Fluffy_Pillow 72.4/100: 72% astral_power primordial_arcanic_pulsar(40), starfall, starlord(3), dreamstate, best_friends_with_aerwynn_static
4:23.973 aoe O wrath Fluffy_Pillow 29.4/100: 29% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(3), best_friends_with_aerwynn_static, corrupting_rage
4:24.728 aoe K cancel_buff Fluffy_Pillow 41.4/100: 41% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), best_friends_with_aerwynn_static, corrupting_rage
4:24.728 aoe R starfire Fluffy_Pillow 41.4/100: 41% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, best_friends_with_aerwynn_static, corrupting_rage
4:26.534 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, best_friends_with_aerwynn_static, corrupting_rage
4:27.739 aoe Q starfall Fluffy_Pillow 59.0/100: 59% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, corrupting_rage
4:28.899 aoe R starfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, corrupting_rage
4:30.572 aoe Q starfall Fluffy_Pillow 45.2/100: 45% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, corrupting_rage
4:31.691 default F natures_vigil phial_of_corrupting_rage_3 6.2/100: 6% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, corrupting_rage
4:31.691 aoe P fury_of_elune Fluffy_Pillow 6.2/100: 6% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, corrupting_rage
4:32.673 aoe R starfire Fluffy_Pillow 13.2/100: 13% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, corrupting_rage
4:34.142 aoe R starfire Fluffy_Pillow 51.4/100: 51% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, corrupting_rage
4:35.610 aoe L starfall Fluffy_Pillow 83.6/100: 84% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, corrupting_rage
4:36.589 aoe R starfire Fluffy_Pillow 58.6/100: 59% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, corrupting_rage
4:38.056 default E use_items Fluffy_Pillow 90.8/100: 91% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage
4:38.056 aoe L starfall Fluffy_Pillow 90.8/100: 91% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(10), best_friends_with_urctos_static, corrupting_rage, kindled_soul(100)
4:39.036 aoe L starfall Fluffy_Pillow 65.8/100: 66% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, corrupting_rage, kindled_soul(100)
4:40.016 aoe K cancel_buff Fluffy_Pillow 38.8/100: 39% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage, kindled_soul(95)
4:40.016 aoe L starfall Fluffy_Pillow 38.8/100: 39% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, corrupting_rage, kindled_soul(95)
4:41.113 aoe R starfire Fluffy_Pillow 3.8/100: 4% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, corrupting_rage, kindled_soul(85)
4:42.693 aoe O wrath Fluffy_Pillow 15.8/100: 16% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(4), starlord, dreamstate, best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(80)
4:43.448 aoe O wrath Fluffy_Pillow 25.8/100: 26% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(4), starlord, best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(75)
4:44.201 aoe R starfire Fluffy_Pillow 35.8/100: 36% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord, best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage, kindled_soul(70)
4:45.938 aoe L starfall Fluffy_Pillow 89.0/100: 89% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord, best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage, kindled_soul(65)
4:47.098 aoe Q starfall Fluffy_Pillow 48.0/100: 48% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage, kindled_soul(55)
4:48.217 aoe R starfire Fluffy_Pillow 9.0/100: 9% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, corrupting_rage, kindled_soul(50)
4:49.832 aoe R starfire Fluffy_Pillow 36.2/100: 36% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, corrupting_rage, kindled_soul(45)
4:51.447 aoe R starfire Fluffy_Pillow 59.4/100: 59% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, corrupting_rage, kindled_soul(35)
4:53.060 aoe K cancel_buff Fluffy_Pillow 82.6/100: 83% astral_power eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, corrupting_rage, kindled_soul(25)
4:53.060 aoe L starfall Fluffy_Pillow 82.6/100: 83% astral_power eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, corrupting_rage, kindled_soul(25)
4:54.265 aoe R starfire Fluffy_Pillow 37.6/100: 38% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(20)
4:56.002 aoe Q starfall Fluffy_Pillow 56.8/100: 57% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, starlord, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(15)
4:57.160 aoe R starfire Fluffy_Pillow 13.8/100: 14% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage, kindled_soul(5)
4:58.832 aoe O wrath Fluffy_Pillow 37.0/100: 37% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage
4:59.949 aoe O wrath Fluffy_Pillow 47.0/100: 47% astral_power primordial_arcanic_pulsar(40), starfall(2), starlord(2), umbral_embrace, dreamstate, best_friends_with_urctos_static, corrupting_rage
5:00.705 aoe R starfire Fluffy_Pillow 63.0/100: 63% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(40), solstice, starfall(2), starlord(2), umbral_embrace, best_friends_with_urctos_static, corrupting_rage
5:01.711 aoe L starfall Fluffy_Pillow 84.2/100: 84% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(40), solstice, starfall, starlord(2), best_friends_with_urctos_static, corrupting_rage

Stats

Level Bonus (70) Race Bonus (tauren) Raid-Buffed Unbuffed Gear Amount
Strength 898 2 986 900 0
Agility 2089 -2 2173 2087 0
Stamina 3848 2 44833 42698 38825
Intellect 2089 -2 15807 14885 12090 (7538)
Spirit 0 0 0 0 0
Health 896660 896660 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 15807 14885 0
Crit 28.51% 22.30% 3114
Haste 24.78% 24.78% 4212
Versatility 6.30% 1.30% 267
Mana Regen 2560 2560 0
Attack Power 16439 15480 0
Mastery 30.74% 30.74% 8152
Armor 5324 5324 5324
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 489.00
Local Head Benevolent Embersage's Casque
ilevel: 489, stats: { 673 Armor, +3966 Sta, +704 Crit, +330 Haste, +938 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }, enchant: incandescent_essence
Local Neck Eye of the Rising Flame
ilevel: 489, stats: { +2231 Sta, +256 Haste, +1537 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Life-Bound Shoulderpads
ilevel: 486, stats: { 603 Armor, +2875 Sta, +383 Mastery, +383 Haste, +684 AgiInt }
item effects: { equip: Toxified }
Local Chest Benevolent Embersage's Robe
ilevel: 489, stats: { 897 Armor, +3966 Sta, +715 Crit, +318 Mastery, +938 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 489, stats: { 505 Armor, +2975 Sta, +535 Haste, +241 Mastery, +704 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 489, stats: { 785 Armor, +3966 Sta, +705 Haste, +328 Mastery, +938 AgiInt }, enchant: { +155 StrAgiInt, +41 Vers (lambent_armor_kit_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 486, stats: { 548 Armor, +2875 Sta, +274 Crit, +438 Haste, +684 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Thermal Bindings
ilevel: 489, stats: { 449 Armor, +2231 Sta, +191 Crit, +390 Mastery, +528 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Benevolent Embersage's Talons
ilevel: 489, stats: { 505 Armor, +2975 Sta, +226 Vers, +549 Mastery, +704 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 489, stats: { +2231 Sta, +512 Haste, +1281 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 489, stats: { +2231 Sta, +1230 Crit, +564 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 489, stats: { +892 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 489, stats: { +738 Mastery }
item effects: { use: Balefire Branch }
Local Back Drape of the Loyal Vassal
ilevel: 489, stats: { 359 Armor, +2231 Sta, +328 Haste, +253 Mastery, +528 StrAgiInt }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 489, weapon: { 606 - 781, 2.6 }, stats: { +469 Int, +2264 Int, +1983 Sta, +156 Haste, +361 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 489, stats: { +1439 Int, +1983 Sta, +174 Haste, +343 Mastery }

Profile

druid="phial_of_corrupting_rage_3"
source=default
spec=balance
level=70
race=tauren
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:hissing_rune_3

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=489,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=489,gem_id=192961/192961/192961
shoulders=lifebound_shoulderpads,id=193406,bonus_id=8836/1576/8797/8960,ilevel=486,crafted_stats=49/36
back=drape_of_the_loyal_vassal,id=158375,bonus_id=4795,ilevel=489
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=489,enchant_id=6625
wrists=thermal_bindings,id=134461,bonus_id=4795,ilevel=489,gem_id=192961
hands=benevolent_embersages_talons,id=207255,bonus_id=4795,ilevel=489
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=489,enchant_id=6830
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=486
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=489
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=489
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=489,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=489

# Gear Summary
# gear_ilvl=488.63
# gear_stamina=38825
# gear_intellect=12090
# gear_crit_rating=3114
# gear_haste_rating=4212
# gear_mastery_rating=8152
# gear_versatility_rating=267
# gear_armor=5324
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

phial_of_elemental_chaos_3 : 930339 dps, 169696 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
930338.6 930338.6 463.0 / 0.050% 87493.7 / 9.4% 67097.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.8 14.0 Astral Power 0.00% 56.7 100.0% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
phial_of_elemental_chaos_3 930339
Astral Smolder 133943 14.4% 360.5 0.89s 111139 0 Periodic 719.7 55664 0 55664 0.0% 80.1%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 360.45 0.00 719.67 719.67 270.08 0.0000 2.0000 40060535.96 40060535.96 0.00% 27832.59 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 719.67 536 920 55663.73 4695 275280 55739.13 46728 65983 40060536 40060536 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Fury of Elune 28515 3.1% 5.1 65.12s 1662591 1732673 Direct 770.9 7008 15015 11058 50.6%

Stats Details: Fury Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.13 770.93 0.00 0.00 0.00 0.9597 0.0000 8524752.81 8524752.81 0.00% 1732673.34 1732673.34
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.42% 380.97 233 548 7007.63 3321 22868 7014.55 6085 8119 2669593 2669593 0.00%
crit 50.58% 389.97 254 574 15014.68 6774 46650 15034.03 13541 17021 5855160 5855160 0.00%

Action Details: Fury Of Elune

  • id:202770
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:astral_power
  • energize_amount:3.0

Spelldata

  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r

Action Details: Fury Of Elune Tick

  • id:211545
  • school:astral
  • range:105.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.149000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:211545
  • name:Fury of Elune
  • school:astral
  • tooltip:
  • description:{$@spelldesc202770=Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r}

Action Priority List

    aoe
    [P]:5.13
  • if_expr:target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Hungering Shadowflame 3780 0.4% 17.2 16.76s 65886 0 Direct 17.2 52385 107426 65881 24.5%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.20 17.20 0.00 0.00 0.00 0.0000 0.0000 1133250.45 1133250.45 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.49% 12.98 3 29 52384.67 34936 207459 52241.37 34936 111466 680248 680248 0.00%
crit 24.51% 4.22 0 13 107426.23 71270 423217 105467.51 0 407878 453002 453002 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:31299.68
  • base_dd_max:31299.68
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 7020 0.8% 34.6 8.43s 60777 0 Direct 34.5 48465 99271 60941 24.6%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.59 34.49 0.00 0.00 0.00 0.0000 0.0000 2102123.59 2102123.59 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.45% 26.02 11 46 48464.63 47503 56417 48462.76 47503 50972 1261283 1261283 0.00%
crit 24.55% 8.47 0 22 99270.69 96907 115091 99241.96 0 113819 840840 840840 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42559.30
  • base_dd_max:42559.30
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 77030 8.3% 3.0 1.05s 7687331 8407581 Direct 6.0 7093 14525 10419 44.7%
Periodic 1835.4 8895 18444 12531 38.1% 99.2%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.00 6.00 1835.37 1835.37 0.00 0.9144 0.9715 23061994.29 23061994.29 0.00% 12914.08 8407580.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 55.26% 3.32 0 6 7093.07 6922 8364 7025.75 0 8364 23517 23517 0.00%
crit 44.74% 2.68 0 6 14525.12 14121 17063 14087.43 0 17000 38993 38993 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 61.92% 1136.44 831 1447 8894.87 6693 14624 8894.79 8587 9246 10108429 10108429 0.00%
crit 38.08% 698.93 514 919 18444.16 13655 29834 18447.80 17833 19174 12891055 12891055 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy3
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    aoe
    [J]:3.00
  • if_expr:!fight_style.dungeonroute
  • target_if_expr:refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (82204) 0.0% (8.8%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 20312 2.2% 237.5 1.45s 25596 0 Direct 236.9 16533 35622 25663 47.8%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 237.53 236.92 0.00 0.00 0.00 0.0000 0.0000 6079884.28 6079884.28 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.17% 123.61 74 182 16533.15 11191 31462 16538.98 15373 17872 2043603 2043603 0.00%
crit 47.83% 113.31 70 167 35622.14 22829 64183 35652.13 33279 38962 4036281 4036281 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy4
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 20396 2.2% 239.1 1.46s 25531 0 Direct 238.5 16478 35522 25597 47.9%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 239.14 238.52 0.00 0.00 0.00 0.0000 0.0000 6105330.13 6105330.13 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.11% 124.30 74 180 16478.38 10069 31430 16484.84 15285 18085 2048277 2048277 0.00%
crit 47.89% 114.21 71 163 35522.40 20540 63324 35550.31 33198 38491 4057053 4057053 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy5
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 41496 4.5% 15.9 19.11s 781637 0 Direct 95.1 84105 181716 130659 47.7%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.89 95.05 0.00 0.00 0.00 0.0000 0.0000 12419825.94 12419825.94 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.30% 49.72 25 80 84105.03 41506 309532 84168.36 65937 104171 4181337 4181337 0.00%
crit 47.70% 45.34 22 81 181715.96 84672 627353 181864.88 135217 231425 8238489 8238489 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfall 313754 33.7% 105.5 2.82s 889600 885770 Direct 1767.7 35759 77485 53092 41.5%

Stats Details: Starfall

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 105.49 1767.66 0.00 0.00 0.00 1.0043 0.0000 93847280.37 93847280.37 0.00% 885769.52 885769.52
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.46% 1033.36 753 1315 35759.20 7656 133627 35832.70 32517 39654 36951798 36951798 0.00%
crit 41.54% 734.30 531 975 77484.64 15618 272599 77630.12 70772 86514 56895482 56895482 0.00%

Action Details: Starfall

  • id:191034
  • school:astral
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:45.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]

Action Details: Starfall Damage

  • id:191037
  • school:astral
  • range:200.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.114000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.41

Spelldata

  • id:191037
  • name:Starfall
  • school:astral
  • tooltip:
  • description:{$@spelldesc191034=Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]}

Action Priority List

    aoe
    [L]:71.29
  • if_expr:variable.starfall_condition1
    aoe
    [Q]:34.20
  • if_expr:variable.starfall_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountLunar Shrapnel4151691PCT0.200
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 208329 22.4% 118.7 2.49s 525074 378951 Direct 718.3 55256 119801 86780 48.8%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 118.71 718.25 0.00 0.00 0.00 1.3856 0.0000 62330999.51 62330999.51 0.00% 378951.01 378951.01
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 51.16% 367.45 250 485 55256.21 7504 249712 55272.54 49099 64407 20303491 20303491 0.00%
crit 48.84% 350.81 255 469 119801.13 15308 511032 119871.52 104944 136795 42027508 42027508 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    aoe
    [M]:1.19
  • if_expr:buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
    aoe
    [R]:118.04
  • if_expr:spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Solar)4851710.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Sunfire16481550.283Mastery
Sunfire 64542 6.9% 1.0 0.00s 19309230 20965504 Direct 1.0 5567 11408 6928 23.3%
Periodic 1848.3 7493 16092 10443 34.3% 99.9%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 1848.29 1848.29 0.00 0.9219 0.9712 19309229.59 19309229.59 0.00% 10751.88 20965504.44
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.72% 0.77 0 1 5567.38 5472 5708 4271.42 0 5708 4271 4271 0.00%
crit 23.28% 0.23 0 1 11408.44 11163 11643 2655.73 0 11643 2656 2656 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 65.69% 1214.13 901 1527 7492.97 5532 13176 7496.54 7212 7883 9097370 9097370 0.00%
crit 34.31% 634.17 463 825 16091.93 11285 26879 16102.12 15377 16898 10204933 10204933 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    aoe
    [I]:1.00
  • target_if_expr:refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (6960) 0.0% (0.7%) 8.5 32.03s 245707 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.49 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 3639 0.4% 8.5 32.03s 128453 0 Direct 50.9 16987 34798 21407 24.8%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.49 50.91 0.00 0.00 0.00 0.0000 0.0000 1089988.04 1089988.04 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.17% 38.27 5 93 16986.77 16647 19770 16986.38 16647 18310 650124 650124 0.00%
crit 24.83% 12.64 0 36 34798.45 33959 40332 34798.01 0 39647 439864 439864 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:51134.41
  • base_dd_max:51134.41
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 3321 0.4% 16.3 15.70s 61024 0 Direct 97.8 8081 16554 10171 24.7%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.30 97.83 0.00 0.00 0.00 0.0000 0.0000 994951.67 994951.67 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.33% 73.70 15 171 8080.71 7921 9407 8080.57 7921 8770 595525 595525 0.00%
crit 24.67% 24.13 4 73 16553.66 16159 19191 16555.82 16159 17966 399427 399427 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24330.91
  • base_dd_max:24330.91
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 4263 0.5% 26.5 10.31s 48464 63209 Direct 26.3 35158 72158 48746 36.7%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.49 26.33 0.00 0.00 0.00 0.7667 0.0000 1283655.22 1283655.22 0.00% 63209.34 63209.34
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 63.25% 16.66 5 28 35157.73 15177 69061 35077.66 24606 44266 585510 585510 0.00%
crit 36.75% 9.68 0 22 72157.76 30962 137894 71998.38 0 101378 698145 698145 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    aoe
    [O]:24.57
  • if_expr:!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.800Spell Data
Eclipse (Solar)4851710.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Lunar)4851810.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
phial_of_elemental_chaos_3
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_elemental_chaos_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Phial of Elemental Chaos 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_elemental_chaos_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_elemental_chaos_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 180.84s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    aoe
    [N]:2.00
  • if_expr:variable.cd_condition_aoe

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.43s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_elemental_chaos_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.74
Elemental Potion of Ultimate Power 1.4 306.05s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.44 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.44
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 17.3 6.2 17.9s 13.3s 9.7s 55.67% 57.81% 6.2 (21.6) 16.7

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 52.3s
  • trigger_min/max:0.0s / 37.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.8s
  • uptime_min/max:50.89% / 59.01%

Stack Uptimes

  • balance_of_all_things_arcane_1:5.70%
  • balance_of_all_things_arcane_2:6.08%
  • balance_of_all_things_arcane_3:6.59%
  • balance_of_all_things_arcane_4:7.01%
  • balance_of_all_things_arcane_5:7.30%
  • balance_of_all_things_arcane_6:7.54%
  • balance_of_all_things_arcane_7:7.68%
  • balance_of_all_things_arcane_8:7.77%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 10.2 0.1 29.9s 29.6s 8.0s 27.31% 30.73% 0.1 (0.2) 10.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 47.1s
  • trigger_min/max:3.5s / 47.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:24.87% / 30.00%

Stack Uptimes

  • balance_of_all_things_nature_1:3.36%
  • balance_of_all_things_nature_2:3.39%
  • balance_of_all_things_nature_3:3.40%
  • balance_of_all_things_nature_4:3.42%
  • balance_of_all_things_nature_5:3.42%
  • balance_of_all_things_nature_6:3.43%
  • balance_of_all_things_nature_7:3.44%
  • balance_of_all_things_nature_8:3.45%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 15.2 87.1 20.2s 2.9s 17.4s 88.25% 0.00% 35.8 (35.8) 0.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 60.0s
  • trigger_min/max:0.8s / 13.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:82.05% / 93.34%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:13.33%
  • balance_t31_4pc_buff_lunar_2:13.57%
  • balance_t31_4pc_buff_lunar_3:13.89%
  • balance_t31_4pc_buff_lunar_4:11.79%
  • balance_t31_4pc_buff_lunar_5:35.67%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 8.2 57.9 38.1s 4.4s 19.1s 52.23% 0.00% 27.2 (27.2) 0.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.1s / 85.2s
  • trigger_min/max:0.8s / 41.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.76% / 59.43%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:7.35%
  • balance_t31_4pc_buff_solar_2:6.34%
  • balance_t31_4pc_buff_solar_3:6.20%
  • balance_t31_4pc_buff_solar_4:6.30%
  • balance_t31_4pc_buff_solar_5:26.05%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 69.9s 69.9s 10.8s 10.09% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 327.3s
  • trigger_min/max:12.0s / 327.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 39.08%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.90%
  • best_friends_with_aerwynn_2:0.90%
  • best_friends_with_aerwynn_3:0.91%
  • best_friends_with_aerwynn_4:0.91%
  • best_friends_with_aerwynn_5:0.91%
  • best_friends_with_aerwynn_6:0.92%
  • best_friends_with_aerwynn_7:0.92%
  • best_friends_with_aerwynn_8:0.92%
  • best_friends_with_aerwynn_9:0.93%
  • best_friends_with_aerwynn_10:0.93%
  • best_friends_with_aerwynn_11:0.93%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 112.1s 69.9s 45.1s 33.25% 0.00% 69.7 (69.7) 0.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 349.5s
  • trigger_min/max:12.0s / 327.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 307.6s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.25%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 69.5s 69.5s 10.8s 10.12% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 351.7s
  • trigger_min/max:12.0s / 351.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 37.44%

Stack Uptimes

  • best_friends_with_pip_1:0.91%
  • best_friends_with_pip_2:0.91%
  • best_friends_with_pip_3:0.91%
  • best_friends_with_pip_4:0.91%
  • best_friends_with_pip_5:0.92%
  • best_friends_with_pip_6:0.92%
  • best_friends_with_pip_7:0.92%
  • best_friends_with_pip_8:0.93%
  • best_friends_with_pip_9:0.93%
  • best_friends_with_pip_10:0.93%
  • best_friends_with_pip_11:0.94%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 113.5s 69.5s 45.4s 33.31% 0.00% 69.0 (69.0) 0.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.2s / 352.6s
  • trigger_min/max:12.0s / 351.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 325.3s
  • uptime_min/max:0.00% / 98.35%

Stack Uptimes

  • best_friends_with_pip_static_1:33.31%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 69.6s 69.6s 10.8s 10.16% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 333.1s
  • trigger_min/max:12.0s / 333.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 33.07%

Stack Uptimes

  • best_friends_with_urctos_1:0.91%
  • best_friends_with_urctos_2:0.91%
  • best_friends_with_urctos_3:0.91%
  • best_friends_with_urctos_4:0.92%
  • best_friends_with_urctos_5:0.92%
  • best_friends_with_urctos_6:0.92%
  • best_friends_with_urctos_7:0.93%
  • best_friends_with_urctos_8:0.93%
  • best_friends_with_urctos_9:0.93%
  • best_friends_with_urctos_10:0.94%
  • best_friends_with_urctos_11:0.94%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 113.4s 69.6s 45.2s 33.44% 0.00% 69.6 (69.6) 0.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 348.3s
  • trigger_min/max:12.0s / 333.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 295.2s
  • uptime_min/max:0.00% / 95.53%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.44%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.53% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.53%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Dreamstate 15.4 0.0 20.2s 21.2s 2.1s 10.79% 20.54% 0.0 (0.1) 0.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 55.8s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.6s
  • uptime_min/max:6.87% / 15.20%

Stack Uptimes

  • dreamstate_1:7.36%
  • dreamstate_2:3.43%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 13.3 8.1 23.6s 14.8s 21.0s 93.11% 93.82% 8.1 (8.1) 12.4

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.6s / 72.4s
  • trigger_min/max:0.0s / 58.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.0s
  • uptime_min/max:90.28% / 96.13%

Stack Uptimes

  • eclipse_lunar_1:93.11%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 8.2 0.0 38.3s 38.3s 19.3s 52.97% 54.93% 0.0 (0.0) 7.8

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 85.7s
  • trigger_min/max:12.0s / 85.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:47.49% / 59.90%

Stack Uptimes

  • eclipse_solar_1:52.97%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 122.5s 99.7s 57.9s 24.93% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 313.3s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • elemental_chaos_air_1:24.93%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:Grants Haste and movement speed is increased.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 124.4s 99.6s 57.9s 24.64% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 300.0s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • elemental_chaos_earth_1:24.64%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:Grants Mastery and damage taken reduced.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 124.8s 100.0s 58.0s 25.16% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • elemental_chaos_fire_1:25.16%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:Grants Critical Strike and damage dealt by critical strikes is increased.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 124.0s 99.0s 58.1s 25.26% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 331.9s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • elemental_chaos_frost_1:25.27%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:Grants Versatility and healing dealt by critical strikes is increased.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 305.9s 305.9s 27.4s 12.92% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 326.2s
  • trigger_min/max:300.0s / 326.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.76% / 17.85%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.92%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Fury of Elune 5.1 0.0 65.1s 65.1s 7.9s 13.54% 0.00% 75.9 (75.9) 5.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:60.0s / 90.4s
  • trigger_min/max:60.0s / 90.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:10.73% / 15.66%

Stack Uptimes

  • fury_of_elune_1:13.54%

Spelldata

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 8.2 0.0 38.3s 38.3s 19.3s 52.97% 55.64% 0.0 (0.0) 7.8

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 85.7s
  • trigger_min/max:12.0s / 85.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:47.49% / 59.90%

Stack Uptimes

  • incarnation_chosen_of_elune_1:52.97%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.7 0.0 91.3s 91.3s 19.5s 23.99% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:65.76

Trigger Details

  • interval_min/max:90.0s / 124.8s
  • trigger_min/max:90.0s / 124.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.54% / 27.00%

Stack Uptimes

  • kindled_soul_5:1.17%
  • kindled_soul_10:1.17%
  • kindled_soul_15:1.18%
  • kindled_soul_20:1.18%
  • kindled_soul_25:1.18%
  • kindled_soul_30:1.19%
  • kindled_soul_35:1.19%
  • kindled_soul_40:1.19%
  • kindled_soul_45:1.20%
  • kindled_soul_50:1.20%
  • kindled_soul_55:1.20%
  • kindled_soul_60:1.20%
  • kindled_soul_65:1.21%
  • kindled_soul_70:1.21%
  • kindled_soul_75:1.21%
  • kindled_soul_80:1.22%
  • kindled_soul_85:1.22%
  • kindled_soul_90:1.22%
  • kindled_soul_95:1.23%
  • kindled_soul_100:1.23%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Vigil 3.7 0.0 90.4s 90.4s 14.7s 18.41% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.5s
  • trigger_min/max:90.0s / 91.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.52% / 21.04%

Stack Uptimes

  • natures_vigil_1:18.41%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.6 0.0 69.5s 68.9s 0.9s 0.76% 1.17% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 341.9s
  • trigger_min/max:0.0s / 341.9s
  • trigger_pct:15.05%
  • duration_min/max:0.0s / 5.8s
  • uptime_min/max:0.00% / 4.17%

Stack Uptimes

  • owlkin_frenzy_1:0.76%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 9.2 97.2 33.8s 33.8s 29.6s 91.34% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.7s / 46.6s
  • trigger_min/max:20.7s / 46.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.4s
  • uptime_min/max:87.39% / 94.65%

Stack Uptimes

  • primordial_arcanic_pulsar_5:7.22%
  • primordial_arcanic_pulsar_10:6.74%
  • primordial_arcanic_pulsar_15:7.44%
  • primordial_arcanic_pulsar_20:8.34%
  • primordial_arcanic_pulsar_25:8.61%
  • primordial_arcanic_pulsar_30:8.50%
  • primordial_arcanic_pulsar_35:8.79%
  • primordial_arcanic_pulsar_40:9.04%
  • primordial_arcanic_pulsar_45:9.03%
  • primordial_arcanic_pulsar_50:8.74%
  • primordial_arcanic_pulsar_55:8.88%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 19.7 3.8 15.6s 13.3s 6.7s 43.88% 43.10% 3.8 (3.8) 19.2

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 42.9s
  • trigger_min/max:0.0s / 37.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.0s
  • uptime_min/max:40.00% / 46.79%

Stack Uptimes

  • solstice_1:43.88%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starfall 105.5 0.0 143.1s 2.8s 295.7s 98.89% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_starfall
  • max_stacks:20
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:asynchronous
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.8s / 357.4s
  • trigger_min/max:0.7s / 8.4s
  • trigger_pct:99.99%
  • duration_min/max:6.7s / 358.1s
  • uptime_min/max:98.41% / 99.49%

Stack Uptimes

  • starfall_1:5.09%
  • starfall_2:31.82%
  • starfall_3:42.39%
  • starfall_4:15.70%
  • starfall_5:3.48%
  • starfall_6:0.40%
  • starfall_7:0.00%

Spelldata

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]
  • max_stacks:20
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Starlord 21.0 84.5 14.4s 2.8s 13.9s 97.54% 0.00% 43.1 (43.1) 5.9

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 19.3s
  • trigger_min/max:0.8s / 8.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:94.72% / 99.45%

Stack Uptimes

  • starlord_1:12.48%
  • starlord_2:17.69%
  • starlord_3:67.37%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Umbral Embrace 23.2 2.7 12.6s 11.3s 1.6s 12.40% 0.00% 2.7 (2.7) 0.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_umbral_embrace
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 53.1s
  • trigger_min/max:0.0s / 51.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:4.83% / 24.03%

Stack Uptimes

  • umbral_embrace_1:12.40%

Spelldata

  • id:393763
  • name:Umbral Embrace
  • tooltip:Your next Wrath or Starfire cast during an Eclipse deals Astral damage and deals {$=}w1% additional damage.
  • description:{$@spelldesc393760=Dealing Astral damage has a chance to cause your next Wrath or Starfire cast during an Eclipse to become Astral and deal {$s1=25}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Wafting Devotion 4.3 1.1 61.3s 45.8s 16.5s 23.45% 0.00% 1.1 (1.1) 4.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 219.1s
  • trigger_min/max:0.0s / 217.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.7s
  • uptime_min/max:4.75% / 60.28%

Stack Uptimes

  • wafting_devotion_1:23.45%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Elemental Chaos

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Primordial Arcanic Pulsar 8.3 6.0 10.0 34.9s 21.9s 47.1s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.05% 0.00% 0.55% 0.0s 0.0s 1.1s
Astral Smolder 72.95% 63.34% 81.99% 4.0s 0.0s 46.0s
Incarnation (Total) 52.97% 47.49% 59.90% 19.3s 0.0s 54.0s
Incarnation (Pulsar) 32.68% 29.54% 35.31% 11.8s 0.0s 12.0s
Lunar Eclipse Only 40.14% 32.13% 45.92% 9.2s 0.0s 15.0s
No Eclipse 6.85% 3.87% 9.72% 1.7s 0.0s 4.3s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Fury of Elune5.2360.00030.36026.8585.60574.863

Eclipse Utilization

NoneSolarLunarBoth
Wrath24.49100.0%0.000.0%0.000.0%0.000.0%
Starfire2.662.2%0.000.0%49.7141.5%67.3456.3%
Starfall20.797.0%0.000.0%117.2339.6%157.8853.4%
Fury of Elune15.021.9%0.000.0%142.1218.4%613.7979.6%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
phial_of_elemental_chaos_3
Fury of EluneAstral Power80.87242.205.76%2.990.420.17%
MoonfireAstral Power3.0018.000.43%6.000.000.00%
Orbit BreakerAstral Power15.89474.5011.29%29.862.210.46%
Shooting Stars (Moonfire)Astral Power237.54474.7811.30%2.000.300.06%
Shooting Stars (Sunfire)Astral Power239.14477.9711.38%2.000.300.06%
StarfireAstral Power119.712243.5253.39%18.7435.761.57%
SunfireAstral Power1.006.000.14%6.000.000.00%
WrathAstral Power26.49264.866.30%10.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
phial_of_elemental_chaos_3
StarfallAstral Power 105.874163.04100.00%39.3239.4622543.00
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 896660.0 1900.95 2177.19 4257104.7 813874.4 371799.7 896660.0
Astral Power 20.0 14.02 13.84 39.0 53.5 0.4 100.0

Statistics & Data Analysis

Fight Length
phial_of_elemental_chaos_3 Fight Length
Count 9051
Mean 299.69
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 34.4727
5th Percentile 246.05
95th Percentile 353.65
( 95th Percentile - 5th Percentile ) 107.60
Mean Distribution
Standard Deviation 0.3623
95.00% Confidence Interval ( 298.98 - 300.40 )
Normalized 95.00% Confidence Interval ( 99.76% - 100.24% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 509
0.1% Error 50829
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1015
DPS
phial_of_elemental_chaos_3 Damage Per Second
Count 9051
Mean 930338.61
Minimum 860826.71
Maximum 1019146.07
Spread ( max - min ) 158319.36
Range [ ( max - min ) / 2 * 100% ] 8.51%
Standard Deviation 22472.0465
5th Percentile 895416.26
95th Percentile 968882.10
( 95th Percentile - 5th Percentile ) 73465.84
Mean Distribution
Standard Deviation 236.2079
95.00% Confidence Interval ( 929875.65 - 930801.57 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2242
0.1 Scale Factor Error with Delta=300 4310910
0.05 Scale Factor Error with Delta=300 17243639
0.01 Scale Factor Error with Delta=300 431090961
Priority Target DPS
phial_of_elemental_chaos_3 Priority Target Damage Per Second
Count 9051
Mean 169695.91
Minimum 152072.20
Maximum 193040.85
Spread ( max - min ) 40968.66
Range [ ( max - min ) / 2 * 100% ] 12.07%
Standard Deviation 5452.6865
5th Percentile 160893.98
95th Percentile 178972.34
( 95th Percentile - 5th Percentile ) 18078.36
Mean Distribution
Standard Deviation 57.3142
95.00% Confidence Interval ( 169583.58 - 169808.24 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3967
0.1 Scale Factor Error with Delta=300 253808
0.05 Scale Factor Error with Delta=300 1015231
0.01 Scale Factor Error with Delta=300 25380766
DPS(e)
phial_of_elemental_chaos_3 Damage Per Second (Effective)
Count 9051
Mean 930338.61
Minimum 860826.71
Maximum 1019146.07
Spread ( max - min ) 158319.36
Range [ ( max - min ) / 2 * 100% ] 8.51%
Damage
phial_of_elemental_chaos_3 Damage
Count 9051
Mean 278343801.86
Minimum 218953215.14
Maximum 345024003.77
Spread ( max - min ) 126070788.63
Range [ ( max - min ) / 2 * 100% ] 22.65%
DTPS
phial_of_elemental_chaos_3 Damage Taken Per Second
Count 9051
Mean 2179.04
Minimum 856.32
Maximum 4161.46
Spread ( max - min ) 3305.14
Range [ ( max - min ) / 2 * 100% ] 75.84%
HPS
phial_of_elemental_chaos_3 Healing Per Second
Count 9051
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
phial_of_elemental_chaos_3 Healing Per Second (Effective)
Count 9051
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
phial_of_elemental_chaos_3 Heal
Count 9051
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
phial_of_elemental_chaos_3 Healing Taken Per Second
Count 9051
Mean 1898.91
Minimum 496.40
Maximum 4062.65
Spread ( max - min ) 3566.25
Range [ ( max - min ) / 2 * 100% ] 93.90%
TMI
phial_of_elemental_chaos_3 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
phial_of_elemental_chaos_3Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
phial_of_elemental_chaos_3 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.44 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.68 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.74 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.aoe
# count action,conditions
0.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
0.00 variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
I 1.00 sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
J 3.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
0.00 variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
K 14.09 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
L 71.29 starfall,if=variable.starfall_condition1
M 1.19 starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
0.00 celestial_alignment,if=variable.cd_condition_aoe
N 2.00 incarnation,if=variable.cd_condition_aoe
0.00 warrior_of_elune
0.00 variable,name=enter_solar,value=spell_targets.starfire<3
0.00 starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
O 24.57 wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
0.00 wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
P 5.13 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
Q 34.20 starfall,if=variable.starfall_condition2
0.00 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+50
0.00 convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 new_moon,if=astral_power.deficit>variable.passive_asp+10
0.00 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
R 118.04 starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
0.00 wrath
S 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFIJJJLMNDEPQQRLRLRLRLRLRRLQRQRRRRLRLLRLRKLQRQRRRRLRLRLOKLORQRQRRRLRKLLQOOPRLRLRLRQRROOLRLRLRFRLQREQRRRLRLLOORLQRRQRRRLOOKLRLRQPRRLRLRKLLOLORLRRLRRKLQRROLORLRRKLQRQRRLRLRLOORFLRQRNEQRPRLLRLRKLQQRRRLRRLLRKLQRQRRRRLRKLQRQRLRRLRLRKLQROOQRRRLLRRQROOQRQRRRLKLPQQFRRLRLEOO

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask phial_of_elemental_chaos_3 0.0/100: 0% astral_power
Pre precombat 1 food phial_of_elemental_chaos_3 0.0/100: 0% astral_power elemental_chaos_earth
Pre precombat 2 augmentation phial_of_elemental_chaos_3 0.0/100: 0% astral_power elemental_chaos_earth
Pre precombat 4 no_cd_talent phial_of_elemental_chaos_3 0.0/100: 0% astral_power elemental_chaos_earth
Pre precombat 5 on_use_trinket phial_of_elemental_chaos_3 0.0/100: 0% astral_power elemental_chaos_earth
Pre precombat 6 on_use_trinket phial_of_elemental_chaos_3 0.0/100: 0% astral_power elemental_chaos_earth
Pre precombat 7 on_use_trinket phial_of_elemental_chaos_3 0.0/100: 0% astral_power elemental_chaos_earth
Pre precombat 8 moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power elemental_chaos_earth
Pre precombat 9 wrath Fluffy_Pillow 0.0/100: 0% astral_power elemental_chaos_earth
Pre precombat A wrath Fluffy_Pillow 10.0/100: 10% astral_power elemental_chaos_earth
Pre precombat C starfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, elemental_chaos_earth
0:00.000 default F natures_vigil phial_of_elemental_chaos_3 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, elemental_chaos_earth
0:00.000 aoe I sunfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, elemental_chaos_earth
0:00.929 aoe J moonfire Fluffy_Pillow 49.2/100: 49% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, elemental_chaos_earth
0:01.858 aoe J moonfire enemy2 61.2/100: 61% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, dreamstate, elemental_chaos_earth
0:02.786 aoe J moonfire enemy4 73.2/100: 73% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, dreamstate, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, elemental_chaos_earth
0:03.716 aoe L starfall Fluffy_Pillow 85.2/100: 85% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, solstice, umbral_embrace, dreamstate, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, elemental_chaos_earth
0:04.646 aoe M starfire Fluffy_Pillow 44.2/100: 44% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, elemental_chaos_earth
0:05.449 aoe N incarnation_chosen_of_elune Fluffy_Pillow 67.4/100: 67% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, elemental_chaos_earth
0:05.449 default D potion Fluffy_Pillow 67.4/100: 67% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, elemental_chaos_earth
0:05.449 default E use_items Fluffy_Pillow 67.4/100: 67% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:05.449 aoe P fury_of_elune Fluffy_Pillow 67.4/100: 67% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power, kindled_soul(100)
0:06.260 aoe Q starfall Fluffy_Pillow 76.4/100: 76% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power, kindled_soul(100)
0:07.073 aoe Q starfall Fluffy_Pillow 55.4/100: 55% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power, kindled_soul(95)
0:07.856 aoe R starfire Fluffy_Pillow 29.4/100: 29% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power, kindled_soul(90)
0:08.611 aoe L starfall Fluffy_Pillow 58.6/100: 59% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power, kindled_soul(85)
0:09.366 aoe R starfire Fluffy_Pillow 62.6/100: 63% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power, kindled_soul(85)
0:10.122 aoe L starfall Fluffy_Pillow 91.8/100: 92% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power, kindled_soul(80)
0:10.875 aoe R starfire Fluffy_Pillow 63.8/100: 64% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(5), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power, kindled_soul(75)
0:12.003 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn, best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power, kindled_soul(70)
0:12.757 aoe R starfire Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn, best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power, kindled_soul(65)
0:13.887 aoe L starfall Fluffy_Pillow 93.2/100: 93% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power, kindled_soul(60)
0:14.643 aoe R starfire Fluffy_Pillow 60.2/100: 60% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power, kindled_soul(55)
0:15.772 aoe L starfall Fluffy_Pillow 85.4/100: 85% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power, kindled_soul(50)
0:16.527 aoe R starfire Fluffy_Pillow 50.4/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power, kindled_soul(45)
0:17.657 aoe R starfire Fluffy_Pillow 69.6/100: 70% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power, kindled_soul(40)
0:18.786 aoe L starfall Fluffy_Pillow 90.8/100: 91% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power, kindled_soul(35)
0:19.630 aoe Q starfall Fluffy_Pillow 57.8/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power, kindled_soul(30)
0:20.446 aoe R starfire Fluffy_Pillow 22.8/100: 23% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(2), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power, kindled_soul(30)
0:21.617 aoe Q starfall Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power, kindled_soul(20)
0:22.399 aoe R starfire Fluffy_Pillow 7.0/100: 7% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power, kindled_soul(20)
0:23.529 aoe R starfire Fluffy_Pillow 30.2/100: 30% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power, kindled_soul(10)
0:24.658 aoe R starfire Fluffy_Pillow 51.4/100: 51% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power, kindled_soul(5)
0:25.789 aoe R starfire Fluffy_Pillow 74.6/100: 75% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:26.918 aoe L starfall Fluffy_Pillow 95.8/100: 96% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:27.673 aoe R starfire Fluffy_Pillow 64.8/100: 65% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:28.802 aoe L starfall Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:29.556 aoe L starfall Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:30.309 aoe R starfire Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:31.438 aoe L starfall Fluffy_Pillow 91.2/100: 91% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:32.192 aoe R starfire Fluffy_Pillow 60.2/100: 60% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:33.323 aoe K cancel_buff Fluffy_Pillow 85.4/100: 85% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:33.323 aoe L starfall Fluffy_Pillow 85.4/100: 85% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:34.168 aoe Q starfall Fluffy_Pillow 50.4/100: 50% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(5), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:34.980 aoe R starfire Fluffy_Pillow 17.4/100: 17% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(5), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:36.150 aoe Q starfall Fluffy_Pillow 38.6/100: 39% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(5), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_earth
0:36.930 aoe R starfire Fluffy_Pillow 7.6/100: 8% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_earth
0:37.979 aoe R starfire Fluffy_Pillow 32.8/100: 33% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_earth
0:39.028 aoe R starfire Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_earth
0:40.078 aoe R starfire Fluffy_Pillow 79.2/100: 79% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_earth
0:41.439 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_earth
0:42.348 aoe R starfire Fluffy_Pillow 67.0/100: 67% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_earth
0:43.709 aoe L starfall Fluffy_Pillow 88.2/100: 88% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_earth
0:44.618 aoe R starfire Fluffy_Pillow 55.2/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_earth
0:45.980 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_earth
0:46.889 aoe O wrath Fluffy_Pillow 65.0/100: 65% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_earth
0:47.799 aoe K cancel_buff Fluffy_Pillow 77.0/100: 77% astral_power primordial_arcanic_pulsar(45), starfall(3), starlord(3), umbral_embrace, dreamstate(2), best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_earth
0:47.799 aoe L starfall Fluffy_Pillow 77.0/100: 77% astral_power primordial_arcanic_pulsar(45), starfall(3), umbral_embrace, dreamstate(2), best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_earth
0:48.918 aoe O wrath Fluffy_Pillow 32.0/100: 32% astral_power primordial_arcanic_pulsar(50), starfall(4), starlord, umbral_embrace, dreamstate, best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_earth
0:49.674 aoe R starfire Fluffy_Pillow 44.0/100: 44% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord, umbral_embrace, best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_earth
0:50.643 aoe Q starfall Fluffy_Pillow 65.2/100: 65% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord, best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_earth
0:51.719 aoe R starfire Fluffy_Pillow 28.2/100: 28% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(4), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, elemental_chaos_earth
0:53.393 aoe Q starfall Fluffy_Pillow 53.4/100: 53% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, elemental_chaos_earth
0:54.510 aoe R starfire Fluffy_Pillow 14.4/100: 14% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, elemental_chaos_earth
0:55.978 aoe R starfire Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, elemental_chaos_earth
0:57.447 aoe R starfire Fluffy_Pillow 70.8/100: 71% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, elemental_chaos_earth
0:58.915 aoe L starfall Fluffy_Pillow 96.0/100: 96% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, elemental_chaos_earth
0:59.895 aoe R starfire Fluffy_Pillow 63.0/100: 63% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(11), best_friends_with_pip_static, elemental_chaos_earth
1:01.365 aoe K cancel_buff Fluffy_Pillow 88.2/100: 88% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(9), best_friends_with_pip_static, elemental_chaos_frost
1:01.365 aoe L starfall Fluffy_Pillow 88.2/100: 88% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(9), best_friends_with_pip_static, elemental_chaos_frost
1:02.460 aoe L starfall Fluffy_Pillow 85.2/100: 85% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(8), best_friends_with_pip_static, elemental_chaos_frost
1:03.515 aoe Q starfall Fluffy_Pillow 50.2/100: 50% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(7), best_friends_with_pip_static, elemental_chaos_frost
1:04.529 aoe O wrath Fluffy_Pillow 15.2/100: 15% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(6), best_friends_with_pip_static, elemental_chaos_frost
1:05.509 aoe O wrath Fluffy_Pillow 25.2/100: 25% astral_power primordial_arcanic_pulsar(20), starfall(4), starlord(3), dreamstate, best_friends_with_pip(5), best_friends_with_pip_static, elemental_chaos_frost
1:06.264 aoe P fury_of_elune Fluffy_Pillow 35.2/100: 35% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), dreamstate, best_friends_with_pip(4), best_friends_with_pip_static, elemental_chaos_frost
1:07.342 aoe R starfire Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_arcane(7), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), best_friends_with_pip(3), best_friends_with_pip_static, elemental_chaos_frost
1:08.312 aoe L starfall Fluffy_Pillow 78.4/100: 78% astral_power balance_of_all_things_arcane(6), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), best_friends_with_pip(2), best_friends_with_pip_static, elemental_chaos_frost
1:09.390 aoe R starfire Fluffy_Pillow 43.4/100: 43% astral_power balance_of_all_things_arcane(5), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip, best_friends_with_pip_static, elemental_chaos_frost
1:11.004 aoe L starfall Fluffy_Pillow 75.6/100: 76% astral_power balance_of_all_things_arcane(4), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, elemental_chaos_frost
1:12.081 aoe R starfire Fluffy_Pillow 42.6/100: 43% astral_power balance_of_all_things_arcane(3), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, elemental_chaos_frost
1:13.696 aoe L starfall Fluffy_Pillow 74.8/100: 75% astral_power balance_of_all_things_arcane, eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, elemental_chaos_frost
1:14.774 aoe R starfire Fluffy_Pillow 37.8/100: 38% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, elemental_chaos_frost
1:16.387 aoe Q starfall Fluffy_Pillow 59.0/100: 59% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, elemental_chaos_frost
1:17.593 aoe R starfire Fluffy_Pillow 18.0/100: 18% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, elemental_chaos_frost
1:19.330 aoe R starfire Fluffy_Pillow 41.2/100: 41% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, elemental_chaos_frost
1:21.067 aoe O wrath Fluffy_Pillow 60.4/100: 60% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, elemental_chaos_frost
1:22.228 aoe O wrath Fluffy_Pillow 70.4/100: 70% astral_power primordial_arcanic_pulsar(40), starfall, starlord, dreamstate, best_friends_with_pip_static, elemental_chaos_frost
1:22.982 aoe L starfall Fluffy_Pillow 82.4/100: 82% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(40), solstice, starfall, starlord, dreamstate, best_friends_with_pip_static, elemental_chaos_frost
1:24.142 aoe R starfire Fluffy_Pillow 43.4/100: 43% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, elemental_chaos_frost
1:25.147 aoe L starfall Fluffy_Pillow 68.6/100: 69% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_pip(11), best_friends_with_pip_static, elemental_chaos_frost
1:26.266 aoe R starfire Fluffy_Pillow 59.6/100: 60% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(10), best_friends_with_pip_static, elemental_chaos_frost
1:27.880 aoe L starfall Fluffy_Pillow 84.8/100: 85% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(8), best_friends_with_pip_static, elemental_chaos_frost
1:28.958 aoe R starfire Fluffy_Pillow 43.8/100: 44% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(7), best_friends_with_pip_static, elemental_chaos_frost
1:30.574 default F natures_vigil phial_of_elemental_chaos_3 63.0/100: 63% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(6), best_friends_with_pip_static, wafting_devotion, elemental_chaos_frost
1:30.574 aoe R starfire Fluffy_Pillow 63.0/100: 63% astral_power natures_vigil, balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(6), best_friends_with_pip_static, wafting_devotion, elemental_chaos_frost
1:32.072 aoe L starfall Fluffy_Pillow 84.2/100: 84% astral_power natures_vigil, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(4), best_friends_with_pip_static, wafting_devotion, elemental_chaos_frost
1:33.191 aoe Q starfall Fluffy_Pillow 47.2/100: 47% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord, umbral_embrace, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(4), best_friends_with_pip(3), best_friends_with_pip_static, wafting_devotion, elemental_chaos_frost
1:34.170 aoe R starfire Fluffy_Pillow 18.2/100: 18% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), umbral_embrace, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(2), best_friends_with_pip_static, wafting_devotion, elemental_chaos_frost
1:35.580 default E use_items Fluffy_Pillow 41.4/100: 41% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(5), best_friends_with_pip, best_friends_with_pip_static, wafting_devotion, elemental_chaos_frost
1:35.580 aoe Q starfall Fluffy_Pillow 41.4/100: 41% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(5), best_friends_with_pip, best_friends_with_pip_static, wafting_devotion, elemental_chaos_frost, kindled_soul(100)
1:36.522 aoe R starfire Fluffy_Pillow 12.4/100: 12% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, elemental_chaos_frost, kindled_soul(100)
1:37.883 aoe R starfire Fluffy_Pillow 39.6/100: 40% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, elemental_chaos_frost, kindled_soul(90)
1:39.243 aoe R starfire Fluffy_Pillow 62.8/100: 63% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, elemental_chaos_frost, kindled_soul(85)
1:40.604 aoe L starfall Fluffy_Pillow 84.0/100: 84% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, elemental_chaos_frost, kindled_soul(75)
1:41.515 aoe R starfire Fluffy_Pillow 51.0/100: 51% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, elemental_chaos_frost, kindled_soul(75)
1:42.876 aoe L starfall Fluffy_Pillow 72.2/100: 72% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, elemental_chaos_frost, kindled_soul(65)
1:43.786 aoe L starfall Fluffy_Pillow 39.2/100: 39% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, elemental_chaos_frost, kindled_soul(60)
1:44.696 aoe O wrath Fluffy_Pillow 36.2/100: 36% astral_power natures_vigil, primordial_arcanic_pulsar(25), starfall(3), starlord(3), dreamstate, best_friends_with_pip_static, wafting_devotion, elemental_chaos_frost, kindled_soul(55)
1:45.449 aoe O wrath Fluffy_Pillow 48.2/100: 48% astral_power natures_vigil, primordial_arcanic_pulsar(25), starfall(3), starlord(3), best_friends_with_pip_static, elemental_chaos_frost, kindled_soul(55)
1:46.203 aoe R starfire Fluffy_Pillow 60.2/100: 60% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), best_friends_with_pip_static, elemental_chaos_frost, kindled_soul(50)
1:47.816 aoe L starfall Fluffy_Pillow 83.4/100: 83% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), best_friends_with_pip_static, elemental_chaos_frost, kindled_soul(40)
1:49.024 aoe Q starfall Fluffy_Pillow 46.4/100: 46% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, elemental_chaos_frost, kindled_soul(35)
1:50.182 aoe R starfire Fluffy_Pillow 7.4/100: 7% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(4), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, elemental_chaos_frost, kindled_soul(30)
1:51.854 aoe R starfire Fluffy_Pillow 32.6/100: 33% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, elemental_chaos_frost, kindled_soul(20)
1:53.526 aoe Q starfall Fluffy_Pillow 57.8/100: 58% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, elemental_chaos_frost, kindled_soul(15)
1:54.644 aoe R starfire Fluffy_Pillow 16.8/100: 17% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion, elemental_chaos_frost, kindled_soul(5)
1:56.143 aoe R starfire Fluffy_Pillow 38.0/100: 38% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion, elemental_chaos_frost
1:57.641 aoe R starfire Fluffy_Pillow 59.2/100: 59% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion, elemental_chaos_frost
1:59.137 aoe L starfall Fluffy_Pillow 82.4/100: 82% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion, elemental_chaos_frost
2:00.136 aoe O wrath Fluffy_Pillow 41.4/100: 41% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, wafting_devotion, elemental_chaos_earth
2:01.135 aoe O wrath Fluffy_Pillow 51.4/100: 51% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(3), dreamstate, best_friends_with_pip_static, wafting_devotion, elemental_chaos_earth
2:01.891 aoe K cancel_buff Fluffy_Pillow 63.4/100: 63% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), dreamstate, best_friends_with_pip_static, wafting_devotion, elemental_chaos_earth
2:01.891 aoe L starfall Fluffy_Pillow 63.4/100: 63% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, dreamstate, best_friends_with_pip_static, wafting_devotion, elemental_chaos_earth
2:03.010 aoe R starfire Fluffy_Pillow 22.4/100: 22% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, wafting_devotion, elemental_chaos_earth
2:03.978 aoe L starfall Fluffy_Pillow 75.6/100: 76% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, wafting_devotion, elemental_chaos_earth
2:05.054 aoe R starfire Fluffy_Pillow 34.6/100: 35% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion, elemental_chaos_earth
2:06.606 aoe Q starfall Fluffy_Pillow 63.8/100: 64% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion, elemental_chaos_earth
2:07.644 aoe P fury_of_elune Fluffy_Pillow 22.8/100: 23% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion, elemental_chaos_earth
2:08.553 aoe R starfire Fluffy_Pillow 29.8/100: 30% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, owlkin_frenzy, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion, elemental_chaos_earth
2:09.461 aoe R starfire Fluffy_Pillow 59.0/100: 59% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion, elemental_chaos_earth
2:10.821 aoe L starfall Fluffy_Pillow 97.2/100: 97% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, elemental_chaos_earth
2:11.802 aoe R starfire Fluffy_Pillow 74.2/100: 74% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, elemental_chaos_earth
2:13.270 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, elemental_chaos_earth
2:14.248 aoe R starfire Fluffy_Pillow 75.0/100: 75% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, elemental_chaos_earth
2:15.715 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, elemental_chaos_earth
2:15.715 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, elemental_chaos_earth
2:16.811 aoe L starfall Fluffy_Pillow 67.0/100: 67% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, elemental_chaos_earth
2:17.865 aoe O wrath Fluffy_Pillow 66.0/100: 66% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, elemental_chaos_earth
2:18.881 aoe L starfall Fluffy_Pillow 78.0/100: 78% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(2), dreamstate(2), best_friends_with_pip_static, elemental_chaos_earth
2:19.999 aoe O wrath Fluffy_Pillow 35.0/100: 35% astral_power primordial_arcanic_pulsar(25), starfall(4), starlord(3), dreamstate, best_friends_with_pip_static, elemental_chaos_earth
2:20.753 aoe R starfire Fluffy_Pillow 47.0/100: 47% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(4), starlord(3), best_friends_with_pip_static, elemental_chaos_earth
2:21.723 aoe L starfall Fluffy_Pillow 72.2/100: 72% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), best_friends_with_pip_static, elemental_chaos_earth
2:22.800 aoe R starfire Fluffy_Pillow 35.2/100: 35% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, elemental_chaos_earth
2:24.414 aoe R starfire Fluffy_Pillow 64.4/100: 64% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, elemental_chaos_earth
2:26.028 aoe L starfall Fluffy_Pillow 91.6/100: 92% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, elemental_chaos_earth
2:27.107 aoe R starfire Fluffy_Pillow 48.6/100: 49% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, elemental_chaos_earth
2:28.725 aoe R starfire Fluffy_Pillow 69.8/100: 70% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, elemental_chaos_earth
2:30.340 aoe K cancel_buff Fluffy_Pillow 93.0/100: 93% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, elemental_chaos_earth
2:30.340 aoe L starfall Fluffy_Pillow 93.0/100: 93% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, elemental_chaos_earth
2:31.548 aoe Q starfall Fluffy_Pillow 50.0/100: 50% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, elemental_chaos_earth
2:32.708 aoe R starfire Fluffy_Pillow 5.0/100: 5% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(3), starlord(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, elemental_chaos_earth
2:34.382 aoe R starfire Fluffy_Pillow 26.2/100: 26% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, elemental_chaos_earth
2:36.056 aoe O wrath Fluffy_Pillow 42.2/100: 42% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(2), dreamstate, best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, elemental_chaos_earth
2:36.812 aoe L starfall Fluffy_Pillow 54.2/100: 54% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(2), dreamstate, best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, elemental_chaos_earth
2:37.929 aoe O wrath Fluffy_Pillow 43.2/100: 43% astral_power primordial_arcanic_pulsar(50), starfall(3), starlord(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static, elemental_chaos_earth
2:38.685 aoe R starfire Fluffy_Pillow 55.2/100: 55% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, elemental_chaos_earth
2:40.301 aoe L starfall Fluffy_Pillow 80.4/100: 80% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), best_friends_with_aerwynn_static, elemental_chaos_earth
2:41.379 aoe R starfire Fluffy_Pillow 39.4/100: 39% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, elemental_chaos_earth
2:42.993 aoe R starfire Fluffy_Pillow 66.6/100: 67% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, elemental_chaos_earth
2:44.607 aoe K cancel_buff Fluffy_Pillow 95.8/100: 96% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, elemental_chaos_earth
2:44.607 aoe L starfall Fluffy_Pillow 95.8/100: 96% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, elemental_chaos_earth
2:45.813 aoe Q starfall Fluffy_Pillow 54.8/100: 55% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, elemental_chaos_earth
2:46.869 aoe R starfire Fluffy_Pillow 25.8/100: 26% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_earth
2:48.280 aoe Q starfall Fluffy_Pillow 51.0/100: 51% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_earth
2:49.224 aoe R starfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_earth
2:50.587 aoe R starfire Fluffy_Pillow 77.2/100: 77% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_earth
2:51.948 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_earth
2:52.858 aoe R starfire Fluffy_Pillow 65.0/100: 65% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_earth
2:54.219 aoe L starfall Fluffy_Pillow 86.2/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_earth
2:55.130 aoe R starfire Fluffy_Pillow 55.2/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_earth
2:56.493 aoe L starfall Fluffy_Pillow 74.4/100: 74% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_earth
2:57.402 aoe O wrath Fluffy_Pillow 39.4/100: 39% astral_power primordial_arcanic_pulsar(25), starfall(3), starlord(3), dreamstate, best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_earth
2:58.156 aoe O wrath Fluffy_Pillow 49.4/100: 49% astral_power primordial_arcanic_pulsar(25), starfall(3), starlord(3), umbral_embrace, best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_earth
2:58.911 aoe R starfire Fluffy_Pillow 59.4/100: 59% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), umbral_embrace, best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_earth
3:00.408 default F natures_vigil phial_of_elemental_chaos_3 84.6/100: 85% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_fire
3:00.574 aoe L starfall Fluffy_Pillow 84.6/100: 85% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_fire
3:01.694 aoe R starfire Fluffy_Pillow 43.6/100: 44% astral_power natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_fire
3:03.305 aoe Q starfall Fluffy_Pillow 68.8/100: 69% astral_power natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_fire
3:04.381 aoe R starfire Fluffy_Pillow 27.8/100: 28% astral_power natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_fire
3:05.931 aoe N incarnation_chosen_of_elune Fluffy_Pillow 49.0/100: 49% astral_power natures_vigil, balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_fire
3:05.931 default E use_items Fluffy_Pillow 49.0/100: 49% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(2), starlord(2), dreamstate(2), best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_fire
3:05.931 aoe Q starfall Fluffy_Pillow 49.0/100: 49% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(2), starlord(2), dreamstate(2), best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_fire, kindled_soul(100)
3:06.873 aoe R starfire Fluffy_Pillow 22.0/100: 22% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_fire, kindled_soul(100)
3:07.692 aoe P fury_of_elune Fluffy_Pillow 47.2/100: 47% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_aerwynn_static, wafting_devotion, elemental_chaos_fire, kindled_soul(95)
3:08.600 aoe R starfire Fluffy_Pillow 54.2/100: 54% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(40), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, elemental_chaos_fire, kindled_soul(90)
3:09.481 aoe L starfall Fluffy_Pillow 87.4/100: 87% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(40), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, elemental_chaos_fire, kindled_soul(85)
3:10.460 aoe L starfall Fluffy_Pillow 92.4/100: 92% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, elemental_chaos_fire, kindled_soul(80)
3:11.441 aoe R starfire Fluffy_Pillow 69.4/100: 69% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, elemental_chaos_fire, kindled_soul(75)
3:12.908 aoe L starfall Fluffy_Pillow 99.6/100: 100% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, elemental_chaos_fire, kindled_soul(70)
3:13.888 aoe R starfire Fluffy_Pillow 72.6/100: 73% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, elemental_chaos_fire, kindled_soul(65)
3:15.355 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, elemental_chaos_fire, kindled_soul(55)
3:15.355 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, elemental_chaos_fire, kindled_soul(55)
3:16.451 aoe Q starfall Fluffy_Pillow 72.0/100: 72% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(4), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_fire, kindled_soul(50)
3:17.505 aoe Q starfall Fluffy_Pillow 41.0/100: 41% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(5), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_fire, kindled_soul(45)
3:18.520 aoe R starfire Fluffy_Pillow 10.0/100: 10% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_fire, kindled_soul(40)
3:19.986 aoe R starfire Fluffy_Pillow 37.2/100: 37% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_fire, kindled_soul(30)
3:20.967 aoe R starfire Fluffy_Pillow 62.4/100: 62% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_fire, kindled_soul(25)
3:22.434 aoe L starfall Fluffy_Pillow 87.6/100: 88% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_fire, kindled_soul(20)
3:23.412 aoe R starfire Fluffy_Pillow 54.6/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_fire, kindled_soul(15)
3:24.879 aoe R starfire Fluffy_Pillow 79.8/100: 80% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_fire, kindled_soul(10)
3:26.344 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_fire
3:27.325 aoe L starfall Fluffy_Pillow 97.0/100: 97% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_fire
3:28.303 aoe R starfire Fluffy_Pillow 62.0/100: 62% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_fire
3:29.771 aoe K cancel_buff Fluffy_Pillow 89.2/100: 89% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_fire
3:29.771 aoe L starfall Fluffy_Pillow 89.2/100: 89% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_fire
3:30.868 aoe Q starfall Fluffy_Pillow 54.2/100: 54% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_fire
3:31.921 aoe R starfire Fluffy_Pillow 19.2/100: 19% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_fire
3:33.444 aoe Q starfall Fluffy_Pillow 40.4/100: 40% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, elemental_chaos_fire
3:34.461 aoe R starfire Fluffy_Pillow 9.4/100: 9% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(11), best_friends_with_pip_static, elemental_chaos_fire
3:35.929 aoe R starfire Fluffy_Pillow 30.6/100: 31% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, elemental_chaos_fire
3:37.398 aoe R starfire Fluffy_Pillow 49.8/100: 50% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(8), best_friends_with_pip_static, elemental_chaos_fire
3:38.866 aoe R starfire Fluffy_Pillow 69.0/100: 69% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(6), best_friends_with_pip_static, elemental_chaos_fire
3:40.332 aoe L starfall Fluffy_Pillow 94.2/100: 94% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(5), best_friends_with_pip_static, elemental_chaos_fire
3:41.312 aoe R starfire Fluffy_Pillow 63.2/100: 63% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(4), best_friends_with_pip_static, elemental_chaos_fire
3:42.779 aoe K cancel_buff Fluffy_Pillow 86.4/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(3), best_friends_with_pip_static, wafting_devotion, elemental_chaos_fire
3:42.779 aoe L starfall Fluffy_Pillow 86.4/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(3), best_friends_with_pip_static, wafting_devotion, elemental_chaos_fire
3:43.798 aoe Q starfall Fluffy_Pillow 55.4/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(2), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(2), best_friends_with_pip_static, wafting_devotion, elemental_chaos_fire
3:44.776 aoe R starfire Fluffy_Pillow 24.4/100: 24% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(3), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip, best_friends_with_pip_static, wafting_devotion, elemental_chaos_fire
3:46.188 aoe Q starfall Fluffy_Pillow 47.6/100: 48% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(3), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(11), best_friends_with_urctos_static, wafting_devotion, elemental_chaos_fire
3:47.133 aoe R starfire Fluffy_Pillow 16.6/100: 17% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(10), best_friends_with_urctos_static, wafting_devotion, elemental_chaos_fire
3:48.493 aoe L starfall Fluffy_Pillow 43.8/100: 44% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, wafting_devotion, elemental_chaos_fire
3:49.405 aoe R starfire Fluffy_Pillow 44.8/100: 45% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, wafting_devotion, elemental_chaos_fire
3:50.767 aoe R starfire Fluffy_Pillow 72.0/100: 72% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, wafting_devotion, elemental_chaos_fire
3:52.129 aoe L starfall Fluffy_Pillow 99.2/100: 99% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(5), best_friends_with_urctos_static, wafting_devotion, elemental_chaos_fire
3:53.039 aoe R starfire Fluffy_Pillow 66.2/100: 66% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion, elemental_chaos_fire
3:54.401 aoe L starfall Fluffy_Pillow 89.4/100: 89% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(3), best_friends_with_urctos_static, wafting_devotion, elemental_chaos_fire
3:55.310 aoe R starfire Fluffy_Pillow 54.4/100: 54% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion, elemental_chaos_fire
3:56.672 aoe K cancel_buff Fluffy_Pillow 73.6/100: 74% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion, elemental_chaos_fire
3:56.672 aoe L starfall Fluffy_Pillow 73.6/100: 74% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion, elemental_chaos_fire
3:57.689 aoe Q starfall Fluffy_Pillow 38.6/100: 39% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord, umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_chaos_fire
3:58.742 aoe R starfire Fluffy_Pillow 5.6/100: 6% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(2), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_chaos_fire
4:00.265 aoe O wrath Fluffy_Pillow 21.6/100: 22% astral_power primordial_arcanic_pulsar(25), starfall(3), starlord(2), umbral_embrace, dreamstate, best_friends_with_urctos_static, elemental_chaos_air
4:01.019 aoe O wrath Fluffy_Pillow 33.6/100: 34% astral_power primordial_arcanic_pulsar(25), starfall(3), starlord(2), umbral_embrace, best_friends_with_urctos_static, elemental_chaos_air
4:01.774 aoe Q starfall Fluffy_Pillow 45.6/100: 46% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(2), umbral_embrace, best_friends_with_urctos_static, elemental_chaos_air
4:02.858 aoe R starfire Fluffy_Pillow 6.6/100: 7% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, elemental_chaos_air
4:04.423 aoe R starfire Fluffy_Pillow 31.8/100: 32% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, elemental_chaos_air
4:05.988 aoe R starfire Fluffy_Pillow 57.0/100: 57% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, elemental_chaos_air
4:07.553 aoe L starfall Fluffy_Pillow 82.2/100: 82% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, elemental_chaos_air
4:08.600 aoe L starfall Fluffy_Pillow 73.2/100: 73% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, elemental_chaos_air
4:09.645 aoe R starfire Fluffy_Pillow 30.2/100: 30% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, elemental_chaos_air
4:11.213 aoe R starfire Fluffy_Pillow 51.4/100: 51% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, elemental_chaos_air
4:12.778 aoe Q starfall Fluffy_Pillow 70.6/100: 71% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, elemental_chaos_air
4:13.949 aoe R starfire Fluffy_Pillow 27.6/100: 28% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(3), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, elemental_chaos_air
4:15.636 aoe O wrath Fluffy_Pillow 46.8/100: 47% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, elemental_chaos_air
4:16.761 aoe O wrath Fluffy_Pillow 58.8/100: 59% astral_power primordial_arcanic_pulsar(45), starfall, starlord, dreamstate, best_friends_with_urctos_static, elemental_chaos_air
4:17.517 aoe Q starfall Fluffy_Pillow 70.8/100: 71% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord, dreamstate, best_friends_with_urctos_static, elemental_chaos_air
4:18.642 aoe R starfire Fluffy_Pillow 31.8/100: 32% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, elemental_chaos_air
4:19.617 aoe Q starfall Fluffy_Pillow 53.0/100: 53% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, elemental_chaos_air
4:20.701 aoe R starfire Fluffy_Pillow 18.0/100: 18% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, elemental_chaos_air
4:22.267 aoe R starfire Fluffy_Pillow 43.2/100: 43% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, elemental_chaos_air
4:23.833 aoe R starfire Fluffy_Pillow 70.4/100: 70% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, elemental_chaos_air
4:25.400 aoe L starfall Fluffy_Pillow 89.6/100: 90% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, elemental_chaos_air
4:26.444 aoe K cancel_buff Fluffy_Pillow 52.6/100: 53% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, elemental_chaos_air
4:26.444 aoe L starfall Fluffy_Pillow 52.6/100: 53% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, elemental_chaos_air
4:27.508 aoe P fury_of_elune Fluffy_Pillow 21.6/100: 22% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, elemental_chaos_air
4:28.532 aoe Q starfall Fluffy_Pillow 61.6/100: 62% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, elemental_chaos_air
4:29.555 aoe Q starfall Fluffy_Pillow 38.6/100: 39% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_chaos_air
4:30.541 default F natures_vigil phial_of_elemental_chaos_3 15.6/100: 16% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_chaos_air
4:30.574 aoe R starfire Fluffy_Pillow 15.6/100: 16% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_chaos_air
4:31.999 aoe R starfire Fluffy_Pillow 46.8/100: 47% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_chaos_air
4:33.423 aoe L starfall Fluffy_Pillow 79.0/100: 79% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_chaos_air
4:34.372 aoe R starfire Fluffy_Pillow 52.0/100: 52% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_chaos_air
4:35.795 aoe L starfall Fluffy_Pillow 82.2/100: 82% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_chaos_air
4:36.746 default E use_items Fluffy_Pillow 51.2/100: 51% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_chaos_air
4:36.746 aoe O wrath Fluffy_Pillow 51.2/100: 51% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_chaos_air, kindled_soul(100)
4:37.698 aoe O wrath Fluffy_Pillow 65.2/100: 65% astral_power natures_vigil, primordial_arcanic_pulsar(25), starfall(2), starlord(3), dreamstate, best_friends_with_urctos_static, elemental_chaos_air, kindled_soul(100)

Stats

Level Bonus (70) Race Bonus (tauren) Raid-Buffed Unbuffed Gear Amount
Strength 898 2 986 900 0
Agility 2089 -2 2173 2087 0
Stamina 3848 2 44833 42698 38825
Intellect 2089 -2 15807 14885 12090 (7538)
Spirit 0 0 0 0 0
Health 896660 896660 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 15807 14885 0
Crit 22.30% 22.30% 3114
Haste 24.78% 24.78% 4212
Versatility 6.30% 1.30% 267
Mana Regen 2560 2560 0
Attack Power 16439 15480 0
Mastery 32.48% 30.74% 8152
Armor 5324 5324 5324
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 489.00
Local Head Benevolent Embersage's Casque
ilevel: 489, stats: { 673 Armor, +3966 Sta, +704 Crit, +330 Haste, +938 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }, enchant: incandescent_essence
Local Neck Eye of the Rising Flame
ilevel: 489, stats: { +2231 Sta, +256 Haste, +1537 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Life-Bound Shoulderpads
ilevel: 486, stats: { 603 Armor, +2875 Sta, +383 Mastery, +383 Haste, +684 AgiInt }
item effects: { equip: Toxified }
Local Chest Benevolent Embersage's Robe
ilevel: 489, stats: { 897 Armor, +3966 Sta, +715 Crit, +318 Mastery, +938 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 489, stats: { 505 Armor, +2975 Sta, +535 Haste, +241 Mastery, +704 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 489, stats: { 785 Armor, +3966 Sta, +705 Haste, +328 Mastery, +938 AgiInt }, enchant: { +155 StrAgiInt, +41 Vers (lambent_armor_kit_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 486, stats: { 548 Armor, +2875 Sta, +274 Crit, +438 Haste, +684 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Thermal Bindings
ilevel: 489, stats: { 449 Armor, +2231 Sta, +191 Crit, +390 Mastery, +528 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Benevolent Embersage's Talons
ilevel: 489, stats: { 505 Armor, +2975 Sta, +226 Vers, +549 Mastery, +704 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 489, stats: { +2231 Sta, +512 Haste, +1281 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 489, stats: { +2231 Sta, +1230 Crit, +564 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 489, stats: { +892 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 489, stats: { +738 Mastery }
item effects: { use: Balefire Branch }
Local Back Drape of the Loyal Vassal
ilevel: 489, stats: { 359 Armor, +2231 Sta, +328 Haste, +253 Mastery, +528 StrAgiInt }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 489, weapon: { 606 - 781, 2.6 }, stats: { +469 Int, +2264 Int, +1983 Sta, +156 Haste, +361 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 489, stats: { +1439 Int, +1983 Sta, +174 Haste, +343 Mastery }

Profile

druid="phial_of_elemental_chaos_3"
source=default
spec=balance
level=70
race=tauren
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:hissing_rune_3

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=489,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=489,gem_id=192961/192961/192961
shoulders=lifebound_shoulderpads,id=193406,bonus_id=8836/1576/8797/8960,ilevel=486,crafted_stats=49/36
back=drape_of_the_loyal_vassal,id=158375,bonus_id=4795,ilevel=489
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=489,enchant_id=6625
wrists=thermal_bindings,id=134461,bonus_id=4795,ilevel=489,gem_id=192961
hands=benevolent_embersages_talons,id=207255,bonus_id=4795,ilevel=489
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=489,enchant_id=6830
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=486
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=489
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=489
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=489,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=489

# Gear Summary
# gear_ilvl=488.63
# gear_stamina=38825
# gear_intellect=12090
# gear_crit_rating=3114
# gear_haste_rating=4212
# gear_mastery_rating=8152
# gear_versatility_rating=267
# gear_armor=5324
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

phial_of_static_empowerment_3 : 935656 dps, 170669 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
935656.1 935656.1 465.9 / 0.050% 88051.3 / 9.4% 67888.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.8 13.9 Astral Power 0.00% 56.4 100.0% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
phial_of_static_empowerment_3 935656
Astral Smolder 133628 14.3% 351.0 0.91s 113822 0 Periodic 709.9 56272 0 56272 0.0% 79.0%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 350.95 0.00 709.86 709.86 258.66 0.0000 2.0000 39946490.23 39946490.23 0.00% 28136.82 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 709.86 516 906 56272.02 4899 277573 56350.60 49029 67052 39946490 39946490 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Fury of Elune 28435 3.0% 5.1 65.02s 1660975 1718532 Direct 763.8 7178 15264 11127 48.8%

Stats Details: Fury Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.12 763.77 0.00 0.00 0.00 0.9665 0.0000 8498142.78 8498142.78 0.00% 1718532.41 1718532.41
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 51.16% 390.76 230 555 7177.66 3465 22865 7186.33 6181 8276 2804653 2804653 0.00%
crit 48.84% 373.01 238 532 15264.15 7068 46645 15276.73 13804 17499 5693490 5693490 0.00%

Action Details: Fury Of Elune

  • id:202770
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:astral_power
  • energize_amount:3.0

Spelldata

  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r

Action Details: Fury Of Elune Tick

  • id:211545
  • school:astral
  • range:105.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.149000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:211545
  • name:Fury of Elune
  • school:astral
  • tooltip:
  • description:{$@spelldesc202770=Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r}

Action Priority List

    aoe
    [P]:5.12
  • if_expr:target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Hungering Shadowflame 3706 0.4% 17.1 16.82s 64984 0 Direct 17.1 52151 106381 64984 23.7%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.09 17.09 0.00 0.00 0.00 0.0000 0.0000 1110275.79 1110275.79 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.33% 13.04 1 28 52150.52 34936 202233 51958.52 34936 107793 680140 680140 0.00%
crit 23.67% 4.04 0 12 106381.38 71270 412555 104542.60 0 407878 430136 430136 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:31299.68
  • base_dd_max:31299.68
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 6854 0.7% 34.3 8.49s 59832 0 Direct 34.2 48103 98016 59986 23.8%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.29 34.21 0.00 0.00 0.00 0.0000 0.0000 2051800.73 2051800.73 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.20% 26.06 11 46 48102.73 47503 54996 48102.15 47503 50125 1253747 1253747 0.00%
crit 23.80% 8.14 0 21 98016.34 96907 112191 97976.79 0 105398 798053 798053 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42559.30
  • base_dd_max:42559.30
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 77832 8.3% 3.0 1.05s 7763682 8432674 Direct 6.0 7149 14557 10392 43.8%
Periodic 1820.5 9142 18866 12759 37.2% 99.1%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.00 6.00 1820.55 1820.55 0.00 0.9209 0.9789 23291044.85 23291044.85 0.00% 13048.50 8432673.73
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.22% 3.37 0 6 7149.44 6982 8436 7095.76 0 8357 24116 24116 0.00%
crit 43.78% 2.63 0 6 14556.60 14244 17210 14149.21 0 17210 38239 38239 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 62.80% 1143.37 863 1454 9142.29 6984 14549 9142.34 8907 9421 10452933 10452933 0.00%
crit 37.20% 677.18 488 894 18866.24 14248 29681 18870.16 18284 19548 12775756 12775756 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy3
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    aoe
    [J]:3.00
  • if_expr:!fight_style.dungeonroute
  • target_if_expr:refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (82643) 0.0% (8.8%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 20421 2.2% 235.8 1.47s 25905 0 Direct 235.3 16892 36240 25971 46.9%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 235.85 235.25 0.00 0.00 0.00 0.0000 0.0000 6109606.11 6109606.11 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.08% 124.86 74 186 16891.90 11677 31459 16900.87 15768 18071 2109164 2109164 0.00%
crit 46.92% 110.39 67 166 36240.28 23821 64175 36271.24 33680 38971 4000442 4000442 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy3
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 20498 2.2% 237.5 1.46s 25819 0 Direct 236.9 16838 36124 25886 46.9%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 237.50 236.89 0.00 0.00 0.00 0.0000 0.0000 6132038.10 6132038.10 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.09% 125.75 77 179 16837.70 10156 31459 16844.37 15772 18216 2117355 2117355 0.00%
crit 46.91% 111.14 70 165 36123.89 20718 63149 36155.14 33829 39358 4014683 4014683 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 41724 4.5% 15.8 19.12s 790928 0 Direct 94.4 85936 185030 132208 46.7%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.78 94.41 0.00 0.00 0.00 0.0000 0.0000 12481452.06 12481452.06 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.31% 50.32 24 81 85936.03 41865 313691 86022.63 68179 107362 4324601 4324601 0.00%
crit 46.69% 44.08 19 73 185029.93 85406 627278 185200.30 145824 251530 8156851 8156851 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfall 315498 33.7% 104.7 2.83s 900662 890366 Direct 1766.7 36309 78366 53385 40.6%

Stats Details: Starfall

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 104.72 1766.75 0.00 0.00 0.00 1.0116 0.0000 94315535.11 94315535.11 0.00% 890365.58 890365.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.40% 1049.41 781 1350 36309.09 7855 133959 36392.05 33348 40430 38102008 38102008 0.00%
crit 40.60% 717.34 520 948 78365.87 16024 269868 78512.58 71444 87628 56213527 56213527 0.00%

Action Details: Starfall

  • id:191034
  • school:astral
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:45.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]

Action Details: Starfall Damage

  • id:191037
  • school:astral
  • range:200.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy5
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.114000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.41

Spelldata

  • id:191037
  • name:Starfall
  • school:astral
  • tooltip:
  • description:{$@spelldesc191034=Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]}

Action Priority List

    aoe
    [L]:70.52
  • if_expr:variable.starfall_condition1
    aoe
    [Q]:34.20
  • if_expr:variable.starfall_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountLunar Shrapnel4151691PCT0.200
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 210846 22.5% 117.8 2.50s 535443 383891 Direct 712.6 56952 122733 88486 47.9%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.76 712.55 0.00 0.00 0.00 1.3948 0.0000 63053260.56 63053260.56 0.00% 383890.58 383890.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.06% 370.98 264 483 56952.39 7830 250654 56981.56 51040 64523 21128926 21128926 0.00%
crit 47.94% 341.58 241 451 122733.44 15974 519310 122802.37 110283 140135 41924334 41924334 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    aoe
    [M]:1.27
  • if_expr:buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
    aoe
    [R]:117.02
  • if_expr:spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Solar)4851710.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Sunfire16481550.283Mastery
Sunfire 65145 7.0% 1.0 0.00s 19479409 20990743 Direct 1.0 5554 11328 6924 23.7%
Periodic 1833.4 7698 16463 10621 33.3% 99.8%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 1833.44 1833.44 0.00 0.9285 0.9786 19479409.36 19479409.36 0.00% 10851.45 20990742.85
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.31% 0.76 0 1 5554.30 5519 5592 4238.27 0 5592 4238 4238 0.00%
crit 23.69% 0.24 0 1 11328.45 11260 11407 2684.25 0 11407 2684 2684 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 66.65% 1221.99 914 1544 7697.54 5580 13227 7701.53 7479 7985 9406211 9406211 0.00%
crit 33.35% 611.45 458 806 16462.95 11383 26983 16473.25 15875 17167 10066276 10066276 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    aoe
    [I]:1.00
  • target_if_expr:refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (6761) 0.0% (0.7%) 8.4 32.77s 241426 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.39 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 3532 0.4% 8.4 32.77s 126136 0 Direct 50.3 16862 34365 21023 23.8%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.39 50.32 0.00 0.00 0.00 0.0000 0.0000 1057907.22 1057907.22 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.23% 38.36 7 101 16862.46 16647 19272 16861.45 16647 18557 646857 646857 0.00%
crit 23.77% 11.96 0 33 34365.45 33959 39316 34366.59 0 38870 411051 411051 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:51134.41
  • base_dd_max:51134.41
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 3229 0.3% 16.1 16.06s 60016 0 Direct 96.7 8022 16350 10003 23.8%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.11 96.67 0.00 0.00 0.00 0.0000 0.0000 966942.64 966942.64 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.22% 73.68 13 182 8022.40 7921 9170 8021.84 7921 8677 591092 591092 0.00%
crit 23.78% 22.99 2 67 16349.51 16159 18707 16351.61 16159 17872 375851 375851 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24330.91
  • base_dd_max:24330.91
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 4308 0.5% 26.4 10.36s 49035 63670 Direct 26.3 35920 73355 49318 35.8%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.44 26.29 0.00 0.00 0.00 0.7701 0.0000 1296575.28 1296575.28 0.00% 63669.97 63669.97
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 64.21% 16.88 6 30 35919.84 15309 69327 35844.31 26417 44281 606289 606289 0.00%
crit 35.79% 9.41 1 21 73354.82 31230 139823 73232.26 39061 103013 690286 690286 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    aoe
    [O]:24.52
  • if_expr:!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.800Spell Data
Eclipse (Solar)4851710.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Lunar)4851810.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
phial_of_static_empowerment_3
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_static_empowerment_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Phial of Static Empowerment 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_static_empowerment_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_static_empowerment_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 180.84s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    aoe
    [N]:2.00
  • if_expr:variable.cd_condition_aoe

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.41s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.73 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_static_empowerment_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.73
Elemental Potion of Ultimate Power 1.4 307.08s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.44 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy6
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.44
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 17.4 6.0 17.7s 13.4s 9.6s 55.84% 57.86% 6.0 (20.5) 16.8

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.1s
  • trigger_min/max:0.0s / 38.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.7s
  • uptime_min/max:51.90% / 59.23%

Stack Uptimes

  • balance_of_all_things_arcane_1:5.73%
  • balance_of_all_things_arcane_2:6.12%
  • balance_of_all_things_arcane_3:6.62%
  • balance_of_all_things_arcane_4:7.04%
  • balance_of_all_things_arcane_5:7.33%
  • balance_of_all_things_arcane_6:7.56%
  • balance_of_all_things_arcane_7:7.68%
  • balance_of_all_things_arcane_8:7.76%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 10.2 0.0 29.8s 29.7s 7.9s 27.19% 30.45% 0.0 (0.1) 10.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 48.0s
  • trigger_min/max:4.5s / 47.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:24.67% / 30.00%

Stack Uptimes

  • balance_of_all_things_nature_1:3.36%
  • balance_of_all_things_nature_2:3.37%
  • balance_of_all_things_nature_3:3.39%
  • balance_of_all_things_nature_4:3.40%
  • balance_of_all_things_nature_5:3.41%
  • balance_of_all_things_nature_6:3.41%
  • balance_of_all_things_nature_7:3.42%
  • balance_of_all_things_nature_8:3.43%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 15.1 86.4 20.3s 2.9s 17.5s 88.19% 0.00% 35.5 (35.5) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 59.4s
  • trigger_min/max:0.8s / 13.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:83.50% / 92.89%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:13.36%
  • balance_t31_4pc_buff_lunar_2:13.67%
  • balance_t31_4pc_buff_lunar_3:13.95%
  • balance_t31_4pc_buff_lunar_4:11.72%
  • balance_t31_4pc_buff_lunar_5:35.49%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 8.2 57.1 38.0s 4.4s 18.9s 52.01% 0.00% 26.5 (26.5) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 84.1s
  • trigger_min/max:0.8s / 41.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.37% / 59.59%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:7.42%
  • balance_t31_4pc_buff_solar_2:6.44%
  • balance_t31_4pc_buff_solar_3:6.29%
  • balance_t31_4pc_buff_solar_4:6.43%
  • balance_t31_4pc_buff_solar_5:25.42%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 69.2s 69.2s 10.8s 10.17% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 326.2s
  • trigger_min/max:12.0s / 326.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 34.83%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.91%
  • best_friends_with_aerwynn_2:0.91%
  • best_friends_with_aerwynn_3:0.92%
  • best_friends_with_aerwynn_4:0.92%
  • best_friends_with_aerwynn_5:0.92%
  • best_friends_with_aerwynn_6:0.92%
  • best_friends_with_aerwynn_7:0.93%
  • best_friends_with_aerwynn_8:0.93%
  • best_friends_with_aerwynn_9:0.93%
  • best_friends_with_aerwynn_10:0.94%
  • best_friends_with_aerwynn_11:0.94%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 1.0 112.9s 69.2s 45.5s 33.47% 0.00% 69.3 (69.3) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:13.0s / 349.4s
  • trigger_min/max:12.0s / 326.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 316.3s
  • uptime_min/max:0.00% / 95.55%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.47%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 68.6s 68.6s 10.8s 10.12% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 329.2s
  • trigger_min/max:12.0s / 329.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 36.83%

Stack Uptimes

  • best_friends_with_pip_1:0.90%
  • best_friends_with_pip_2:0.91%
  • best_friends_with_pip_3:0.91%
  • best_friends_with_pip_4:0.91%
  • best_friends_with_pip_5:0.92%
  • best_friends_with_pip_6:0.92%
  • best_friends_with_pip_7:0.92%
  • best_friends_with_pip_8:0.93%
  • best_friends_with_pip_9:0.93%
  • best_friends_with_pip_10:0.93%
  • best_friends_with_pip_11:0.93%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 1.0 112.9s 68.6s 45.3s 33.13% 0.00% 68.3 (68.3) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:13.0s / 353.5s
  • trigger_min/max:12.0s / 329.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 291.2s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.13%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 68.9s 68.9s 10.8s 10.18% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 323.5s
  • trigger_min/max:12.0s / 323.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 36.40%

Stack Uptimes

  • best_friends_with_urctos_1:0.91%
  • best_friends_with_urctos_2:0.91%
  • best_friends_with_urctos_3:0.92%
  • best_friends_with_urctos_4:0.92%
  • best_friends_with_urctos_5:0.92%
  • best_friends_with_urctos_6:0.93%
  • best_friends_with_urctos_7:0.93%
  • best_friends_with_urctos_8:0.93%
  • best_friends_with_urctos_9:0.94%
  • best_friends_with_urctos_10:0.94%
  • best_friends_with_urctos_11:0.94%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 1.0 112.4s 68.9s 45.3s 33.40% 0.00% 69.4 (69.4) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:13.0s / 346.7s
  • trigger_min/max:12.0s / 323.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 307.6s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.40%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.54% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.66%

Stack Uptimes

  • bloodlust_1:13.54%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Dreamstate 15.3 0.0 20.3s 21.3s 2.1s 10.83% 20.62% 0.0 (0.1) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.6s / 55.7s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.3s
  • uptime_min/max:6.97% / 16.76%

Stack Uptimes

  • dreamstate_1:7.36%
  • dreamstate_2:3.46%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 13.2 8.1 23.7s 14.8s 21.0s 93.09% 93.81% 8.1 (8.1) 12.4

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.6s / 71.3s
  • trigger_min/max:0.0s / 57.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.0s
  • uptime_min/max:90.29% / 96.10%

Stack Uptimes

  • eclipse_lunar_1:93.09%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 8.2 0.0 38.1s 38.1s 19.2s 52.75% 54.68% 0.0 (0.0) 7.9

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 84.9s
  • trigger_min/max:12.0s / 84.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:47.10% / 59.93%

Stack Uptimes

  • eclipse_solar_1:52.75%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 306.0s 306.0s 27.4s 12.93% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 325.9s
  • trigger_min/max:300.0s / 325.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.76% / 17.87%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.93%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Fury of Elune 5.1 0.0 65.1s 65.1s 7.9s 13.51% 0.00% 75.7 (75.7) 4.9

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:60.0s / 88.9s
  • trigger_min/max:60.0s / 88.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:10.84% / 15.68%

Stack Uptimes

  • fury_of_elune_1:13.51%

Spelldata

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 8.2 0.0 38.1s 38.1s 19.2s 52.75% 55.39% 0.0 (0.0) 7.9

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 84.9s
  • trigger_min/max:12.0s / 84.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:47.10% / 59.93%

Stack Uptimes

  • incarnation_chosen_of_elune_1:52.75%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.7 0.0 90.9s 90.9s 19.6s 24.00% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:65.76

Trigger Details

  • interval_min/max:90.0s / 122.1s
  • trigger_min/max:90.0s / 122.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.82% / 26.96%

Stack Uptimes

  • kindled_soul_5:1.17%
  • kindled_soul_10:1.18%
  • kindled_soul_15:1.18%
  • kindled_soul_20:1.18%
  • kindled_soul_25:1.18%
  • kindled_soul_30:1.19%
  • kindled_soul_35:1.19%
  • kindled_soul_40:1.19%
  • kindled_soul_45:1.20%
  • kindled_soul_50:1.20%
  • kindled_soul_55:1.20%
  • kindled_soul_60:1.20%
  • kindled_soul_65:1.21%
  • kindled_soul_70:1.21%
  • kindled_soul_75:1.21%
  • kindled_soul_80:1.22%
  • kindled_soul_85:1.22%
  • kindled_soul_90:1.22%
  • kindled_soul_95:1.22%
  • kindled_soul_100:1.23%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Vigil 3.7 0.0 90.4s 90.4s 14.7s 18.39% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.5s
  • trigger_min/max:90.0s / 91.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.50% / 21.00%

Stack Uptimes

  • natures_vigil_1:18.39%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.6 0.0 68.5s 67.8s 0.9s 0.77% 1.18% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 335.9s
  • trigger_min/max:0.1s / 335.9s
  • trigger_pct:15.12%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:0.00% / 4.47%

Stack Uptimes

  • owlkin_frenzy_1:0.77%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 9.2 96.5 34.0s 34.0s 29.8s 91.36% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:21.1s / 45.9s
  • trigger_min/max:21.1s / 45.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.6s
  • uptime_min/max:87.57% / 94.70%

Stack Uptimes

  • primordial_arcanic_pulsar_5:7.24%
  • primordial_arcanic_pulsar_10:6.73%
  • primordial_arcanic_pulsar_15:7.52%
  • primordial_arcanic_pulsar_20:8.34%
  • primordial_arcanic_pulsar_25:8.66%
  • primordial_arcanic_pulsar_30:8.40%
  • primordial_arcanic_pulsar_35:8.69%
  • primordial_arcanic_pulsar_40:9.02%
  • primordial_arcanic_pulsar_45:9.04%
  • primordial_arcanic_pulsar_50:8.85%
  • primordial_arcanic_pulsar_55:8.89%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 19.7 3.7 15.6s 13.4s 6.7s 43.99% 43.19% 3.7 (3.7) 19.3

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 42.9s
  • trigger_min/max:0.0s / 38.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:40.10% / 47.14%

Stack Uptimes

  • solstice_1:43.99%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starfall 104.7 0.0 143.0s 2.8s 295.7s 98.88% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_starfall
  • max_stacks:20
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:asynchronous
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.8s / 357.7s
  • trigger_min/max:0.7s / 8.4s
  • trigger_pct:99.99%
  • duration_min/max:6.3s / 358.1s
  • uptime_min/max:98.43% / 99.49%

Stack Uptimes

  • starfall_1:5.25%
  • starfall_2:32.47%
  • starfall_3:42.28%
  • starfall_4:15.17%
  • starfall_5:3.35%
  • starfall_6:0.37%
  • starfall_7:0.00%

Spelldata

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]
  • max_stacks:20
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Starlord 21.0 83.7 14.5s 2.8s 13.9s 97.48% 0.00% 42.4 (42.4) 6.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 19.3s
  • trigger_min/max:0.8s / 8.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:94.77% / 99.39%

Stack Uptimes

  • starlord_1:12.58%
  • starlord_2:17.70%
  • starlord_3:67.20%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Static Empowerment 1.0 0.0 0.0s 0.0s 299.6s 100.00% 0.00% 295.1 (295.1) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:intellect
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s
  • uptime_min/max:100.00% / 100.00%

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:Primary stat is increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your primary stat up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Umbral Embrace 23.0 2.6 12.7s 11.3s 1.6s 12.38% 0.00% 2.6 (2.6) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_umbral_embrace
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 56.0s
  • trigger_min/max:0.0s / 56.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.8s
  • uptime_min/max:2.50% / 22.51%

Stack Uptimes

  • umbral_embrace_1:12.38%

Spelldata

  • id:393763
  • name:Umbral Embrace
  • tooltip:Your next Wrath or Starfire cast during an Eclipse deals Astral damage and deals {$=}w1% additional damage.
  • description:{$@spelldesc393760=Dealing Astral damage has a chance to cause your next Wrath or Starfire cast during an Eclipse to become Astral and deal {$s1=25}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Wafting Devotion 4.3 1.2 60.9s 45.4s 16.5s 23.55% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 211.9s
  • trigger_min/max:0.0s / 205.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.5s
  • uptime_min/max:4.79% / 64.15%

Stack Uptimes

  • wafting_devotion_1:23.55%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Static Empowerment

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:Primary stat is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your primary stat up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Primordial Arcanic Pulsar 8.3 6.0 10.0 35.2s 22.5s 47.7s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.05% 0.00% 0.61% 0.0s 0.0s 1.0s
Astral Smolder 72.05% 61.60% 83.39% 3.9s 0.0s 44.0s
Incarnation (Total) 52.75% 47.10% 59.93% 19.2s 0.0s 54.0s
Incarnation (Pulsar) 32.44% 29.45% 35.01% 11.8s 0.0s 12.0s
Lunar Eclipse Only 40.34% 32.94% 46.46% 9.2s 0.0s 15.0s
No Eclipse 6.87% 3.65% 9.71% 1.7s 0.0s 4.5s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Fury of Elune5.2570.00028.91226.9036.14874.280

Eclipse Utilization

NoneSolarLunarBoth
Wrath24.44100.0%0.000.0%0.000.0%0.000.0%
Starfire2.442.1%0.000.0%49.8342.0%66.4856.0%
Starfall20.847.0%0.000.0%117.8039.8%157.1153.1%
Fury of Elune16.062.1%0.000.0%142.2918.6%605.4279.3%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
phial_of_static_empowerment_3
Fury of EluneAstral Power80.66241.605.79%3.000.370.15%
MoonfireAstral Power3.0018.000.43%6.000.000.00%
Orbit BreakerAstral Power15.78471.2311.29%29.862.210.47%
Shooting Stars (Moonfire)Astral Power235.86471.4411.29%2.000.290.06%
Shooting Stars (Sunfire)Astral Power237.49474.6911.37%2.000.300.06%
StarfireAstral Power118.762227.4453.35%18.7635.141.55%
SunfireAstral Power1.006.000.14%6.000.000.00%
WrathAstral Power26.44264.426.33%10.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
phial_of_static_empowerment_3
StarfallAstral Power 105.094136.05100.00%39.3639.5022803.27
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 896660.0 1890.05 2167.10 4279847.9 813668.1 431654.9 896660.0
Astral Power 20.0 13.94 13.76 38.3 53.5 0.0 100.0

Statistics & Data Analysis

Fight Length
phial_of_static_empowerment_3 Fight Length
Count 8981
Mean 299.56
Minimum 240.03
Maximum 359.99
Spread ( max - min ) 119.95
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 34.7871
5th Percentile 245.98
95th Percentile 353.90
( 95th Percentile - 5th Percentile ) 107.92
Mean Distribution
Standard Deviation 0.3671
95.00% Confidence Interval ( 298.84 - 300.28 )
Normalized 95.00% Confidence Interval ( 99.76% - 100.24% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 519
0.1% Error 51806
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1034
DPS
phial_of_static_empowerment_3 Damage Per Second
Count 8981
Mean 935656.06
Minimum 865717.20
Maximum 1017746.74
Spread ( max - min ) 152029.55
Range [ ( max - min ) / 2 * 100% ] 8.12%
Standard Deviation 22527.9860
5th Percentile 900781.04
95th Percentile 975041.42
( 95th Percentile - 5th Percentile ) 74260.38
Mean Distribution
Standard Deviation 237.7169
95.00% Confidence Interval ( 935190.14 - 936121.98 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2227
0.1 Scale Factor Error with Delta=300 4332399
0.05 Scale Factor Error with Delta=300 17329595
0.01 Scale Factor Error with Delta=300 433239856
Priority Target DPS
phial_of_static_empowerment_3 Priority Target Damage Per Second
Count 8981
Mean 170668.68
Minimum 154288.80
Maximum 190645.84
Spread ( max - min ) 36357.04
Range [ ( max - min ) / 2 * 100% ] 10.65%
Standard Deviation 5465.6249
5th Percentile 161957.19
95th Percentile 180033.47
( 95th Percentile - 5th Percentile ) 18076.29
Mean Distribution
Standard Deviation 57.6737
95.00% Confidence Interval ( 170555.64 - 170781.72 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3940
0.1 Scale Factor Error with Delta=300 255014
0.05 Scale Factor Error with Delta=300 1020055
0.01 Scale Factor Error with Delta=300 25501359
DPS(e)
phial_of_static_empowerment_3 Damage Per Second (Effective)
Count 8981
Mean 935656.06
Minimum 865717.20
Maximum 1017746.74
Spread ( max - min ) 152029.55
Range [ ( max - min ) / 2 * 100% ] 8.12%
Damage
phial_of_static_empowerment_3 Damage
Count 8981
Mean 279790480.83
Minimum 222736592.89
Maximum 347021696.59
Spread ( max - min ) 124285103.70
Range [ ( max - min ) / 2 * 100% ] 22.21%
DTPS
phial_of_static_empowerment_3 Damage Taken Per Second
Count 8981
Mean 2168.87
Minimum 709.96
Maximum 4167.74
Spread ( max - min ) 3457.78
Range [ ( max - min ) / 2 * 100% ] 79.71%
HPS
phial_of_static_empowerment_3 Healing Per Second
Count 8981
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
phial_of_static_empowerment_3 Healing Per Second (Effective)
Count 8981
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
phial_of_static_empowerment_3 Heal
Count 8981
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
phial_of_static_empowerment_3 Healing Taken Per Second
Count 8981
Mean 1887.85
Minimum 555.91
Maximum 4013.16
Spread ( max - min ) 3457.25
Range [ ( max - min ) / 2 * 100% ] 91.57%
TMI
phial_of_static_empowerment_3 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
phial_of_static_empowerment_3Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
phial_of_static_empowerment_3 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.44 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.68 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.73 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.aoe
# count action,conditions
0.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
0.00 variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
I 1.00 sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
J 3.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
0.00 variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
K 13.96 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
L 70.52 starfall,if=variable.starfall_condition1
M 1.27 starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
0.00 celestial_alignment,if=variable.cd_condition_aoe
N 2.00 incarnation,if=variable.cd_condition_aoe
0.00 warrior_of_elune
0.00 variable,name=enter_solar,value=spell_targets.starfire<3
0.00 starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
O 24.52 wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
0.00 wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
P 5.12 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
Q 34.20 starfall,if=variable.starfall_condition2
0.00 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+50
0.00 convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 new_moon,if=astral_power.deficit>variable.passive_asp+10
0.00 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
R 117.02 starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
0.00 wrath
S 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFIJJJLMNDEPLLRRLRLRLRLRKLQRLRRRLRLRLRLRKLLRQRRRLRLRRLRLOOQRQRRRLLRRLQPQRROLORLRKLQRQRRRLOORFKLQRRELRLRLROOKLRQRQRRLRRKLOOQRQRRRLRRLPQRLRLRLLROOKLRQRLRRLRRKLOOQRQRRRLLRKLQOOFMQRRNERLRLKLRQQRPRRLRLRLQQRRLRRLRLRKLQRQRROOLRLRKLQRQRRRLRLLOORLRQRQRRRRLOOQRLQFPRRLRELLROLORLQRRRLRRKLROLORQRRLRKLQRQRRRLRDLOORLLRQRRRLRRKLOOPLRLRLRL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask phial_of_static_empowerment_3 0.0/100: 0% astral_power
Pre precombat 1 food phial_of_static_empowerment_3 0.0/100: 0% astral_power static_empowerment
Pre precombat 2 augmentation phial_of_static_empowerment_3 0.0/100: 0% astral_power static_empowerment
Pre precombat 4 no_cd_talent phial_of_static_empowerment_3 0.0/100: 0% astral_power static_empowerment
Pre precombat 5 on_use_trinket phial_of_static_empowerment_3 0.0/100: 0% astral_power static_empowerment
Pre precombat 6 on_use_trinket phial_of_static_empowerment_3 0.0/100: 0% astral_power static_empowerment
Pre precombat 7 on_use_trinket phial_of_static_empowerment_3 0.0/100: 0% astral_power static_empowerment
Pre precombat 8 moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power static_empowerment
Pre precombat 9 wrath Fluffy_Pillow 0.0/100: 0% astral_power static_empowerment
Pre precombat A wrath Fluffy_Pillow 10.0/100: 10% astral_power static_empowerment
Pre precombat C starfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, static_empowerment
0:00.000 default F natures_vigil phial_of_static_empowerment_3 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, static_empowerment
0:00.000 aoe I sunfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, static_empowerment
0:00.929 aoe J moonfire Fluffy_Pillow 47.2/100: 47% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, static_empowerment
0:01.856 aoe J moonfire enemy2 59.2/100: 59% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, dreamstate, static_empowerment(2)
0:02.784 aoe J moonfire enemy3 69.2/100: 69% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, dreamstate, static_empowerment(3)
0:03.714 aoe L starfall Fluffy_Pillow 79.2/100: 79% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, solstice, dreamstate, static_empowerment(4)
0:04.642 aoe M starfire Fluffy_Pillow 40.2/100: 40% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, static_empowerment(5)
0:05.445 aoe N incarnation_chosen_of_elune Fluffy_Pillow 63.4/100: 63% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, static_empowerment(5)
0:05.445 default D potion Fluffy_Pillow 63.4/100: 63% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), static_empowerment(5)
0:05.445 default E use_items Fluffy_Pillow 63.4/100: 63% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), static_empowerment(5), elemental_potion_of_ultimate_power
0:05.445 aoe P fury_of_elune Fluffy_Pillow 63.4/100: 63% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(100)
0:06.257 aoe L starfall Fluffy_Pillow 70.4/100: 70% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall, starlord, dreamstate(2), static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(100)
0:07.069 aoe L starfall Fluffy_Pillow 47.4/100: 47% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(95)
0:07.852 aoe R starfire Fluffy_Pillow 49.4/100: 49% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(90)
0:08.606 aoe R starfire Fluffy_Pillow 78.6/100: 79% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(85)
0:09.359 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(85)
0:10.114 aoe R starfire Fluffy_Pillow 77.0/100: 77% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(80)
0:11.244 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(75)
0:11.999 aoe R starfire Fluffy_Pillow 75.0/100: 75% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(70)
0:13.128 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(65)
0:13.881 aoe R starfire Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(60)
0:15.008 aoe L starfall Fluffy_Pillow 97.2/100: 97% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(55)
0:15.763 aoe R starfire Fluffy_Pillow 64.2/100: 64% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(50)
0:16.892 aoe K cancel_buff Fluffy_Pillow 87.4/100: 87% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(45)
0:16.892 aoe L starfall Fluffy_Pillow 87.4/100: 87% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(45)
0:17.737 aoe Q starfall Fluffy_Pillow 52.4/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(40)
0:18.549 aoe R starfire Fluffy_Pillow 19.4/100: 19% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(5), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(35)
0:19.721 aoe L starfall Fluffy_Pillow 42.6/100: 43% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(30)
0:20.501 aoe R starfire Fluffy_Pillow 7.6/100: 8% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(5), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(25)
0:21.631 aoe R starfire Fluffy_Pillow 58.8/100: 59% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(20)
0:22.762 aoe R starfire Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(15)
0:23.891 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(10)
0:24.646 aoe R starfire Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), static_empowerment(5), elemental_potion_of_ultimate_power, kindled_soul(5)
0:25.777 aoe L starfall Fluffy_Pillow 88.2/100: 88% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), static_empowerment(5), elemental_potion_of_ultimate_power
0:26.531 aoe R starfire Fluffy_Pillow 59.2/100: 59% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), static_empowerment(5), elemental_potion_of_ultimate_power
0:27.661 aoe L starfall Fluffy_Pillow 84.4/100: 84% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(11), best_friends_with_pip_static, static_empowerment(5), elemental_potion_of_ultimate_power
0:28.416 aoe R starfire Fluffy_Pillow 55.4/100: 55% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(10), best_friends_with_pip_static, static_empowerment(5), elemental_potion_of_ultimate_power
0:29.545 aoe L starfall Fluffy_Pillow 84.6/100: 85% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, static_empowerment(5), elemental_potion_of_ultimate_power
0:30.299 aoe R starfire Fluffy_Pillow 57.6/100: 58% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(8), best_friends_with_pip_static, static_empowerment(5), elemental_potion_of_ultimate_power
0:31.428 aoe K cancel_buff Fluffy_Pillow 82.8/100: 83% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(7), best_friends_with_pip_static, static_empowerment(5), elemental_potion_of_ultimate_power
0:31.428 aoe L starfall Fluffy_Pillow 82.8/100: 83% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(7), best_friends_with_pip_static, static_empowerment(5), elemental_potion_of_ultimate_power
0:32.274 aoe L starfall Fluffy_Pillow 53.8/100: 54% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(6), best_friends_with_pip_static, static_empowerment(5), elemental_potion_of_ultimate_power
0:33.086 aoe R starfire Fluffy_Pillow 18.8/100: 19% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(5), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(5), best_friends_with_pip_static, static_empowerment(5), elemental_potion_of_ultimate_power
0:34.258 aoe Q starfall Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(4), best_friends_with_pip_static, static_empowerment(5), elemental_potion_of_ultimate_power
0:35.041 aoe R starfire Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(3), best_friends_with_pip_static, static_empowerment(5), elemental_potion_of_ultimate_power
0:36.169 aoe R starfire Fluffy_Pillow 56.2/100: 56% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(2), best_friends_with_pip_static, static_empowerment(5)
0:37.299 aoe R starfire Fluffy_Pillow 77.4/100: 77% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip, best_friends_with_pip_static, static_empowerment(5)
0:38.428 aoe L starfall Fluffy_Pillow 98.6/100: 99% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, static_empowerment(5)
0:39.183 aoe R starfire Fluffy_Pillow 65.6/100: 66% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, static_empowerment(5)
0:40.314 aoe L starfall Fluffy_Pillow 86.8/100: 87% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, static_empowerment(5)
0:41.293 aoe R starfire Fluffy_Pillow 53.8/100: 54% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, static_empowerment(5)
0:42.760 aoe R starfire Fluffy_Pillow 77.0/100: 77% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, static_empowerment(5)
0:44.227 aoe L starfall Fluffy_Pillow 96.2/100: 96% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, static_empowerment(5)
0:45.207 aoe R starfire Fluffy_Pillow 63.2/100: 63% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, static_empowerment(5)
0:46.676 aoe L starfall Fluffy_Pillow 84.4/100: 84% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, static_empowerment(5)
0:47.772 aoe O wrath Fluffy_Pillow 51.4/100: 51% astral_power primordial_arcanic_pulsar(45), starfall(3), starlord, dreamstate, best_friends_with_pip_static, static_empowerment(5)
0:48.527 aoe O wrath Fluffy_Pillow 61.4/100: 61% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord, best_friends_with_pip_static, static_empowerment(5)
0:49.281 aoe Q starfall Fluffy_Pillow 71.4/100: 71% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord, best_friends_with_pip_static, static_empowerment(5)
0:50.442 aoe R starfire Fluffy_Pillow 30.4/100: 30% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(2), umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, static_empowerment(5)
0:52.117 aoe Q starfall Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_pip(11), best_friends_with_pip_static, static_empowerment(5)
0:53.234 aoe R starfire Fluffy_Pillow 14.6/100: 15% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(10), best_friends_with_pip_static, static_empowerment(5)
0:54.849 aoe R starfire Fluffy_Pillow 41.8/100: 42% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(9), best_friends_with_pip_static, static_empowerment(5)
0:56.464 aoe R starfire Fluffy_Pillow 65.0/100: 65% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(7), best_friends_with_pip_static, static_empowerment(5)
0:58.079 aoe L starfall Fluffy_Pillow 90.2/100: 90% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall, starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(6), best_friends_with_pip_static, static_empowerment(5)
0:59.156 aoe L starfall Fluffy_Pillow 51.2/100: 51% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip(4), best_friends_with_pip_static, static_empowerment(5)
1:00.134 aoe R starfire Fluffy_Pillow 52.2/100: 52% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(3), best_friends_with_pip_static, static_empowerment(5)
1:01.602 aoe R starfire Fluffy_Pillow 81.4/100: 81% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(2), best_friends_with_pip_static, static_empowerment(5)
1:03.070 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip, best_friends_with_pip_static, static_empowerment(5)
1:04.167 aoe Q starfall Fluffy_Pillow 69.0/100: 69% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, static_empowerment(5)
1:05.221 aoe P fury_of_elune Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, static_empowerment(5)
1:06.459 aoe Q starfall Fluffy_Pillow 40.0/100: 40% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, static_empowerment(5)
1:07.475 aoe R starfire Fluffy_Pillow 13.0/100: 13% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, static_empowerment(5)
1:08.941 aoe R starfire Fluffy_Pillow 40.2/100: 40% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, static_empowerment(5)
1:10.408 aoe O wrath Fluffy_Pillow 67.2/100: 67% astral_power fury_of_elune, primordial_arcanic_pulsar(20), starfall(3), starlord(3), dreamstate, best_friends_with_pip_static, static_empowerment(5)
1:11.164 aoe L starfall Fluffy_Pillow 85.2/100: 85% astral_power fury_of_elune, primordial_arcanic_pulsar(20), starfall(2), starlord(3), dreamstate, best_friends_with_pip_static, static_empowerment(5)
1:12.241 aoe O wrath Fluffy_Pillow 48.2/100: 48% astral_power fury_of_elune, primordial_arcanic_pulsar(25), starfall(2), starlord(3), best_friends_with_pip_static, static_empowerment(5)
1:12.996 aoe R starfire Fluffy_Pillow 64.2/100: 64% astral_power balance_of_all_things_arcane(8), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_pip_static, static_empowerment(5)
1:14.611 aoe L starfall Fluffy_Pillow 92.4/100: 92% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall, starlord(3), best_friends_with_pip_static, static_empowerment(5)
1:15.689 aoe R starfire Fluffy_Pillow 53.4/100: 53% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, static_empowerment(5)
1:17.305 aoe K cancel_buff Fluffy_Pillow 80.6/100: 81% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, static_empowerment(5)
1:17.305 aoe L starfall Fluffy_Pillow 80.6/100: 81% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, static_empowerment(5)
1:18.512 aoe Q starfall Fluffy_Pillow 69.6/100: 70% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, static_empowerment(5)
1:19.671 aoe R starfire Fluffy_Pillow 28.6/100: 29% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, static_empowerment(5)
1:21.345 aoe Q starfall Fluffy_Pillow 49.8/100: 50% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, static_empowerment(5)
1:22.463 aoe R starfire Fluffy_Pillow 6.8/100: 7% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(4), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, wafting_devotion, static_empowerment(5)
1:23.958 aoe R starfire Fluffy_Pillow 32.0/100: 32% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, wafting_devotion, static_empowerment(5)
1:25.456 aoe R starfire Fluffy_Pillow 53.2/100: 53% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(10), best_friends_with_pip_static, wafting_devotion, static_empowerment(5)
1:26.951 aoe L starfall Fluffy_Pillow 78.4/100: 78% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall, starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(9), best_friends_with_pip_static, wafting_devotion, static_empowerment(5)
1:27.952 aoe O wrath Fluffy_Pillow 35.4/100: 35% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord(3), umbral_embrace, dreamstate, best_friends_with_pip(8), best_friends_with_pip_static, wafting_devotion, static_empowerment(5)
1:28.709 aoe O wrath Fluffy_Pillow 45.4/100: 45% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord(3), umbral_embrace, best_friends_with_pip(7), best_friends_with_pip_static, wafting_devotion, static_empowerment(5)
1:29.465 aoe R starfire Fluffy_Pillow 55.4/100: 55% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), umbral_embrace, best_friends_with_pip(6), best_friends_with_pip_static, wafting_devotion, static_empowerment(5)
1:30.962 default F natures_vigil phial_of_static_empowerment_3 84.6/100: 85% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), best_friends_with_pip(5), best_friends_with_pip_static, wafting_devotion, static_empowerment(5)
1:30.962 aoe K cancel_buff Fluffy_Pillow 84.6/100: 85% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), best_friends_with_pip(5), best_friends_with_pip_static, wafting_devotion, static_empowerment(5)
1:30.962 aoe L starfall Fluffy_Pillow 84.6/100: 85% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, best_friends_with_pip(5), best_friends_with_pip_static, wafting_devotion, static_empowerment(5)
1:32.082 aoe Q starfall Fluffy_Pillow 47.6/100: 48% astral_power natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, best_friends_with_pip(4), best_friends_with_pip_static, wafting_devotion, static_empowerment(5)
1:33.159 aoe R starfire Fluffy_Pillow 6.6/100: 7% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip(3), best_friends_with_pip_static, wafting_devotion, static_empowerment(5)
1:34.572 aoe R starfire Fluffy_Pillow 33.8/100: 34% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip, best_friends_with_pip_static, wafting_devotion, static_empowerment(5)
1:35.983 default E use_items Fluffy_Pillow 91.0/100: 91% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion, static_empowerment(5)
1:35.983 aoe L starfall Fluffy_Pillow 91.0/100: 91% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion, static_empowerment(5), kindled_soul(100)
1:36.927 aoe R starfire Fluffy_Pillow 60.0/100: 60% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, static_empowerment(5), kindled_soul(100)
1:38.395 aoe L starfall Fluffy_Pillow 85.2/100: 85% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, static_empowerment(5), kindled_soul(90)
1:39.376 aoe R starfire Fluffy_Pillow 52.2/100: 52% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, static_empowerment(5), kindled_soul(85)
1:40.845 aoe L starfall Fluffy_Pillow 71.4/100: 71% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, static_empowerment(5), kindled_soul(80)
1:41.826 aoe R starfire Fluffy_Pillow 38.4/100: 38% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, static_empowerment(5), kindled_soul(75)
1:43.295 aoe O wrath Fluffy_Pillow 57.6/100: 58% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, static_empowerment(5), kindled_soul(65)
1:44.275 aoe O wrath Fluffy_Pillow 69.6/100: 70% astral_power natures_vigil, primordial_arcanic_pulsar(15), starfall(2), starlord(3), dreamstate, best_friends_with_pip_static, static_empowerment(5), kindled_soul(60)
1:45.030 aoe K cancel_buff Fluffy_Pillow 79.6/100: 80% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(15), solstice, starfall(2), starlord(3), dreamstate, best_friends_with_pip_static, static_empowerment(5), kindled_soul(55)
1:45.030 aoe L starfall Fluffy_Pillow 79.6/100: 80% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(15), solstice, starfall(2), dreamstate, best_friends_with_pip_static, static_empowerment(5), kindled_soul(55)
1:46.238 aoe R starfire Fluffy_Pillow 42.6/100: 43% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, static_empowerment(5), kindled_soul(50)
1:47.280 aoe Q starfall Fluffy_Pillow 65.8/100: 66% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, static_empowerment(5), kindled_soul(45)
1:48.439 aoe R starfire Fluffy_Pillow 26.8/100: 27% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, static_empowerment(5), kindled_soul(40)
1:50.112 aoe Q starfall Fluffy_Pillow 56.0/100: 56% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, static_empowerment(5), kindled_soul(30)
1:51.228 aoe R starfire Fluffy_Pillow 15.0/100: 15% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, static_empowerment(5), kindled_soul(25)
1:52.842 aoe R starfire Fluffy_Pillow 36.2/100: 36% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, static_empowerment(5), kindled_soul(20)
1:54.457 aoe L starfall Fluffy_Pillow 57.4/100: 57% astral_power eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, static_empowerment(5), kindled_soul(10)
1:55.535 aoe R starfire Fluffy_Pillow 14.4/100: 14% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, static_empowerment(5), kindled_soul(5)
1:57.149 aoe R starfire Fluffy_Pillow 65.6/100: 66% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, static_empowerment(5)
1:58.765 aoe K cancel_buff Fluffy_Pillow 84.8/100: 85% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, static_empowerment(5)
1:58.765 aoe L starfall Fluffy_Pillow 84.8/100: 85% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, static_empowerment(5)
1:59.973 aoe O wrath Fluffy_Pillow 43.8/100: 44% astral_power primordial_arcanic_pulsar(40), starfall(2), starlord, dreamstate, best_friends_with_aerwynn, best_friends_with_aerwynn_static, static_empowerment(5)
2:00.726 aoe O wrath Fluffy_Pillow 53.8/100: 54% astral_power primordial_arcanic_pulsar(40), starfall(2), starlord, best_friends_with_aerwynn_static, static_empowerment(5)
2:01.481 aoe Q starfall Fluffy_Pillow 65.8/100: 66% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(40), solstice, starfall(2), starlord, best_friends_with_aerwynn_static, static_empowerment(5)
2:02.640 aoe R starfire Fluffy_Pillow 24.8/100: 25% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, static_empowerment(5)
2:04.312 aoe Q starfall Fluffy_Pillow 56.0/100: 56% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, static_empowerment(5)
2:05.429 aoe R starfire Fluffy_Pillow 15.0/100: 15% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, static_empowerment(5)
2:07.044 aoe R starfire Fluffy_Pillow 38.2/100: 38% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, static_empowerment(5)
2:08.659 aoe R starfire Fluffy_Pillow 59.4/100: 59% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(50), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(11), best_friends_with_urctos_static, static_empowerment(5)
2:10.271 aoe L starfall Fluffy_Pillow 78.6/100: 79% astral_power eclipse_lunar, primordial_arcanic_pulsar(50), starfall, starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(10), best_friends_with_urctos_static, static_empowerment(5)
2:11.348 aoe R starfire Fluffy_Pillow 35.6/100: 36% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(9), best_friends_with_urctos_static, wafting_devotion, static_empowerment(5)
2:12.847 aoe R starfire Fluffy_Pillow 54.8/100: 55% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(7), best_friends_with_urctos_static, wafting_devotion, static_empowerment(5)
2:14.346 aoe L starfall Fluffy_Pillow 76.0/100: 76% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(6), best_friends_with_urctos_static, wafting_devotion, static_empowerment(5)
2:15.465 aoe P fury_of_elune Fluffy_Pillow 41.0/100: 41% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(5), best_friends_with_urctos_static, wafting_devotion, static_empowerment(5)
2:16.442 aoe Q starfall Fluffy_Pillow 48.0/100: 48% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion, static_empowerment(5)
2:17.419 aoe R starfire Fluffy_Pillow 25.0/100: 25% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(3), best_friends_with_urctos_static, wafting_devotion, static_empowerment(5)
2:18.830 aoe L starfall Fluffy_Pillow 91.2/100: 91% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion, static_empowerment(5)
2:19.775 aoe R starfire Fluffy_Pillow 68.2/100: 68% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, static_empowerment(5)
2:21.136 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, static_empowerment(5)
2:22.044 aoe R starfire Fluffy_Pillow 73.0/100: 73% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, static_empowerment(5)
2:23.406 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, static_empowerment(5)
2:24.317 aoe L starfall Fluffy_Pillow 72.0/100: 72% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, static_empowerment(5)
2:25.227 aoe R starfire Fluffy_Pillow 39.0/100: 39% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, static_empowerment(5)
2:26.586 aoe O wrath Fluffy_Pillow 55.0/100: 55% astral_power primordial_arcanic_pulsar(25), starfall(4), starlord(3), dreamstate, best_friends_with_urctos_static, static_empowerment(5)
2:27.341 aoe O wrath Fluffy_Pillow 67.0/100: 67% astral_power primordial_arcanic_pulsar(25), starfall(3), starlord(3), best_friends_with_urctos_static, static_empowerment(5)
2:28.096 aoe K cancel_buff Fluffy_Pillow 81.0/100: 81% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), umbral_embrace, best_friends_with_urctos_static, static_empowerment(5)
2:28.096 aoe L starfall Fluffy_Pillow 81.0/100: 81% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), umbral_embrace, best_friends_with_urctos_static, static_empowerment(5)
2:29.303 aoe R starfire Fluffy_Pillow 40.0/100: 40% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_urctos(11), best_friends_with_urctos_static, static_empowerment(5)
2:31.041 aoe Q starfall Fluffy_Pillow 65.2/100: 65% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar, best_friends_with_urctos(10), best_friends_with_urctos_static, static_empowerment(5)
2:32.200 aoe R starfire Fluffy_Pillow 26.2/100: 26% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(8), best_friends_with_urctos_static, static_empowerment(5)
2:33.875 aoe L starfall Fluffy_Pillow 85.4/100: 85% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(7), best_friends_with_urctos_static, static_empowerment(5)
2:34.992 aoe R starfire Fluffy_Pillow 42.4/100: 42% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(6), best_friends_with_urctos_static, static_empowerment(5)
2:36.607 aoe R starfire Fluffy_Pillow 65.6/100: 66% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(4), best_friends_with_urctos_static, static_empowerment(5)
2:38.221 aoe L starfall Fluffy_Pillow 86.8/100: 87% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(2), best_friends_with_urctos_static, static_empowerment(5)
2:39.299 aoe R starfire Fluffy_Pillow 41.8/100: 42% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos, best_friends_with_urctos_static, static_empowerment(5)
2:40.913 aoe R starfire Fluffy_Pillow 61.0/100: 61% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, static_empowerment(5)
2:42.525 aoe K cancel_buff Fluffy_Pillow 84.2/100: 84% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall, starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(10), best_friends_with_urctos_static, static_empowerment(5)
2:42.525 aoe L starfall Fluffy_Pillow 84.2/100: 84% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall, balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(10), best_friends_with_urctos_static, static_empowerment(5)
2:43.732 aoe O wrath Fluffy_Pillow 39.2/100: 39% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord, dreamstate, best_friends_with_urctos(9), best_friends_with_urctos_static, static_empowerment(5)
2:44.488 aoe O wrath Fluffy_Pillow 49.2/100: 49% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord, best_friends_with_urctos(8), best_friends_with_urctos_static, static_empowerment(5)
2:45.243 aoe Q starfall Fluffy_Pillow 61.2/100: 61% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, best_friends_with_urctos(7), best_friends_with_urctos_static, static_empowerment(5)
2:46.403 aoe R starfire Fluffy_Pillow 20.2/100: 20% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_urctos(6), best_friends_with_urctos_static, static_empowerment(5)
2:48.076 aoe Q starfall Fluffy_Pillow 49.4/100: 49% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_urctos(5), best_friends_with_urctos_static, static_empowerment(5)
2:49.193 aoe R starfire Fluffy_Pillow 8.4/100: 8% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(4), best_friends_with_urctos_static, static_empowerment(5)
2:50.660 aoe R starfire Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(2), best_friends_with_urctos_static, static_empowerment(5)
2:52.129 aoe R starfire Fluffy_Pillow 60.8/100: 61% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_urctos, best_friends_with_urctos_static, static_empowerment(5)
2:53.596 aoe L starfall Fluffy_Pillow 88.0/100: 88% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, static_empowerment(5)
2:54.576 aoe L starfall Fluffy_Pillow 89.0/100: 89% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, static_empowerment(5)
2:55.556 aoe R starfire Fluffy_Pillow 56.0/100: 56% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, static_empowerment(5)
2:57.024 aoe K cancel_buff Fluffy_Pillow 75.2/100: 75% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, static_empowerment(5)
2:57.024 aoe L starfall Fluffy_Pillow 75.2/100: 75% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, static_empowerment(5)
2:58.121 aoe Q starfall Fluffy_Pillow 42.2/100: 42% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, static_empowerment(5)
2:59.173 aoe O wrath Fluffy_Pillow 9.2/100: 9% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, static_empowerment(5)
3:00.189 aoe O wrath Fluffy_Pillow 19.2/100: 19% astral_power primordial_arcanic_pulsar(20), starfall(4), starlord(2), dreamstate, best_friends_with_urctos_static, static_empowerment(5)
3:00.944 default F natures_vigil phial_of_static_empowerment_3 33.2/100: 33% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(2), dreamstate, best_friends_with_urctos_static, static_empowerment(5)
3:00.962 aoe M starfire Fluffy_Pillow 33.2/100: 33% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(2), best_friends_with_urctos_static, static_empowerment(5)
3:01.967 aoe Q starfall Fluffy_Pillow 56.4/100: 56% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(2), best_friends_with_urctos_static, static_empowerment(5)
3:03.082 aoe R starfire Fluffy_Pillow 17.4/100: 17% astral_power natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, static_empowerment(5)
3:04.696 aoe R starfire Fluffy_Pillow 42.6/100: 43% astral_power natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, static_empowerment(5)
3:06.311 aoe N incarnation_chosen_of_elune Fluffy_Pillow 69.8/100: 70% astral_power natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, static_empowerment(5)
3:06.311 default E use_items Fluffy_Pillow 69.8/100: 70% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), solstice, starfall, starlord(3), dreamstate(2), best_friends_with_urctos_static, static_empowerment(5)
3:06.311 aoe R starfire Fluffy_Pillow 69.8/100: 70% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), solstice, starfall, starlord(3), dreamstate, best_friends_with_urctos_static, static_empowerment(5), kindled_soul(100)
3:07.191 aoe L starfall Fluffy_Pillow 91.0/100: 91% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), solstice, starfall, starlord(3), dreamstate, best_friends_with_urctos_static, static_empowerment(5), kindled_soul(100)
3:08.170 aoe R starfire Fluffy_Pillow 62.0/100: 62% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, static_empowerment(5), kindled_soul(95)
3:09.051 aoe L starfall Fluffy_Pillow 87.2/100: 87% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, static_empowerment(5), kindled_soul(90)
3:10.029 aoe K cancel_buff Fluffy_Pillow 58.2/100: 58% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, static_empowerment(5), kindled_soul(85)
3:10.029 aoe L starfall Fluffy_Pillow 58.2/100: 58% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, static_empowerment(5), kindled_soul(85)
3:11.127 aoe R starfire Fluffy_Pillow 27.2/100: 27% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starfall(3), starlord, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, static_empowerment(5), kindled_soul(80)
3:12.708 aoe Q starfall Fluffy_Pillow 82.4/100: 82% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, static_empowerment(5), kindled_soul(70)
3:13.764 aoe Q starfall Fluffy_Pillow 47.4/100: 47% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, static_empowerment(5), kindled_soul(65)
3:14.779 aoe R starfire Fluffy_Pillow 14.4/100: 14% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, static_empowerment(5), kindled_soul(60)
3:16.248 aoe P fury_of_elune Fluffy_Pillow 37.6/100: 38% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, static_empowerment(5), kindled_soul(55)
3:17.229 aoe R starfire Fluffy_Pillow 42.6/100: 43% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, static_empowerment(5), kindled_soul(50)
3:18.696 aoe R starfire Fluffy_Pillow 70.8/100: 71% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, static_empowerment(5), kindled_soul(40)
3:20.164 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, static_empowerment(5), kindled_soul(35)
3:21.142 aoe R starfire Fluffy_Pillow 73.0/100: 73% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, static_empowerment(5), kindled_soul(30)
3:22.609 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, static_empowerment(5), kindled_soul(20)
3:23.589 aoe R starfire Fluffy_Pillow 75.0/100: 75% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, static_empowerment(5), kindled_soul(15)
3:25.057 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, static_empowerment(5), kindled_soul(10)
3:26.153 aoe Q starfall Fluffy_Pillow 71.0/100: 71% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(11), best_friends_with_urctos_static, static_empowerment(5), kindled_soul(5)
3:27.206 aoe Q starfall Fluffy_Pillow 40.0/100: 40% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(10), best_friends_with_urctos_static, static_empowerment(5)
3:28.221 aoe R starfire Fluffy_Pillow 13.0/100: 13% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, static_empowerment(5)
3:29.690 aoe R starfire Fluffy_Pillow 34.2/100: 34% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, static_empowerment(5)
3:31.156 aoe L starfall Fluffy_Pillow 57.4/100: 57% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(6), best_friends_with_urctos_static, static_empowerment(5)
3:32.135 aoe R starfire Fluffy_Pillow 56.4/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(6), best_friends_with_urctos_static, static_empowerment(5)
3:33.602 aoe R starfire Fluffy_Pillow 79.6/100: 80% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(4), best_friends_with_urctos_static, static_empowerment(5)
3:35.070 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(3), best_friends_with_urctos_static, static_empowerment(5)
3:36.052 aoe R starfire Fluffy_Pillow 67.0/100: 67% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(2), best_friends_with_urctos_static, static_empowerment(5)
3:37.520 aoe L starfall Fluffy_Pillow 92.2/100: 92% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, static_empowerment(5)
3:38.498 aoe R starfire Fluffy_Pillow 61.2/100: 61% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, static_empowerment(5)
3:39.965 aoe K cancel_buff Fluffy_Pillow 84.4/100: 84% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, static_empowerment(5)
3:39.965 aoe L starfall Fluffy_Pillow 84.4/100: 84% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, static_empowerment(5)
3:41.062 aoe Q starfall Fluffy_Pillow 49.4/100: 49% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(3), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, static_empowerment(5)
3:42.117 aoe R starfire Fluffy_Pillow 18.4/100: 18% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, static_empowerment(5)
3:43.637 aoe Q starfall Fluffy_Pillow 41.6/100: 42% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, static_empowerment(5)
3:44.652 aoe R starfire Fluffy_Pillow 10.6/100: 11% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, static_empowerment(5)
3:46.122 aoe R starfire Fluffy_Pillow 31.8/100: 32% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, static_empowerment(5)
3:47.591 aoe O wrath Fluffy_Pillow 55.0/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, static_empowerment(5)
3:48.571 aoe O wrath Fluffy_Pillow 67.0/100: 67% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(3), dreamstate, best_friends_with_urctos_static, static_empowerment(5)
3:49.324 aoe L starfall Fluffy_Pillow 77.0/100: 77% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), dreamstate, best_friends_with_urctos_static, static_empowerment(5)
3:50.402 aoe R starfire Fluffy_Pillow 40.0/100: 40% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, static_empowerment(5)
3:51.372 aoe L starfall Fluffy_Pillow 65.2/100: 65% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, static_empowerment(5)
3:52.449 aoe R starfire Fluffy_Pillow 56.2/100: 56% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, static_empowerment(5)
3:54.063 aoe K cancel_buff Fluffy_Pillow 83.4/100: 83% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(10), best_friends_with_pip_static, static_empowerment(5)
3:54.063 aoe L starfall Fluffy_Pillow 83.4/100: 83% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(10), best_friends_with_pip_static, static_empowerment(5)
3:55.269 aoe Q starfall Fluffy_Pillow 48.4/100: 48% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_pip(9), best_friends_with_pip_static, static_empowerment(5)
3:56.325 aoe R starfire Fluffy_Pillow 17.4/100: 17% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(4), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(8), best_friends_with_pip_static, static_empowerment(5)
3:57.846 aoe Q starfall Fluffy_Pillow 42.6/100: 43% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(6), best_friends_with_pip_static, static_empowerment(5)
3:58.862 aoe R starfire Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(5), best_friends_with_pip_static, static_empowerment(5)
4:00.329 aoe R starfire Fluffy_Pillow 42.8/100: 43% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(4), best_friends_with_pip_static, wafting_devotion, static_empowerment(5)
4:01.690 aoe R starfire Fluffy_Pillow 64.0/100: 64% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(2), best_friends_with_pip_static, wafting_devotion, static_empowerment(5)
4:03.053 aoe L starfall Fluffy_Pillow 83.2/100: 83% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_pip, best_friends_with_pip_static, wafting_devotion, static_empowerment(5)
4:03.962 aoe R starfire Fluffy_Pillow 50.2/100: 50% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, static_empowerment(5)
4:05.321 aoe L starfall Fluffy_Pillow 73.4/100: 73% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, static_empowerment(5)
4:06.230 aoe L starfall Fluffy_Pillow 72.4/100: 72% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), dreamstate(2), best_friends_with_pip_static, wafting_devotion, static_empowerment(5)
4:07.230 aoe O wrath Fluffy_Pillow 29.4/100: 29% astral_power primordial_arcanic_pulsar(25), starfall(3), starlord(3), umbral_embrace, dreamstate, best_friends_with_pip_static, wafting_devotion, static_empowerment(5)
4:07.985 aoe O wrath Fluffy_Pillow 39.4/100: 39% astral_power primordial_arcanic_pulsar(25), starfall(3), starlord(3), umbral_embrace, best_friends_with_pip_static, wafting_devotion, static_empowerment(5)
4:08.739 aoe R starfire Fluffy_Pillow 49.4/100: 49% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), umbral_embrace, best_friends_with_pip_static, wafting_devotion, static_empowerment(5)
4:10.238 aoe L starfall Fluffy_Pillow 72.6/100: 73% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), best_friends_with_pip_static, wafting_devotion, static_empowerment(5)
4:11.356 aoe R starfire Fluffy_Pillow 31.6/100: 32% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, wafting_devotion, static_empowerment(5)
4:12.968 aoe Q starfall Fluffy_Pillow 62.8/100: 63% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, wafting_devotion, static_empowerment(5)
4:14.044 aoe R starfire Fluffy_Pillow 21.8/100: 22% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion, static_empowerment(5)
4:15.596 aoe Q starfall Fluffy_Pillow 45.0/100: 45% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion, static_empowerment(5)
4:16.632 aoe R starfire Fluffy_Pillow 2.0/100: 2% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion, static_empowerment(5)
4:18.130 aoe R starfire Fluffy_Pillow 25.2/100: 25% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, static_empowerment(5)
4:19.745 aoe R starfire Fluffy_Pillow 46.4/100: 46% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, static_empowerment(5)
4:21.360 aoe R starfire Fluffy_Pillow 69.6/100: 70% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, static_empowerment(5)
4:22.976 aoe L starfall Fluffy_Pillow 90.8/100: 91% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, static_empowerment(5)
4:24.052 aoe O wrath Fluffy_Pillow 45.8/100: 46% astral_power primordial_arcanic_pulsar(45), starfall, starlord(3), dreamstate, best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, static_empowerment(5)
4:24.807 aoe O wrath Fluffy_Pillow 55.8/100: 56% astral_power primordial_arcanic_pulsar(45), starfall, starlord(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, static_empowerment(5)
4:25.561 aoe Q starfall Fluffy_Pillow 69.8/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, static_empowerment(5)
4:26.766 aoe R starfire Fluffy_Pillow 28.8/100: 29% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, static_empowerment(5)
4:28.505 aoe L starfall Fluffy_Pillow 86.0/100: 86% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, static_empowerment(5)
4:29.665 aoe Q starfall Fluffy_Pillow 45.0/100: 45% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, static_empowerment(5)
4:30.782 default F natures_vigil phial_of_static_empowerment_3 4.0/100: 4% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static, static_empowerment(5)
4:30.962 aoe P fury_of_elune Fluffy_Pillow 4.0/100: 4% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static, static_empowerment(5)
4:31.940 aoe R starfire Fluffy_Pillow 13.0/100: 13% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, static_empowerment(5)
4:33.407 aoe R starfire Fluffy_Pillow 47.2/100: 47% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, static_empowerment(5)
4:34.874 aoe L starfall Fluffy_Pillow 85.4/100: 85% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, static_empowerment(5)
4:35.854 aoe R starfire Fluffy_Pillow 62.4/100: 62% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, static_empowerment(5)
4:37.323 default E use_items Fluffy_Pillow 96.6/100: 97% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, static_empowerment(5)
4:37.323 aoe L starfall Fluffy_Pillow 96.6/100: 97% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, static_empowerment(5), kindled_soul(100)
4:38.304 aoe L starfall Fluffy_Pillow 71.6/100: 72% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, static_empowerment(5), kindled_soul(100)
4:39.283 aoe R starfire Fluffy_Pillow 42.6/100: 43% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, static_empowerment(5), kindled_soul(95)
4:40.750 aoe O wrath Fluffy_Pillow 63.8/100: 64% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, static_empowerment(5), kindled_soul(85)
4:41.846 aoe L starfall Fluffy_Pillow 73.8/100: 74% astral_power natures_vigil, primordial_arcanic_pulsar(15), starfall(3), dreamstate(2), best_friends_with_aerwynn_static, static_empowerment(5), kindled_soul(80)
4:43.052 aoe O wrath Fluffy_Pillow 30.8/100: 31% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(3), starlord, dreamstate, best_friends_with_aerwynn_static, static_empowerment(5), kindled_soul(75)
4:43.807 aoe R starfire Fluffy_Pillow 42.8/100: 43% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord, best_friends_with_aerwynn_static, static_empowerment(5), kindled_soul(70)
4:44.851 aoe L starfall Fluffy_Pillow 66.0/100: 66% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord, best_friends_with_aerwynn_static, static_empowerment(5), kindled_soul(65)
4:46.010 aoe Q starfall Fluffy_Pillow 57.0/100: 57% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, static_empowerment(5), kindled_soul(60)
4:47.128 aoe R starfire Fluffy_Pillow 18.0/100: 18% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, static_empowerment(5), kindled_soul(55)
4:48.742 aoe R starfire Fluffy_Pillow 43.2/100: 43% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, static_empowerment(5), kindled_soul(45)
4:50.355 aoe R starfire Fluffy_Pillow 68.4/100: 68% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, wafting_devotion, static_empowerment(5), kindled_soul(35)
4:51.851 aoe L starfall Fluffy_Pillow 89.6/100: 90% astral_power eclipse_lunar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, wafting_devotion, static_empowerment(5), kindled_soul(30)
4:52.852 aoe R starfire Fluffy_Pillow 44.6/100: 45% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, wafting_devotion, static_empowerment(5), kindled_soul(25)
4:54.349 aoe R starfire Fluffy_Pillow 65.8/100: 66% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, wafting_devotion, static_empowerment(5), kindled_soul(15)
4:55.845 aoe K cancel_buff Fluffy_Pillow 87.0/100: 87% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, wafting_devotion, static_empowerment(5), kindled_soul(10)
4:55.845 aoe L starfall Fluffy_Pillow 87.0/100: 87% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, wafting_devotion, static_empowerment(5), kindled_soul(10)
4:56.965 aoe R starfire Fluffy_Pillow 42.0/100: 42% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, wafting_devotion, static_empowerment(5), kindled_soul(5)
4:58.578 aoe O wrath Fluffy_Pillow 63.2/100: 63% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, wafting_devotion, static_empowerment(5)
4:59.656 aoe L starfall Fluffy_Pillow 73.2/100: 73% astral_power primordial_arcanic_pulsar(40), starfall(2), starlord, dreamstate(2), best_friends_with_aerwynn_static, wafting_devotion, static_empowerment(5)
5:00.734 aoe O wrath Fluffy_Pillow 32.2/100: 32% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(2), dreamstate, best_friends_with_aerwynn_static, wafting_devotion, static_empowerment(5)
5:01.488 aoe R starfire Fluffy_Pillow 42.2/100: 42% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), best_friends_with_aerwynn_static, wafting_devotion, static_empowerment(5)
5:02.420 aoe Q starfall Fluffy_Pillow 67.4/100: 67% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), best_friends_with_aerwynn_static, wafting_devotion, static_empowerment(5)
5:03.456 aoe R starfire Fluffy_Pillow 26.4/100: 26% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, wafting_devotion, static_empowerment(5)
5:04.953 aoe R starfire Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, wafting_devotion, static_empowerment(5)
5:06.451 aoe L starfall Fluffy_Pillow 78.8/100: 79% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, static_empowerment(5)
5:07.528 aoe R starfire Fluffy_Pillow 67.8/100: 68% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, static_empowerment(5)
5:09.143 aoe K cancel_buff Fluffy_Pillow 91.0/100: 91% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, static_empowerment(5)
5:09.143 aoe L starfall Fluffy_Pillow 91.0/100: 91% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, static_empowerment(5)
5:10.349 aoe Q starfall Fluffy_Pillow 52.0/100: 52% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, static_empowerment(5)
5:11.402 aoe R starfire Fluffy_Pillow 21.0/100: 21% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, static_empowerment(5)
5:12.923 aoe Q starfall Fluffy_Pillow 44.2/100: 44% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, static_empowerment(5)
5:13.939 aoe R starfire Fluffy_Pillow 15.2/100: 15% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, static_empowerment(5)
5:15.407 aoe R starfire Fluffy_Pillow 42.4/100: 42% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn, best_friends_with_aerwynn_static, static_empowerment(5)
5:16.874 aoe R starfire Fluffy_Pillow 63.6/100: 64% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, static_empowerment(5)
5:18.340 aoe L starfall Fluffy_Pillow 84.8/100: 85% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, static_empowerment(5)
5:19.320 aoe R starfire Fluffy_Pillow 51.8/100: 52% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, static_empowerment(5)
5:20.787 default D potion Fluffy_Pillow 71.0/100: 71% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, static_empowerment(5)
5:20.787 aoe L starfall Fluffy_Pillow 71.0/100: 71% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, static_empowerment(5), elemental_potion_of_ultimate_power
5:21.765 aoe O wrath Fluffy_Pillow 38.0/100: 38% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), umbral_embrace, dreamstate, best_friends_with_aerwynn_static, static_empowerment(5), elemental_potion_of_ultimate_power
5:22.519 aoe O wrath Fluffy_Pillow 48.0/100: 48% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), umbral_embrace, best_friends_with_aerwynn_static, static_empowerment(5), elemental_potion_of_ultimate_power
5:23.273 aoe R starfire Fluffy_Pillow 60.0/100: 60% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), umbral_embrace, best_friends_with_aerwynn_static, static_empowerment(5), elemental_potion_of_ultimate_power
5:24.887 aoe L starfall Fluffy_Pillow 89.2/100: 89% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), best_friends_with_aerwynn_static, static_empowerment(5), elemental_potion_of_ultimate_power
5:26.094 aoe L starfall Fluffy_Pillow 48.2/100: 48% astral_power balance_of_all_things_arcane(6), eclipse_lunar, owlkin_frenzy, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, static_empowerment(5), elemental_potion_of_ultimate_power
5:27.254 aoe R starfire Fluffy_Pillow 39.2/100: 39% astral_power balance_of_all_things_arcane(4), eclipse_lunar, owlkin_frenzy, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, static_empowerment(5), elemental_potion_of_ultimate_power
5:28.371 aoe Q starfall Fluffy_Pillow 64.4/100: 64% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, static_empowerment(5), elemental_potion_of_ultimate_power
5:29.487 aoe R starfire Fluffy_Pillow 23.4/100: 23% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, static_empowerment(5), elemental_potion_of_ultimate_power
5:31.101 aoe R starfire Fluffy_Pillow 42.6/100: 43% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, static_empowerment(5), elemental_potion_of_ultimate_power
5:32.714 aoe R starfire Fluffy_Pillow 67.8/100: 68% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, static_empowerment(5), elemental_potion_of_ultimate_power
5:34.329 aoe L starfall Fluffy_Pillow 87.0/100: 87% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall, starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, static_empowerment(5), elemental_potion_of_ultimate_power
5:35.408 aoe R starfire Fluffy_Pillow 46.0/100: 46% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, static_empowerment(5), elemental_potion_of_ultimate_power
5:37.022 aoe R starfire Fluffy_Pillow 65.2/100: 65% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, static_empowerment(5), elemental_potion_of_ultimate_power
5:38.636 aoe K cancel_buff Fluffy_Pillow 81.2/100: 81% astral_power primordial_arcanic_pulsar(40), starfall, starlord(3), dreamstate(2), best_friends_with_aerwynn_static, static_empowerment(5), elemental_potion_of_ultimate_power
5:38.636 aoe L starfall Fluffy_Pillow 81.2/100: 81% astral_power primordial_arcanic_pulsar(40), starfall, dreamstate(2), best_friends_with_aerwynn_static, static_empowerment(5), elemental_potion_of_ultimate_power
5:39.841 aoe O wrath Fluffy_Pillow 40.2/100: 40% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord, dreamstate, best_friends_with_aerwynn_static, static_empowerment(5), elemental_potion_of_ultimate_power
5:40.597 aoe O wrath Fluffy_Pillow 50.2/100: 50% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord, best_friends_with_aerwynn_static, static_empowerment(5), elemental_potion_of_ultimate_power
5:41.350 aoe P fury_of_elune Fluffy_Pillow 60.2/100: 60% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord, best_friends_with_aerwynn_static, static_empowerment(5), elemental_potion_of_ultimate_power
5:42.508 aoe L starfall Fluffy_Pillow 72.2/100: 72% astral_power balance_of_all_things_arcane(7), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(45), solstice, starfall, starlord, best_friends_with_aerwynn_static, wafting_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
5:43.585 aoe R starfire Fluffy_Pillow 39.2/100: 39% astral_power balance_of_all_things_arcane(6), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, wafting_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
5:45.138 aoe L starfall Fluffy_Pillow 75.4/100: 75% astral_power balance_of_all_things_arcane(5), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, wafting_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
5:46.173 aoe R starfire Fluffy_Pillow 42.4/100: 42% astral_power balance_of_all_things_arcane(4), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, wafting_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
5:47.670 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(2), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, wafting_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
5:48.671 aoe R starfire Fluffy_Pillow 69.0/100: 69% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, wafting_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
5:50.033 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, wafting_devotion, static_empowerment(5), elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (tauren) Raid-Buffed Unbuffed Gear Amount
Strength 898 2 986 900 0
Agility 2089 -2 2173 2087 0
Stamina 3848 2 44833 42698 38825
Intellect 2089 -2 15944 14885 12090 (7538)
Spirit 0 0 0 0 0
Health 896660 896660 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 15944 14885 0
Crit 22.30% 22.30% 3114
Haste 24.78% 24.78% 4212
Versatility 6.30% 1.30% 267
Mana Regen 2560 2560 0
Attack Power 16582 15480 0
Mastery 30.74% 30.74% 8152
Armor 5324 5324 5324
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 489.00
Local Head Benevolent Embersage's Casque
ilevel: 489, stats: { 673 Armor, +3966 Sta, +704 Crit, +330 Haste, +938 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }, enchant: incandescent_essence
Local Neck Eye of the Rising Flame
ilevel: 489, stats: { +2231 Sta, +256 Haste, +1537 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Life-Bound Shoulderpads
ilevel: 486, stats: { 603 Armor, +2875 Sta, +383 Mastery, +383 Haste, +684 AgiInt }
item effects: { equip: Toxified }
Local Chest Benevolent Embersage's Robe
ilevel: 489, stats: { 897 Armor, +3966 Sta, +715 Crit, +318 Mastery, +938 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 489, stats: { 505 Armor, +2975 Sta, +535 Haste, +241 Mastery, +704 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 489, stats: { 785 Armor, +3966 Sta, +705 Haste, +328 Mastery, +938 AgiInt }, enchant: { +155 StrAgiInt, +41 Vers (lambent_armor_kit_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 486, stats: { 548 Armor, +2875 Sta, +274 Crit, +438 Haste, +684 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Thermal Bindings
ilevel: 489, stats: { 449 Armor, +2231 Sta, +191 Crit, +390 Mastery, +528 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Benevolent Embersage's Talons
ilevel: 489, stats: { 505 Armor, +2975 Sta, +226 Vers, +549 Mastery, +704 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 489, stats: { +2231 Sta, +512 Haste, +1281 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 489, stats: { +2231 Sta, +1230 Crit, +564 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 489, stats: { +892 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 489, stats: { +738 Mastery }
item effects: { use: Balefire Branch }
Local Back Drape of the Loyal Vassal
ilevel: 489, stats: { 359 Armor, +2231 Sta, +328 Haste, +253 Mastery, +528 StrAgiInt }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 489, weapon: { 606 - 781, 2.6 }, stats: { +469 Int, +2264 Int, +1983 Sta, +156 Haste, +361 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 489, stats: { +1439 Int, +1983 Sta, +174 Haste, +343 Mastery }

Profile

druid="phial_of_static_empowerment_3"
source=default
spec=balance
level=70
race=tauren
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:hissing_rune_3

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=489,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=489,gem_id=192961/192961/192961
shoulders=lifebound_shoulderpads,id=193406,bonus_id=8836/1576/8797/8960,ilevel=486,crafted_stats=49/36
back=drape_of_the_loyal_vassal,id=158375,bonus_id=4795,ilevel=489
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=489,enchant_id=6625
wrists=thermal_bindings,id=134461,bonus_id=4795,ilevel=489,gem_id=192961
hands=benevolent_embersages_talons,id=207255,bonus_id=4795,ilevel=489
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=489,enchant_id=6830
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=486
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=489
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=489
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=489,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=489

# Gear Summary
# gear_ilvl=488.63
# gear_stamina=38825
# gear_intellect=12090
# gear_crit_rating=3114
# gear_haste_rating=4212
# gear_mastery_rating=8152
# gear_versatility_rating=267
# gear_armor=5324
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

phial_of_tepid_versatility_3 : 931117 dps, 169766 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
931117.3 931117.3 463.3 / 0.050% 87021.6 / 9.3% 67539.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.8 13.9 Astral Power 0.00% 56.4 99.9% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
phial_of_tepid_versatility_3 931117
Astral Smolder 132927 14.3% 350.9 0.91s 113192 0 Periodic 709.8 55955 0 55955 0.0% 79.0%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 350.89 0.00 709.83 709.83 258.69 0.0000 2.0000 39718251.83 39718251.83 0.00% 27977.38 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 709.83 518 907 55954.96 4855 266503 56030.07 48164 65833 39718252 39718252 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Fury of Elune 28375 3.0% 5.1 65.01s 1657925 1715719 Direct 763.4 7151 15227 11104 48.9%

Stats Details: Fury Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.11 763.35 0.00 0.00 0.00 0.9665 0.0000 8475652.53 8475652.53 0.00% 1715719.14 1715719.14
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 51.06% 389.74 243 564 7150.70 3434 22962 7158.76 6224 8155 2786818 2786818 0.00%
crit 48.94% 373.61 238 548 15227.36 7006 46843 15241.76 13588 17893 5688835 5688835 0.00%

Action Details: Fury Of Elune

  • id:202770
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:astral_power
  • energize_amount:3.0

Spelldata

  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r

Action Details: Fury Of Elune Tick

  • id:211545
  • school:astral
  • range:105.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.149000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:211545
  • name:Fury of Elune
  • school:astral
  • tooltip:
  • description:{$@spelldesc202770=Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r}

Action Priority List

    aoe
    [P]:5.11
  • if_expr:target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Hungering Shadowflame 3809 0.4% 17.0 17.11s 67059 0 Direct 17.0 53722 109481 67057 23.9%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.00 17.00 0.00 0.00 0.00 0.0000 0.0000 1140014.36 1140014.36 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.08% 12.93 3 28 53721.98 36131 208205 53546.45 36131 120812 694850 694850 0.00%
crit 23.92% 4.07 0 14 109481.48 73707 424738 107482.04 0 424738 445165 445165 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:31299.68
  • base_dd_max:31299.68
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 7097 0.8% 34.3 8.60s 61867 0 Direct 34.2 49724 101346 62027 23.8%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.32 34.23 0.00 0.00 0.00 0.0000 0.0000 2123105.85 2123105.85 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.17% 26.07 9 49 49724.30 49127 56620 49724.11 49127 51781 1296380 1296380 0.00%
crit 23.83% 8.16 0 21 101346.11 100220 115504 101281.11 0 111365 826726 826726 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42559.30
  • base_dd_max:42559.30
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 77354 8.3% 3.0 1.05s 7712077 8376622 Direct 6.0 7253 14780 10545 43.8%
Periodic 1819.9 9083 18752 12679 37.2% 99.1%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.00 6.00 1819.85 1819.85 0.00 0.9208 0.9788 23136231.08 23136231.08 0.00% 12968.19 8376622.40
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.25% 3.37 0 6 7252.94 7159 8394 7194.85 0 8394 24477 24477 0.00%
crit 43.75% 2.63 0 6 14779.53 14604 17124 14305.29 0 17124 38797 38797 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 62.81% 1143.07 850 1441 9083.09 6922 14920 9083.17 8830 9348 10382406 10382406 0.00%
crit 37.19% 676.78 482 892 18751.58 14121 30436 18755.15 18179 19386 12690551 12690551 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    aoe
    [J]:3.00
  • if_expr:!fight_style.dungeonroute
  • target_if_expr:refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (82125) 0.0% (8.8%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 20306 2.2% 235.8 1.47s 25749 0 Direct 235.2 16779 36031 25818 46.9%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 235.79 235.17 0.00 0.00 0.00 0.0000 0.0000 6071508.39 6071508.39 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.05% 124.77 75 176 16778.91 11573 31397 16787.50 15575 18229 2093418 2093418 0.00%
crit 46.95% 110.41 62 160 36031.49 23609 64449 36062.09 33818 38747 3978091 3978091 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 20381 2.2% 237.4 1.46s 25666 0 Direct 236.8 16732 35913 25733 46.9%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 237.44 236.82 0.00 0.00 0.00 0.0000 0.0000 6094056.76 6094056.76 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.07% 125.69 77 182 16732.10 10413 31593 16740.14 15567 18059 2102963 2102963 0.00%
crit 46.93% 111.14 70 166 35912.50 21242 64449 35941.83 33576 38981 3991093 3991093 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 41438 4.5% 15.8 19.19s 785515 0 Direct 94.4 85335 183727 131312 46.7%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.77 94.36 0.00 0.00 0.00 0.0000 0.0000 12389450.36 12389450.36 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.27% 50.27 23 81 85335.08 42925 315029 85408.44 64512 106525 4289675 4289675 0.00%
crit 46.73% 44.09 21 75 183727.10 87566 632569 183885.01 142469 238993 8099775 8099775 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfall 313627 33.7% 104.7 2.84s 895129 884917 Direct 1765.8 36079 77940 53070 40.6%

Stats Details: Starfall

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 104.69 1765.83 0.00 0.00 0.00 1.0115 0.0000 93710048.73 93710048.73 0.00% 884916.94 884916.94
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.41% 1049.09 752 1331 36078.64 7918 140798 36160.41 32884 40024 37849141 37849141 0.00%
crit 40.59% 716.74 531 933 77940.37 16152 287228 78089.10 71550 87340 55860908 55860908 0.00%

Action Details: Starfall

  • id:191034
  • school:astral
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:45.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]

Action Details: Starfall Damage

  • id:191037
  • school:astral
  • range:200.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.114000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.41

Spelldata

  • id:191037
  • name:Starfall
  • school:astral
  • tooltip:
  • description:{$@spelldesc191034=Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]}

Action Priority List

    aoe
    [L]:70.52
  • if_expr:variable.starfall_condition1
    aoe
    [Q]:34.17
  • if_expr:variable.starfall_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountLunar Shrapnel4151691PCT0.200
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 209731 22.5% 117.7 2.51s 532484 381896 Direct 712.4 56602 122088 88001 47.9%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.73 712.36 0.00 0.00 0.00 1.3943 0.0000 62687868.99 62687868.99 0.00% 381896.14 381896.14
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.05% 370.80 259 498 56601.58 7761 254215 56628.98 50570 63722 20987086 20987086 0.00%
crit 47.95% 341.57 245 450 122087.95 15832 518599 122145.98 109463 140883 41700783 41700783 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    aoe
    [M]:1.27
  • if_expr:buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
    aoe
    [R]:116.99
  • if_expr:spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Solar)4851710.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Critical Strike Chance Balance of All Things39405010.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Sunfire16481550.283Mastery
Sunfire 64769 7.0% 1.0 0.00s 19357597 20859479 Direct 1.0 5694 11612 7038 22.7%
Periodic 1832.7 7648 16369 10558 33.4% 99.8%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 1832.75 1832.75 0.00 0.9285 0.9785 19357596.71 19357596.71 0.00% 10788.82 20859479.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.30% 0.77 0 1 5693.76 5659 5731 4401.55 0 5731 4402 4402 0.00%
crit 22.70% 0.23 0 1 11611.96 11545 11691 2635.34 0 11691 2635 2635 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 66.63% 1221.15 911 1536 7648.31 5721 13223 7652.27 7439 7924 9339583 9339583 0.00%
crit 33.37% 611.60 452 809 16368.76 11671 26976 16379.33 15773 17077 10010976 10010976 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    aoe
    [I]:1.00
  • target_if_expr:refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (7038) 0.0% (0.8%) 8.4 32.22s 249483 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.44 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 3679 0.4% 8.4 32.22s 130404 0 Direct 50.7 17428 35515 21734 23.8%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.44 50.66 0.00 0.00 0.00 0.0000 0.0000 1100968.91 1100968.91 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.19% 38.60 7 94 17427.62 17216 19841 17427.93 17216 18911 672616 672616 0.00%
crit 23.81% 12.06 0 36 35514.73 35120 40477 35518.16 0 40030 428353 428353 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:51134.41
  • base_dd_max:51134.41
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 3359 0.4% 16.2 15.82s 62027 0 Direct 97.2 8291 16899 10338 23.8%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.21 97.25 0.00 0.00 0.00 0.0000 0.0000 1005348.53 1005348.53 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.22% 74.13 14 192 8291.19 8192 9441 8291.42 8192 8816 614592 614592 0.00%
crit 23.78% 23.12 2 61 16898.89 16711 19260 16903.05 16711 18517 390757 390757 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24330.91
  • base_dd_max:24330.91
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 4266 0.5% 26.4 10.32s 48569 63028 Direct 26.3 35681 72660 48843 35.6%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.43 26.28 0.00 0.00 0.00 0.7706 0.0000 1283555.85 1283555.85 0.00% 63027.54 63027.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 64.41% 16.93 6 29 35681.19 15696 69309 35599.77 25238 44476 603943 603943 0.00%
crit 35.59% 9.35 1 20 72659.78 32020 139170 72552.51 37304 105275 679613 679613 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    aoe
    [O]:24.50
  • if_expr:!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.800Spell Data
Eclipse (Solar)4851710.150Current Value
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Umbral Embrace39376310.250Default ValueNo-stacks, Conditional
Eclipse (Lunar)4851810.150Spell DataConditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Critical Strike Chance Balance of All Things39404910.030Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
phial_of_tepid_versatility_3
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_tepid_versatility_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Phial of Tepid Versatility 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371172
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_tepid_versatility_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_tepid_versatility_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 181.02s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    aoe
    [N]:2.00
  • if_expr:variable.cd_condition_aoe

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.43s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.73 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:phial_of_tepid_versatility_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.73
Elemental Potion of Ultimate Power 1.4 306.93s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.44 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.44
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 17.4 6.0 17.7s 13.4s 9.6s 55.85% 57.87% 6.0 (20.5) 16.8

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.5s
  • trigger_min/max:0.0s / 37.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.7s
  • uptime_min/max:51.01% / 59.07%

Stack Uptimes

  • balance_of_all_things_arcane_1:5.73%
  • balance_of_all_things_arcane_2:6.12%
  • balance_of_all_things_arcane_3:6.62%
  • balance_of_all_things_arcane_4:7.04%
  • balance_of_all_things_arcane_5:7.33%
  • balance_of_all_things_arcane_6:7.55%
  • balance_of_all_things_arcane_7:7.68%
  • balance_of_all_things_arcane_8:7.76%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 10.2 0.0 29.9s 29.7s 7.9s 27.19% 30.46% 0.0 (0.1) 10.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 48.2s
  • trigger_min/max:3.8s / 48.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:24.72% / 29.96%

Stack Uptimes

  • balance_of_all_things_nature_1:3.36%
  • balance_of_all_things_nature_2:3.37%
  • balance_of_all_things_nature_3:3.39%
  • balance_of_all_things_nature_4:3.40%
  • balance_of_all_things_nature_5:3.41%
  • balance_of_all_things_nature_6:3.41%
  • balance_of_all_things_nature_7:3.42%
  • balance_of_all_things_nature_8:3.43%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 15.1 86.4 20.3s 2.9s 17.5s 88.23% 0.00% 35.5 (35.5) 0.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 59.5s
  • trigger_min/max:0.8s / 13.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:83.12% / 92.69%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:13.37%
  • balance_t31_4pc_buff_lunar_2:13.65%
  • balance_t31_4pc_buff_lunar_3:13.93%
  • balance_t31_4pc_buff_lunar_4:11.73%
  • balance_t31_4pc_buff_lunar_5:35.55%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 8.2 57.1 38.0s 4.4s 18.9s 52.02% 0.00% 26.5 (26.5) 0.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 84.2s
  • trigger_min/max:0.8s / 40.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:46.52% / 59.51%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:7.43%
  • balance_t31_4pc_buff_solar_2:6.44%
  • balance_t31_4pc_buff_solar_3:6.29%
  • balance_t31_4pc_buff_solar_4:6.43%
  • balance_t31_4pc_buff_solar_5:25.43%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 70.0s 70.0s 10.8s 10.09% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 344.2s
  • trigger_min/max:12.0s / 344.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 34.85%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.90%
  • best_friends_with_aerwynn_2:0.90%
  • best_friends_with_aerwynn_3:0.91%
  • best_friends_with_aerwynn_4:0.91%
  • best_friends_with_aerwynn_5:0.91%
  • best_friends_with_aerwynn_6:0.92%
  • best_friends_with_aerwynn_7:0.92%
  • best_friends_with_aerwynn_8:0.92%
  • best_friends_with_aerwynn_9:0.93%
  • best_friends_with_aerwynn_10:0.93%
  • best_friends_with_aerwynn_11:0.93%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 113.9s 70.0s 45.4s 33.28% 0.00% 69.0 (69.0) 0.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 347.8s
  • trigger_min/max:12.0s / 344.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 302.7s
  • uptime_min/max:0.00% / 99.49%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.28%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 69.1s 69.1s 10.8s 10.13% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 320.7s
  • trigger_min/max:12.0s / 320.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 33.25%

Stack Uptimes

  • best_friends_with_pip_1:0.90%
  • best_friends_with_pip_2:0.91%
  • best_friends_with_pip_3:0.91%
  • best_friends_with_pip_4:0.91%
  • best_friends_with_pip_5:0.92%
  • best_friends_with_pip_6:0.92%
  • best_friends_with_pip_7:0.92%
  • best_friends_with_pip_8:0.93%
  • best_friends_with_pip_9:0.93%
  • best_friends_with_pip_10:0.93%
  • best_friends_with_pip_11:0.94%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 112.6s 69.1s 45.1s 33.25% 0.00% 68.8 (68.8) 0.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.9s / 350.8s
  • trigger_min/max:12.0s / 320.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 267.8s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.25%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 69.9s 69.9s 10.8s 10.13% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 335.5s
  • trigger_min/max:12.0s / 335.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 34.50%

Stack Uptimes

  • best_friends_with_urctos_1:0.91%
  • best_friends_with_urctos_2:0.91%
  • best_friends_with_urctos_3:0.91%
  • best_friends_with_urctos_4:0.91%
  • best_friends_with_urctos_5:0.92%
  • best_friends_with_urctos_6:0.92%
  • best_friends_with_urctos_7:0.92%
  • best_friends_with_urctos_8:0.93%
  • best_friends_with_urctos_9:0.93%
  • best_friends_with_urctos_10:0.93%
  • best_friends_with_urctos_11:0.94%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 113.1s 69.9s 45.5s 33.47% 0.00% 69.8 (69.8) 0.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 349.5s
  • trigger_min/max:12.0s / 335.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 340.7s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.47%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.55% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.55%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Dreamstate 15.3 0.1 20.3s 21.3s 2.1s 10.84% 20.61% 0.1 (0.1) 0.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 55.0s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.2s
  • uptime_min/max:7.81% / 15.83%

Stack Uptimes

  • dreamstate_1:7.38%
  • dreamstate_2:3.46%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 13.2 8.1 23.6s 14.8s 21.0s 93.11% 93.82% 8.1 (8.1) 12.3

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.6s / 71.6s
  • trigger_min/max:0.0s / 58.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.0s
  • uptime_min/max:90.36% / 96.07%

Stack Uptimes

  • eclipse_lunar_1:93.11%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 8.2 0.0 38.1s 38.1s 19.2s 52.77% 54.69% 0.0 (0.0) 7.9

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 84.5s
  • trigger_min/max:12.0s / 84.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:47.06% / 59.91%

Stack Uptimes

  • eclipse_solar_1:52.77%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 306.2s 306.2s 27.3s 12.92% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 326.0s
  • trigger_min/max:300.0s / 326.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.76% / 17.86%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.92%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Fury of Elune 5.1 0.0 65.1s 65.1s 7.9s 13.51% 0.00% 75.7 (75.7) 4.9

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:60.0s / 88.7s
  • trigger_min/max:60.0s / 88.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:10.73% / 15.61%

Stack Uptimes

  • fury_of_elune_1:13.51%

Spelldata

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing up to {$=}<dmg> Astral damage over {$d=8 seconds} within its area. Damage reduced on secondary targets. |cFFFFFFFFGenerates {$=}{{$m3=30}/10/{$t3=0.500}*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 8.2 0.0 38.1s 38.1s 19.2s 52.77% 55.40% 0.0 (0.0) 7.9

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 84.5s
  • trigger_min/max:12.0s / 84.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:47.06% / 59.91%

Stack Uptimes

  • incarnation_chosen_of_elune_1:52.77%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.7 0.0 90.9s 90.9s 19.5s 23.98% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:65.76

Trigger Details

  • interval_min/max:90.0s / 121.9s
  • trigger_min/max:90.0s / 121.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.54% / 26.99%

Stack Uptimes

  • kindled_soul_5:1.17%
  • kindled_soul_10:1.17%
  • kindled_soul_15:1.18%
  • kindled_soul_20:1.18%
  • kindled_soul_25:1.18%
  • kindled_soul_30:1.19%
  • kindled_soul_35:1.19%
  • kindled_soul_40:1.19%
  • kindled_soul_45:1.19%
  • kindled_soul_50:1.20%
  • kindled_soul_55:1.20%
  • kindled_soul_60:1.20%
  • kindled_soul_65:1.21%
  • kindled_soul_70:1.21%
  • kindled_soul_75:1.21%
  • kindled_soul_80:1.22%
  • kindled_soul_85:1.22%
  • kindled_soul_90:1.22%
  • kindled_soul_95:1.23%
  • kindled_soul_100:1.23%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Vigil 3.7 0.0 90.4s 90.4s 14.7s 18.40% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.5s
  • trigger_min/max:90.0s / 91.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.51% / 21.04%

Stack Uptimes

  • natures_vigil_1:18.40%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.6 0.0 69.3s 68.6s 0.9s 0.77% 1.17% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 343.9s
  • trigger_min/max:0.0s / 343.9s
  • trigger_pct:15.12%
  • duration_min/max:0.0s / 6.4s
  • uptime_min/max:0.00% / 5.79%

Stack Uptimes

  • owlkin_frenzy_1:0.77%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 9.2 96.4 34.0s 34.0s 29.8s 91.35% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.6s / 47.5s
  • trigger_min/max:20.6s / 47.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 45.4s
  • uptime_min/max:87.44% / 94.75%

Stack Uptimes

  • primordial_arcanic_pulsar_5:7.23%
  • primordial_arcanic_pulsar_10:6.74%
  • primordial_arcanic_pulsar_15:7.53%
  • primordial_arcanic_pulsar_20:8.32%
  • primordial_arcanic_pulsar_25:8.65%
  • primordial_arcanic_pulsar_30:8.41%
  • primordial_arcanic_pulsar_35:8.67%
  • primordial_arcanic_pulsar_40:9.02%
  • primordial_arcanic_pulsar_45:9.07%
  • primordial_arcanic_pulsar_50:8.83%
  • primordial_arcanic_pulsar_55:8.87%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 19.7 3.7 15.6s 13.4s 6.7s 43.99% 43.19% 3.7 (3.7) 19.3

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 43.4s
  • trigger_min/max:0.0s / 37.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:40.25% / 47.09%

Stack Uptimes

  • solstice_1:43.99%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starfall 104.7 0.0 143.0s 2.8s 295.6s 98.88% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_starfall
  • max_stacks:20
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:asynchronous
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.9s / 357.8s
  • trigger_min/max:0.7s / 8.8s
  • trigger_pct:99.99%
  • duration_min/max:1.5s / 358.1s
  • uptime_min/max:98.44% / 99.49%

Stack Uptimes

  • starfall_1:5.25%
  • starfall_2:32.43%
  • starfall_3:42.27%
  • starfall_4:15.23%
  • starfall_5:3.35%
  • starfall_6:0.36%
  • starfall_7:0.00%

Spelldata

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars on nearby enemies.
  • description:Calls down waves of falling stars upon enemies within {$50286=}A1 yds, dealing {$=}<damage> Astral damage over {$191034d=8 seconds}. Multiple uses of this ability may overlap.{$?s327541=true}[ Extends the duration of active Moonfires and Sunfires by {$327541s1=4} sec.][]
  • max_stacks:20
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Starlord 21.0 83.7 14.5s 2.8s 13.9s 97.48% 0.00% 42.4 (42.4) 6.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 19.2s
  • trigger_min/max:0.8s / 8.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:94.54% / 99.27%

Stack Uptimes

  • starlord_1:12.58%
  • starlord_2:17.69%
  • starlord_3:67.21%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Umbral Embrace 23.1 2.7 12.7s 11.3s 1.6s 12.40% 0.00% 2.7 (2.7) 0.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_umbral_embrace
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 55.9s
  • trigger_min/max:0.0s / 55.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.2s
  • uptime_min/max:3.31% / 25.16%

Stack Uptimes

  • umbral_embrace_1:12.40%

Spelldata

  • id:393763
  • name:Umbral Embrace
  • tooltip:Your next Wrath or Starfire cast during an Eclipse deals Astral damage and deals {$=}w1% additional damage.
  • description:{$@spelldesc393760=Dealing Astral damage has a chance to cause your next Wrath or Starfire cast during an Eclipse to become Astral and deal {$s1=25}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Wafting Devotion 4.3 1.2 61.1s 45.6s 16.5s 23.64% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 221.1s
  • trigger_min/max:0.0s / 221.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.9s
  • uptime_min/max:4.39% / 57.65%

Stack Uptimes

  • wafting_devotion_1:23.64%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Tepid Versatility

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_phial_of_tepid_versatility
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Phial of Tepid Versatility

Stat Details

  • stat:versatility_rating
  • amount:745.00

Spelldata

  • id:371172
  • name:Phial of Tepid Versatility
  • tooltip:Versatility increased by {$=}w1.
  • description:Increases your Versatility by {$s1=315}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Primordial Arcanic Pulsar 8.3 6.0 10.0 35.2s 22.1s 48.2s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.05% 0.00% 0.72% 0.0s 0.0s 1.0s
Astral Smolder 72.12% 61.99% 81.11% 3.9s 0.0s 39.4s
Incarnation (Total) 52.77% 47.06% 59.91% 19.2s 0.0s 54.0s
Incarnation (Pulsar) 32.45% 29.53% 34.98% 11.8s 0.0s 12.0s
Lunar Eclipse Only 40.35% 32.74% 46.38% 9.2s 0.0s 15.0s
No Eclipse 6.85% 3.68% 9.64% 1.7s 0.0s 4.5s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Fury of Elune5.2350.00028.72826.7746.13274.085

Eclipse Utilization

NoneSolarLunarBoth
Wrath24.43100.0%0.000.0%0.000.0%0.000.0%
Starfire2.452.1%0.000.0%49.8041.9%66.4856.0%
Starfall20.767.0%0.000.0%117.7739.8%157.0853.1%
Fury of Elune15.672.1%0.000.0%142.8518.7%604.8379.2%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
phial_of_tepid_versatility_3
Fury of EluneAstral Power80.63241.515.79%3.000.390.16%
MoonfireAstral Power3.0018.000.43%6.000.000.00%
Orbit BreakerAstral Power15.77471.0911.29%29.872.060.43%
Shooting Stars (Moonfire)Astral Power235.79471.2911.29%2.000.280.06%
Shooting Stars (Sunfire)Astral Power237.43474.5711.37%2.000.290.06%
StarfireAstral Power118.732226.9653.36%18.7634.961.55%
SunfireAstral Power1.006.000.14%6.000.000.00%
WrathAstral Power26.43264.276.33%10.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
phial_of_tepid_versatility_3
StarfallAstral Power 105.064135.00100.00%39.3639.5022662.67
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 896660.0 1907.54 2187.69 4270380.7 812782.2 370416.3 896660.0
Astral Power 20.0 13.94 13.76 38.0 53.3 0.0 100.0

Statistics & Data Analysis

Fight Length
phial_of_tepid_versatility_3 Fight Length
Count 9046
Mean 299.41
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 20.04%
Standard Deviation 34.9182
5th Percentile 245.99
95th Percentile 354.38
( 95th Percentile - 5th Percentile ) 108.39
Mean Distribution
Standard Deviation 0.3671
95.00% Confidence Interval ( 298.69 - 300.12 )
Normalized 95.00% Confidence Interval ( 99.76% - 100.24% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 523
0.1% Error 52250
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1041
DPS
phial_of_tepid_versatility_3 Damage Per Second
Count 9046
Mean 931117.29
Minimum 866197.60
Maximum 1018089.55
Spread ( max - min ) 151891.94
Range [ ( max - min ) / 2 * 100% ] 8.16%
Standard Deviation 22480.8899
5th Percentile 896148.27
95th Percentile 970238.44
( 95th Percentile - 5th Percentile ) 74090.16
Mean Distribution
Standard Deviation 236.3661
95.00% Confidence Interval ( 930654.03 - 931580.56 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2240
0.1 Scale Factor Error with Delta=300 4314304
0.05 Scale Factor Error with Delta=300 17257213
0.01 Scale Factor Error with Delta=300 431430324
Priority Target DPS
phial_of_tepid_versatility_3 Priority Target Damage Per Second
Count 9046
Mean 169765.90
Minimum 150255.32
Maximum 191978.32
Spread ( max - min ) 41723.00
Range [ ( max - min ) / 2 * 100% ] 12.29%
Standard Deviation 5447.5263
5th Percentile 161094.66
95th Percentile 179013.30
( 95th Percentile - 5th Percentile ) 17918.64
Mean Distribution
Standard Deviation 57.2758
95.00% Confidence Interval ( 169653.64 - 169878.16 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3956
0.1 Scale Factor Error with Delta=300 253328
0.05 Scale Factor Error with Delta=300 1013311
0.01 Scale Factor Error with Delta=300 25332751
DPS(e)
phial_of_tepid_versatility_3 Damage Per Second (Effective)
Count 9046
Mean 931117.29
Minimum 866197.60
Maximum 1018089.55
Spread ( max - min ) 151891.94
Range [ ( max - min ) / 2 * 100% ] 8.16%
Damage
phial_of_tepid_versatility_3 Damage
Count 9046
Mean 278293658.87
Minimum 215629165.68
Maximum 340566351.68
Spread ( max - min ) 124937186.00
Range [ ( max - min ) / 2 * 100% ] 22.45%
DTPS
phial_of_tepid_versatility_3 Damage Taken Per Second
Count 9046
Mean 2189.26
Minimum 845.66
Maximum 4207.85
Spread ( max - min ) 3362.19
Range [ ( max - min ) / 2 * 100% ] 76.79%
HPS
phial_of_tepid_versatility_3 Healing Per Second
Count 9046
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
phial_of_tepid_versatility_3 Healing Per Second (Effective)
Count 9046
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
phial_of_tepid_versatility_3 Heal
Count 9046
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
phial_of_tepid_versatility_3 Healing Taken Per Second
Count 9046
Mean 1905.25
Minimum 582.50
Maximum 4092.33
Spread ( max - min ) 3509.83
Range [ ( max - min ) / 2 * 100% ] 92.11%
TMI
phial_of_tepid_versatility_3 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
phial_of_tepid_versatility_3Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
phial_of_tepid_versatility_3 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.44 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.68 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.73 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.aoe
# count action,conditions
0.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
0.00 variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
I 1.00 sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
J 3.00 moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
0.00 variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
K 13.96 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
L 70.52 starfall,if=variable.starfall_condition1
M 1.27 starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
0.00 celestial_alignment,if=variable.cd_condition_aoe
N 2.00 incarnation,if=variable.cd_condition_aoe
0.00 warrior_of_elune
0.00 variable,name=enter_solar,value=spell_targets.starfire<3
0.00 starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
O 24.50 wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
0.00 wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
P 5.11 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
Q 34.17 starfall,if=variable.starfall_condition2
0.00 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
0.00 stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+50
0.00 convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 new_moon,if=astral_power.deficit>variable.passive_asp+10
0.00 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
R 116.99 starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
0.00 wrath
S 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFIJJJLMLNDEPQRRLRLRLRLLRKLQRQRRRRLRLRLLRKQQRRQRRRLRRLRKLOOLRQRLRRLRKLQRQOOPRLLRLRRLQROOQRRRLLFRRLQQRERROLORLRKLQRRQRRROOKLRQRQRRLPRKLQQRRLROLORLRKLQRRQRRRLOORLRQRLRLRRLRKLOOLFRQRLNRRERLRLPQQRRRLRLLRKLQRQRRRLRRLRKLQRQROOLRRLRRLQQRRROLORRLKLRQRQRRROLORKQRQRFRLPRLREKLQQRROOLRLRLRQRRQOORQRDRKLRQRQRRLRLRKLOO

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask phial_of_tepid_versatility_3 0.0/100: 0% astral_power
Pre precombat 1 food phial_of_tepid_versatility_3 0.0/100: 0% astral_power
Pre precombat 2 augmentation phial_of_tepid_versatility_3 0.0/100: 0% astral_power
Pre precombat 4 no_cd_talent phial_of_tepid_versatility_3 0.0/100: 0% astral_power
Pre precombat 5 on_use_trinket phial_of_tepid_versatility_3 0.0/100: 0% astral_power
Pre precombat 6 on_use_trinket phial_of_tepid_versatility_3 0.0/100: 0% astral_power
Pre precombat 7 on_use_trinket phial_of_tepid_versatility_3 0.0/100: 0% astral_power
Pre precombat 8 moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power
Pre precombat 9 wrath Fluffy_Pillow 0.0/100: 0% astral_power
Pre precombat A wrath Fluffy_Pillow 10.0/100: 10% astral_power
Pre precombat C starfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice
0:00.000 default F natures_vigil phial_of_tepid_versatility_3 20.0/100: 20% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate
0:00.000 aoe I sunfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate
0:00.928 aoe J moonfire Fluffy_Pillow 47.2/100: 47% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, umbral_embrace, dreamstate
0:01.857 aoe J moonfire enemy2 57.2/100: 57% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, umbral_embrace, dreamstate
0:02.785 aoe J moonfire enemy3 67.2/100: 67% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, umbral_embrace, dreamstate
0:03.714 aoe L starfall Fluffy_Pillow 79.2/100: 79% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), eclipse_lunar, solstice, umbral_embrace, dreamstate
0:04.644 aoe M starfire Fluffy_Pillow 68.2/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, umbral_embrace, balance_t31_4pc_buff_lunar
0:05.448 aoe L starfall Fluffy_Pillow 93.4/100: 93% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(5), solstice, starfall, starlord, balance_t31_4pc_buff_lunar
0:06.340 aoe N incarnation_chosen_of_elune Fluffy_Pillow 52.4/100: 52% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(10), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2)
0:06.340 default D potion Fluffy_Pillow 52.4/100: 52% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2)
0:06.340 default E use_items Fluffy_Pillow 52.4/100: 52% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), elemental_potion_of_ultimate_power
0:06.340 aoe P fury_of_elune Fluffy_Pillow 52.4/100: 52% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), elemental_potion_of_ultimate_power, kindled_soul(100)
0:07.122 aoe Q starfall Fluffy_Pillow 57.4/100: 57% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(2), starlord(2), dreamstate(2), elemental_potion_of_ultimate_power, kindled_soul(100)
0:07.904 aoe R starfire Fluffy_Pillow 36.4/100: 36% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, elemental_potion_of_ultimate_power, kindled_soul(95)
0:08.659 aoe R starfire Fluffy_Pillow 64.6/100: 65% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, elemental_potion_of_ultimate_power, kindled_soul(90)
0:09.412 aoe L starfall Fluffy_Pillow 95.8/100: 96% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, elemental_potion_of_ultimate_power, kindled_soul(85)
0:10.167 aoe R starfire Fluffy_Pillow 67.8/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), elemental_potion_of_ultimate_power, kindled_soul(85)
0:11.300 aoe L starfall Fluffy_Pillow 99.0/100: 99% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), elemental_potion_of_ultimate_power, kindled_soul(80)
0:12.056 aoe R starfire Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), elemental_potion_of_ultimate_power, kindled_soul(75)
0:13.185 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(25), starfall(4), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(11), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(70)
0:13.940 aoe R starfire Fluffy_Pillow 71.0/100: 71% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(30), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(10), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(65)
0:15.070 aoe L starfall Fluffy_Pillow 99.2/100: 99% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(9), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(60)
0:15.825 aoe L starfall Fluffy_Pillow 96.2/100: 96% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(55)
0:16.581 aoe R starfire Fluffy_Pillow 63.2/100: 63% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(50)
0:17.709 aoe K cancel_buff Fluffy_Pillow 84.4/100: 84% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(45)
0:17.709 aoe L starfall Fluffy_Pillow 84.4/100: 84% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(4), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(45)
0:18.553 aoe Q starfall Fluffy_Pillow 53.4/100: 53% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(5), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(6), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(40)
0:19.367 aoe R starfire Fluffy_Pillow 18.4/100: 18% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(5), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(5), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(35)
0:20.538 aoe Q starfall Fluffy_Pillow 37.6/100: 38% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(5), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(4), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(30)
0:21.319 aoe R starfire Fluffy_Pillow 4.6/100: 5% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(3), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(30)
0:22.449 aoe R starfire Fluffy_Pillow 31.8/100: 32% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(2), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(20)
0:23.579 aoe R starfire Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos, best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(15)
0:24.707 aoe R starfire Fluffy_Pillow 72.2/100: 72% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(10)
0:25.836 aoe L starfall Fluffy_Pillow 91.4/100: 91% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_potion_of_ultimate_power, kindled_soul(5)
0:26.591 aoe R starfire Fluffy_Pillow 64.4/100: 64% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:27.721 aoe L starfall Fluffy_Pillow 91.6/100: 92% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:28.475 aoe R starfire Fluffy_Pillow 64.6/100: 65% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:29.604 aoe L starfall Fluffy_Pillow 87.8/100: 88% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:30.359 aoe L starfall Fluffy_Pillow 58.8/100: 59% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:31.113 aoe R starfire Fluffy_Pillow 27.8/100: 28% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), solstice, starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:32.244 aoe K cancel_buff Fluffy_Pillow 81.0/100: 81% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:32.244 aoe Q starfall Fluffy_Pillow 81.0/100: 81% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:33.089 aoe Q starfall Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(5), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:33.902 aoe R starfire Fluffy_Pillow 11.0/100: 11% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(5), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:35.073 aoe R starfire Fluffy_Pillow 34.2/100: 34% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(5), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:36.246 aoe Q starfall Fluffy_Pillow 57.4/100: 57% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
0:37.029 aoe R starfire Fluffy_Pillow 24.4/100: 24% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
0:38.159 aoe R starfire Fluffy_Pillow 45.6/100: 46% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
0:39.288 aoe R starfire Fluffy_Pillow 68.8/100: 69% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
0:40.418 aoe L starfall Fluffy_Pillow 88.0/100: 88% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
0:41.398 aoe R starfire Fluffy_Pillow 53.0/100: 53% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
0:42.864 aoe R starfire Fluffy_Pillow 72.2/100: 72% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
0:44.331 aoe L starfall Fluffy_Pillow 95.4/100: 95% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
0:45.312 aoe R starfire Fluffy_Pillow 62.4/100: 62% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
0:46.779 aoe K cancel_buff Fluffy_Pillow 87.6/100: 88% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
0:46.779 aoe L starfall Fluffy_Pillow 87.6/100: 88% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
0:47.876 aoe O wrath Fluffy_Pillow 54.6/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
0:48.933 aoe O wrath Fluffy_Pillow 64.6/100: 65% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord, dreamstate, best_friends_with_urctos_static
0:49.687 aoe L starfall Fluffy_Pillow 78.6/100: 79% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord, dreamstate, best_friends_with_urctos_static
0:50.847 aoe R starfire Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static
0:51.852 aoe Q starfall Fluffy_Pillow 58.8/100: 59% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static
0:52.968 aoe R starfire Fluffy_Pillow 21.8/100: 22% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static
0:54.583 aoe L starfall Fluffy_Pillow 45.0/100: 45% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static
0:55.660 aoe R starfire Fluffy_Pillow 4.0/100: 4% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static
0:57.128 aoe R starfire Fluffy_Pillow 65.2/100: 65% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static
0:58.594 aoe L starfall Fluffy_Pillow 90.4/100: 90% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static
0:59.573 aoe R starfire Fluffy_Pillow 63.4/100: 63% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static
1:01.040 aoe K cancel_buff Fluffy_Pillow 90.6/100: 91% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static
1:01.040 aoe L starfall Fluffy_Pillow 90.6/100: 91% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static
1:02.137 aoe Q starfall Fluffy_Pillow 57.6/100: 58% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static
1:03.190 aoe R starfire Fluffy_Pillow 22.6/100: 23% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static
1:04.711 aoe Q starfall Fluffy_Pillow 45.8/100: 46% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static
1:05.726 aoe O wrath Fluffy_Pillow 10.8/100: 11% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static
1:06.706 aoe O wrath Fluffy_Pillow 24.8/100: 25% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(3), dreamstate, best_friends_with_aerwynn(3), best_friends_with_aerwynn_static
1:07.459 aoe P fury_of_elune Fluffy_Pillow 36.8/100: 37% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), dreamstate, best_friends_with_aerwynn(3), best_friends_with_aerwynn_static
1:08.536 aoe R starfire Fluffy_Pillow 48.8/100: 49% astral_power balance_of_all_things_arcane(7), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), umbral_embrace, best_friends_with_aerwynn(2), best_friends_with_aerwynn_static
1:09.506 aoe L starfall Fluffy_Pillow 80.0/100: 80% astral_power balance_of_all_things_arcane(6), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static
1:10.583 aoe L starfall Fluffy_Pillow 75.0/100: 75% astral_power balance_of_all_things_arcane(5), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static
1:11.662 aoe R starfire Fluffy_Pillow 40.0/100: 40% astral_power balance_of_all_things_arcane(4), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static
1:13.276 aoe L starfall Fluffy_Pillow 74.2/100: 74% astral_power balance_of_all_things_arcane(3), eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static
1:14.353 aoe R starfire Fluffy_Pillow 35.2/100: 35% astral_power balance_of_all_things_arcane, eclipse_lunar, fury_of_elune, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static
1:15.970 aoe R starfire Fluffy_Pillow 65.4/100: 65% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static
1:17.584 aoe L starfall Fluffy_Pillow 86.6/100: 87% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, wafting_devotion
1:18.705 aoe Q starfall Fluffy_Pillow 47.6/100: 48% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, wafting_devotion
1:19.783 aoe R starfire Fluffy_Pillow 4.6/100: 5% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(3), starlord(2), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion
1:21.335 aoe O wrath Fluffy_Pillow 25.8/100: 26% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion
1:22.372 aoe O wrath Fluffy_Pillow 35.8/100: 36% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(2), dreamstate, best_friends_with_aerwynn_static, wafting_devotion
1:23.127 aoe Q starfall Fluffy_Pillow 47.8/100: 48% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), dreamstate, best_friends_with_aerwynn_static, wafting_devotion
1:24.162 aoe R starfire Fluffy_Pillow 6.8/100: 7% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, wafting_devotion
1:25.061 aoe R starfire Fluffy_Pillow 32.0/100: 32% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos(11), best_friends_with_urctos_static, wafting_devotion
1:26.559 aoe R starfire Fluffy_Pillow 57.2/100: 57% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos(10), best_friends_with_urctos_static, wafting_devotion
1:28.057 aoe L starfall Fluffy_Pillow 88.4/100: 88% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos(8), best_friends_with_urctos_static, wafting_devotion
1:29.056 aoe L starfall Fluffy_Pillow 47.4/100: 47% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(7), best_friends_with_urctos_static, wafting_devotion
1:30.055 default F natures_vigil phial_of_tepid_versatility_3 38.4/100: 38% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(6), best_friends_with_urctos_static, wafting_devotion
1:30.055 aoe R starfire Fluffy_Pillow 38.4/100: 38% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(6), best_friends_with_urctos_static, wafting_devotion
1:31.415 aoe R starfire Fluffy_Pillow 61.6/100: 62% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(5), best_friends_with_urctos_static, wafting_devotion
1:32.777 aoe L starfall Fluffy_Pillow 94.8/100: 95% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(3), best_friends_with_urctos_static
1:33.874 aoe Q starfall Fluffy_Pillow 63.8/100: 64% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(2), best_friends_with_urctos_static
1:34.928 aoe Q starfall Fluffy_Pillow 36.8/100: 37% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(4), starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos, best_friends_with_urctos_static
1:35.942 aoe R starfire Fluffy_Pillow 1.8/100: 2% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(5), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
1:37.411 default E use_items Fluffy_Pillow 25.0/100: 25% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
1:37.411 aoe R starfire Fluffy_Pillow 25.0/100: 25% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, kindled_soul(100)
1:38.878 aoe R starfire Fluffy_Pillow 46.2/100: 46% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, kindled_soul(95)
1:40.346 aoe O wrath Fluffy_Pillow 67.4/100: 67% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, kindled_soul(90)
1:41.327 aoe L starfall Fluffy_Pillow 77.4/100: 77% astral_power natures_vigil, primordial_arcanic_pulsar(15), starfall(2), starlord(3), dreamstate(2), best_friends_with_urctos_static, kindled_soul(85)
1:42.404 aoe O wrath Fluffy_Pillow 34.4/100: 34% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(2), starlord(3), dreamstate, best_friends_with_urctos_static, kindled_soul(80)
1:43.158 aoe R starfire Fluffy_Pillow 48.4/100: 48% astral_power natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall, starlord(3), best_friends_with_urctos_static, kindled_soul(75)
1:44.129 aoe L starfall Fluffy_Pillow 71.6/100: 72% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall, starlord(3), best_friends_with_urctos_static, kindled_soul(70)
1:45.207 aoe R starfire Fluffy_Pillow 32.6/100: 33% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, kindled_soul(65)
1:46.821 aoe K cancel_buff Fluffy_Pillow 89.8/100: 90% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, kindled_soul(55)
1:46.821 aoe L starfall Fluffy_Pillow 89.8/100: 90% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, kindled_soul(55)
1:48.027 aoe Q starfall Fluffy_Pillow 48.8/100: 49% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, kindled_soul(50)
1:49.186 aoe R starfire Fluffy_Pillow 9.8/100: 10% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(4), starlord(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(11), best_friends_with_pip_static, kindled_soul(45)
1:50.860 aoe R starfire Fluffy_Pillow 29.0/100: 29% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(9), best_friends_with_pip_static, kindled_soul(35)
1:52.534 aoe Q starfall Fluffy_Pillow 48.2/100: 48% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(8), best_friends_with_pip_static, kindled_soul(25)
1:53.650 aoe R starfire Fluffy_Pillow 3.2/100: 3% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(7), best_friends_with_pip_static, kindled_soul(20)
1:55.265 aoe R starfire Fluffy_Pillow 24.4/100: 24% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(5), best_friends_with_pip_static, kindled_soul(15)
1:56.880 aoe R starfire Fluffy_Pillow 47.6/100: 48% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(3), best_friends_with_pip_static, kindled_soul(5)
1:58.494 aoe O wrath Fluffy_Pillow 59.6/100: 60% astral_power primordial_arcanic_pulsar(40), starfall, starlord(3), dreamstate, best_friends_with_pip(2), best_friends_with_pip_static
1:59.249 aoe O wrath Fluffy_Pillow 71.6/100: 72% astral_power primordial_arcanic_pulsar(40), starfall, starlord(3), best_friends_with_pip, best_friends_with_pip_static
2:00.002 aoe K cancel_buff Fluffy_Pillow 85.6/100: 86% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(40), solstice, starfall, starlord(3), best_friends_with_pip_static
2:00.002 aoe L starfall Fluffy_Pillow 85.6/100: 86% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(40), solstice, starfall, best_friends_with_pip_static
2:01.208 aoe R starfire Fluffy_Pillow 44.6/100: 45% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, best_friends_with_pip_static
2:02.945 aoe Q starfall Fluffy_Pillow 69.8/100: 70% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord, balance_t31_4pc_buff_lunar, best_friends_with_pip_static
2:04.106 aoe R starfire Fluffy_Pillow 28.8/100: 29% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static
2:05.780 aoe Q starfall Fluffy_Pillow 54.0/100: 54% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static
2:06.897 aoe R starfire Fluffy_Pillow 13.0/100: 13% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static
2:08.513 aoe R starfire Fluffy_Pillow 36.2/100: 36% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static
2:10.127 aoe L starfall Fluffy_Pillow 55.4/100: 55% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static
2:11.204 aoe P fury_of_elune Fluffy_Pillow 48.4/100: 48% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static
2:12.182 aoe R starfire Fluffy_Pillow 55.4/100: 55% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static
2:13.648 aoe K cancel_buff Fluffy_Pillow 89.6/100: 90% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(11), best_friends_with_urctos_static
2:13.648 aoe L starfall Fluffy_Pillow 89.6/100: 90% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(11), best_friends_with_urctos_static
2:14.744 aoe Q starfall Fluffy_Pillow 67.6/100: 68% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(10), best_friends_with_urctos_static
2:15.799 aoe Q starfall Fluffy_Pillow 44.6/100: 45% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(9), best_friends_with_urctos_static
2:16.814 aoe R starfire Fluffy_Pillow 19.6/100: 20% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, wafting_devotion
2:18.176 aoe R starfire Fluffy_Pillow 50.8/100: 51% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(6), best_friends_with_urctos_static, wafting_devotion
2:19.538 aoe L starfall Fluffy_Pillow 79.0/100: 79% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(5), best_friends_with_urctos_static, wafting_devotion
2:20.445 aoe R starfire Fluffy_Pillow 46.0/100: 46% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion
2:21.808 aoe O wrath Fluffy_Pillow 67.2/100: 67% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(3), best_friends_with_urctos_static, wafting_devotion
2:22.718 aoe L starfall Fluffy_Pillow 81.2/100: 81% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord(3), umbral_embrace, dreamstate(2), best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion
2:23.716 aoe O wrath Fluffy_Pillow 36.2/100: 36% astral_power primordial_arcanic_pulsar(25), starfall(3), starlord(3), umbral_embrace, dreamstate, best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion
2:24.472 aoe R starfire Fluffy_Pillow 48.2/100: 48% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), umbral_embrace, best_friends_with_urctos_static, wafting_devotion
2:25.371 aoe L starfall Fluffy_Pillow 73.4/100: 73% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), best_friends_with_urctos_static, wafting_devotion
2:26.371 aoe R starfire Fluffy_Pillow 36.4/100: 36% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, wafting_devotion
2:27.868 aoe K cancel_buff Fluffy_Pillow 93.6/100: 94% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_pip(11), best_friends_with_pip_static, wafting_devotion
2:27.868 aoe L starfall Fluffy_Pillow 93.6/100: 94% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), balance_t31_4pc_buff_lunar, best_friends_with_pip(11), best_friends_with_pip_static, wafting_devotion
2:28.988 aoe Q starfall Fluffy_Pillow 54.6/100: 55% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_pip(10), best_friends_with_pip_static, wafting_devotion
2:30.065 aoe R starfire Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(40), solstice, starfall(4), starlord(2), umbral_embrace, balance_t31_4pc_buff_lunar(3), best_friends_with_pip(9), best_friends_with_pip_static, wafting_devotion
2:31.616 aoe R starfire Fluffy_Pillow 34.8/100: 35% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(7), best_friends_with_pip_static
2:33.291 aoe Q starfall Fluffy_Pillow 56.0/100: 56% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(5), best_friends_with_pip_static
2:34.410 aoe R starfire Fluffy_Pillow 11.0/100: 11% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(4), best_friends_with_pip_static
2:36.024 aoe R starfire Fluffy_Pillow 30.2/100: 30% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(3), best_friends_with_pip_static
2:37.637 aoe R starfire Fluffy_Pillow 49.4/100: 49% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall, starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip, best_friends_with_pip_static, wafting_devotion
2:39.135 aoe L starfall Fluffy_Pillow 74.6/100: 75% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall, starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, wafting_devotion
2:40.135 aoe O wrath Fluffy_Pillow 33.6/100: 34% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord(3), dreamstate, best_friends_with_pip_static, wafting_devotion
2:40.889 aoe O wrath Fluffy_Pillow 45.6/100: 46% astral_power primordial_arcanic_pulsar(50), starfall(2), starlord(3), best_friends_with_pip_static, wafting_devotion
2:41.642 aoe R starfire Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), best_friends_with_pip_static, wafting_devotion
2:43.138 aoe L starfall Fluffy_Pillow 82.8/100: 83% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, best_friends_with_pip_static, wafting_devotion
2:44.258 aoe R starfire Fluffy_Pillow 43.8/100: 44% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, wafting_devotion
2:45.868 aoe Q starfall Fluffy_Pillow 67.0/100: 67% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, best_friends_with_pip_static, wafting_devotion
2:46.944 aoe R starfire Fluffy_Pillow 30.0/100: 30% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion
2:48.356 aoe L starfall Fluffy_Pillow 87.2/100: 87% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion
2:49.298 aoe R starfire Fluffy_Pillow 56.2/100: 56% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion
2:50.658 aoe L starfall Fluffy_Pillow 83.4/100: 83% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, wafting_devotion
2:51.569 aoe R starfire Fluffy_Pillow 52.4/100: 52% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, wafting_devotion
2:52.930 aoe R starfire Fluffy_Pillow 77.6/100: 78% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static
2:54.397 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static
2:55.377 aoe R starfire Fluffy_Pillow 67.0/100: 67% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static
2:56.844 aoe K cancel_buff Fluffy_Pillow 86.2/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static
2:56.844 aoe L starfall Fluffy_Pillow 86.2/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static
2:57.941 aoe O wrath Fluffy_Pillow 53.2/100: 53% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord, dreamstate, best_friends_with_aerwynn(4), best_friends_with_aerwynn_static
2:58.696 aoe O wrath Fluffy_Pillow 63.2/100: 63% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord, best_friends_with_aerwynn(4), best_friends_with_aerwynn_static
2:59.452 aoe L starfall Fluffy_Pillow 73.2/100: 73% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(2), starlord, best_friends_with_aerwynn(3), best_friends_with_aerwynn_static
3:00.611 default F natures_vigil phial_of_tepid_versatility_3 32.2/100: 32% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(2), best_friends_with_aerwynn_static
3:00.611 aoe R starfire Fluffy_Pillow 32.2/100: 32% astral_power natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(2), best_friends_with_aerwynn_static
3:02.284 aoe Q starfall Fluffy_Pillow 61.4/100: 61% astral_power natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static
3:03.401 aoe R starfire Fluffy_Pillow 20.4/100: 20% astral_power natures_vigil, balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static
3:05.014 aoe L starfall Fluffy_Pillow 75.6/100: 76% astral_power natures_vigil, balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static
3:06.092 aoe N incarnation_chosen_of_elune Fluffy_Pillow 34.6/100: 35% astral_power natures_vigil, balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static
3:06.340 aoe R starfire Fluffy_Pillow 34.6/100: 35% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(3), dreamstate, best_friends_with_aerwynn_static
3:07.223 aoe R starfire Fluffy_Pillow 59.8/100: 60% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(3), starlord(3), best_friends_with_aerwynn_static
3:08.105 default E use_items Fluffy_Pillow 81.0/100: 81% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static
3:08.105 aoe R starfire Fluffy_Pillow 81.0/100: 81% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(2), starlord(3), best_friends_with_aerwynn_static, kindled_soul(100)
3:09.571 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), solstice, starfall(2), starlord(3), best_friends_with_urctos(10), best_friends_with_urctos_static, kindled_soul(95)
3:10.548 aoe R starfire Fluffy_Pillow 69.0/100: 69% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_urctos(9), best_friends_with_urctos_static, kindled_soul(90)
3:12.016 aoe L starfall Fluffy_Pillow 98.2/100: 98% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starfall(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_urctos(8), best_friends_with_urctos_static, kindled_soul(85)
3:13.112 aoe P fury_of_elune Fluffy_Pillow 65.2/100: 65% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(2), starlord, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(7), best_friends_with_urctos_static, kindled_soul(75)
3:14.167 aoe Q starfall Fluffy_Pillow 73.2/100: 73% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(45), starfall(2), starlord, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(6), best_friends_with_urctos_static, kindled_soul(70)
3:15.221 aoe Q starfall Fluffy_Pillow 44.2/100: 44% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(50), starfall(3), starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(4), best_friends_with_urctos_static, kindled_soul(65)
3:16.236 aoe R starfire Fluffy_Pillow 15.2/100: 15% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(4), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(3), best_friends_with_urctos_static, kindled_soul(60)
3:17.705 aoe R starfire Fluffy_Pillow 45.4/100: 45% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(2), best_friends_with_urctos_static, kindled_soul(55)
3:19.174 aoe R starfire Fluffy_Pillow 73.6/100: 74% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos, best_friends_with_urctos_static, kindled_soul(45)
3:20.642 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(55), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, kindled_soul(40)
3:21.623 aoe R starfire Fluffy_Pillow 74.0/100: 74% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, kindled_soul(35)
3:23.089 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, kindled_soul(30)
3:24.068 aoe L starfall Fluffy_Pillow 99.0/100: 99% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, kindled_soul(25)
3:25.047 aoe R starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, kindled_soul(20)
3:26.514 aoe K cancel_buff Fluffy_Pillow 95.2/100: 95% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, kindled_soul(10)
3:26.514 aoe L starfall Fluffy_Pillow 95.2/100: 95% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), solstice, starfall(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, kindled_soul(10)
3:27.610 aoe Q starfall Fluffy_Pillow 60.2/100: 60% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, kindled_soul(5)
3:28.665 aoe R starfire Fluffy_Pillow 27.2/100: 27% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(20), starfall(5), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:29.681 aoe Q starfall Fluffy_Pillow 46.4/100: 46% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:30.696 aoe R starfire Fluffy_Pillow 13.4/100: 13% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(5), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:32.164 aoe R starfire Fluffy_Pillow 40.6/100: 41% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:33.632 aoe R starfire Fluffy_Pillow 63.8/100: 64% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:35.099 aoe L starfall Fluffy_Pillow 85.0/100: 85% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(25), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:36.079 aoe R starfire Fluffy_Pillow 54.0/100: 54% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:37.546 aoe R starfire Fluffy_Pillow 75.2/100: 75% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:39.014 aoe L starfall Fluffy_Pillow 96.4/100: 96% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(30), starfall, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:39.992 aoe R starfire Fluffy_Pillow 63.4/100: 63% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:41.459 aoe K cancel_buff Fluffy_Pillow 86.6/100: 87% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:41.459 aoe L starfall Fluffy_Pillow 86.6/100: 87% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(35), starfall(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:42.556 aoe Q starfall Fluffy_Pillow 53.6/100: 54% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starfall(3), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:43.610 aoe R starfire Fluffy_Pillow 20.6/100: 21% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
3:45.133 aoe Q starfall Fluffy_Pillow 41.8/100: 42% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(45), starfall(3), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static
3:46.149 aoe R starfire Fluffy_Pillow 6.8/100: 7% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static
3:47.616 aoe O wrath Fluffy_Pillow 26.0/100: 26% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(50), starfall(3), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static
3:48.596 aoe O wrath Fluffy_Pillow 38.0/100: 38% astral_power primordial_arcanic_pulsar(50), starfall(3), starlord(3), dreamstate, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static
3:49.351 aoe L starfall Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(3), starlord(3), dreamstate, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static
3:50.427 aoe R starfire Fluffy_Pillow 9.0/100: 9% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static
3:51.397 aoe R starfire Fluffy_Pillow 62.2/100: 62% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static
3:53.011 aoe L starfall Fluffy_Pillow 85.4/100: 85% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(3), best_friends_with_aerwynn_static
3:54.088 aoe R starfire Fluffy_Pillow 48.4/100: 48% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static
3:55.558 aoe R starfire Fluffy_Pillow 73.6/100: 74% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn, best_friends_with_aerwynn_static
3:57.026 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static
3:58.123 aoe Q starfall Fluffy_Pillow 69.0/100: 69% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord, umbral_embrace, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static
3:59.178 aoe Q starfall Fluffy_Pillow 36.0/100: 36% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(2), umbral_embrace, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static
4:00.194 aoe R starfire Fluffy_Pillow 3.0/100: 3% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(4), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static
4:01.662 aoe R starfire Fluffy_Pillow 22.2/100: 22% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static
4:03.132 aoe R starfire Fluffy_Pillow 41.4/100: 41% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static
4:04.601 aoe O wrath Fluffy_Pillow 62.6/100: 63% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(11), best_friends_with_urctos_static
4:05.579 aoe L starfall Fluffy_Pillow 74.6/100: 75% astral_power primordial_arcanic_pulsar(15), starfall(2), starlord(3), umbral_embrace, dreamstate(2), best_friends_with_urctos(10), best_friends_with_urctos_static, wafting_devotion
4:06.578 aoe O wrath Fluffy_Pillow 31.6/100: 32% astral_power primordial_arcanic_pulsar(20), starfall(2), starlord(3), umbral_embrace, dreamstate, best_friends_with_urctos(9), best_friends_with_urctos_static, wafting_devotion
4:07.334 aoe R starfire Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall, starlord(3), umbral_embrace, best_friends_with_urctos(9), best_friends_with_urctos_static, wafting_devotion
4:08.232 aoe R starfire Fluffy_Pillow 64.8/100: 65% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall, starlord(3), best_friends_with_urctos(8), best_friends_with_urctos_static, wafting_devotion
4:09.729 aoe L starfall Fluffy_Pillow 90.0/100: 90% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall, starlord(3), best_friends_with_urctos(6), best_friends_with_urctos_static, wafting_devotion
4:10.729 aoe K cancel_buff Fluffy_Pillow 49.0/100: 49% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos(5), best_friends_with_urctos_static, wafting_devotion
4:10.729 aoe L starfall Fluffy_Pillow 49.0/100: 49% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(2), balance_t31_4pc_buff_lunar, best_friends_with_urctos(5), best_friends_with_urctos_static, wafting_devotion
4:11.850 aoe R starfire Fluffy_Pillow 40.0/100: 40% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(3), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion
4:13.463 aoe Q starfall Fluffy_Pillow 67.2/100: 67% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(30), starfall(3), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion
4:14.540 aoe R starfire Fluffy_Pillow 22.2/100: 22% astral_power balance_of_all_things_arcane, eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(2), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion
4:16.091 aoe Q starfall Fluffy_Pillow 45.4/100: 45% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(2), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, wafting_devotion
4:17.129 aoe R starfire Fluffy_Pillow 2.4/100: 2% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(4), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, wafting_devotion
4:18.626 aoe R starfire Fluffy_Pillow 23.6/100: 24% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, wafting_devotion
4:20.124 aoe R starfire Fluffy_Pillow 42.8/100: 43% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, wafting_devotion
4:21.621 aoe O wrath Fluffy_Pillow 64.0/100: 64% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall, starlord(3), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static
4:22.699 aoe L starfall Fluffy_Pillow 78.0/100: 78% astral_power primordial_arcanic_pulsar(40), starfall, starlord(3), dreamstate(2), best_friends_with_urctos_static
4:23.778 aoe O wrath Fluffy_Pillow 35.0/100: 35% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(3), dreamstate, best_friends_with_urctos_static
4:24.533 aoe R starfire Fluffy_Pillow 49.0/100: 49% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), best_friends_with_urctos_static
4:25.503 aoe K cancel_buff Fluffy_Pillow 72.2/100: 72% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(3), best_friends_with_urctos_static
4:25.503 aoe Q starfall Fluffy_Pillow 72.2/100: 72% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, best_friends_with_urctos_static
4:26.708 aoe R starfire Fluffy_Pillow 35.2/100: 35% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, best_friends_with_urctos_static
4:28.445 aoe Q starfall Fluffy_Pillow 58.4/100: 58% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord, balance_t31_4pc_buff_lunar, best_friends_with_urctos_static
4:29.604 aoe R starfire Fluffy_Pillow 17.4/100: 17% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(55), solstice, starfall(3), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static
4:31.278 default F natures_vigil phial_of_tepid_versatility_3 42.6/100: 43% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static
4:31.278 aoe R starfire Fluffy_Pillow 42.6/100: 43% astral_power natures_vigil, balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static
4:32.951 aoe L starfall Fluffy_Pillow 63.8/100: 64% astral_power natures_vigil, eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static
4:34.070 aoe P fury_of_elune Fluffy_Pillow 52.8/100: 53% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static
4:35.049 aoe R starfire Fluffy_Pillow 59.8/100: 60% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall(2), starlord(3), umbral_embrace, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static
4:36.516 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, solstice, starfall, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static
4:37.495 aoe R starfire Fluffy_Pillow 75.0/100: 75% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static
4:38.963 default E use_items Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static
4:38.963 aoe K cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, kindled_soul(100)
4:38.963 aoe L starfall Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(5), starfall(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, kindled_soul(100)
4:40.060 aoe Q starfall Fluffy_Pillow 71.0/100: 71% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(10), starfall(3), starlord, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, kindled_soul(95)
4:41.112 aoe Q starfall Fluffy_Pillow 47.0/100: 47% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, fury_of_elune, primordial_arcanic_pulsar(15), starfall(3), starlord(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, kindled_soul(90)
4:42.127 aoe R starfire Fluffy_Pillow 18.0/100: 18% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, kindled_soul(85)
4:43.594 aoe R starfire Fluffy_Pillow 39.2/100: 39% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(4), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, kindled_soul(80)
4:45.062 aoe O wrath Fluffy_Pillow 53.2/100: 53% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(3), starlord(3), dreamstate, best_friends_with_urctos_static, kindled_soul(70)
4:45.818 aoe O wrath Fluffy_Pillow 67.2/100: 67% astral_power natures_vigil, primordial_arcanic_pulsar(20), starfall(3), starlord(3), best_friends_with_urctos_static, kindled_soul(70)
4:46.573 aoe L starfall Fluffy_Pillow 79.2/100: 79% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(20), solstice, starfall(3), starlord(3), best_friends_with_urctos_static, kindled_soul(65)
4:47.650 aoe R starfire Fluffy_Pillow 40.2/100: 40% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos(11), best_friends_with_urctos_static, kindled_soul(60)
4:49.263 aoe L starfall Fluffy_Pillow 63.4/100: 63% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(25), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos(9), best_friends_with_urctos_static, kindled_soul(50)
4:50.341 aoe R starfire Fluffy_Pillow 22.4/100: 22% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(8), best_friends_with_urctos_static, kindled_soul(45)
4:51.957 aoe L starfall Fluffy_Pillow 79.6/100: 80% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(30), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(7), best_friends_with_urctos_static, kindled_soul(40)
4:53.034 aoe R starfire Fluffy_Pillow 38.6/100: 39% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(35), starfall(3), starlord(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(6), best_friends_with_urctos_static, kindled_soul(30)
4:54.648 aoe Q starfall Fluffy_Pillow 57.8/100: 58% astral_power eclipse_lunar, primordial_arcanic_pulsar(35), starfall(2), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(4), best_friends_with_urctos_static, kindled_soul(25)
4:55.855 aoe R starfire Fluffy_Pillow 14.8/100: 15% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(3), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(3), best_friends_with_urctos_static, kindled_soul(20)
4:57.594 aoe R starfire Fluffy_Pillow 38.0/100: 38% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_urctos, best_friends_with_urctos_static, kindled_soul(10)
4:59.331 aoe Q starfall Fluffy_Pillow 59.2/100: 59% astral_power eclipse_lunar, primordial_arcanic_pulsar(40), starfall(2), starlord, balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static
5:00.489 aoe O wrath Fluffy_Pillow 18.2/100: 18% astral_power eclipse_lunar, primordial_arcanic_pulsar(45), starfall(2), starlord(2), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static
5:01.607 aoe O wrath Fluffy_Pillow 28.2/100: 28% astral_power primordial_arcanic_pulsar(45), starfall(2), starlord(2), dreamstate, best_friends_with_urctos_static
5:02.362 aoe R starfire Fluffy_Pillow 40.2/100: 40% astral_power balance_of_all_things_arcane(8), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall(2), starlord(2), best_friends_with_urctos_static
5:03.367 aoe Q starfall Fluffy_Pillow 65.4/100: 65% astral_power balance_of_all_things_arcane(7), eclipse_lunar, primordial_arcanic_pulsar(45), solstice, starfall, starlord(2), best_friends_with_urctos_static
5:04.485 aoe R starfire Fluffy_Pillow 24.4/100: 24% astral_power balance_of_all_things_arcane(6), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static
5:06.100 default D potion Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_arcane(5), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static
5:06.340 aoe R starfire Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_arcane(4), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall(2), starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, elemental_potion_of_ultimate_power
5:07.954 aoe K cancel_buff Fluffy_Pillow 76.8/100: 77% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, starlord(3), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, elemental_potion_of_ultimate_power
5:07.954 aoe L starfall Fluffy_Pillow 76.8/100: 77% astral_power balance_of_all_things_arcane(3), eclipse_lunar, primordial_arcanic_pulsar(50), solstice, starfall, balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, elemental_potion_of_ultimate_power
5:09.160 aoe R starfire Fluffy_Pillow 35.8/100: 36% astral_power balance_of_all_things_arcane(2), eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, elemental_potion_of_ultimate_power
5:10.897 aoe Q starfall Fluffy_Pillow 55.0/100: 55% astral_power eclipse_lunar, primordial_arcanic_pulsar(55), starfall(2), starlord, balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power
5:11.974 aoe R starfire Fluffy_Pillow 16.0/100: 16% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power
5:13.384 aoe Q starfall Fluffy_Pillow 73.2/100: 73% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starfall(2), starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power
5:14.329 aoe R starfire Fluffy_Pillow 44.2/100: 44% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power
5:15.692 aoe R starfire Fluffy_Pillow 71.4/100: 71% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), solstice, starfall(3), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power
5:17.055 aoe L starfall Fluffy_Pillow 96.6/100: 97% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(5), starfall(2), starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power
5:17.964 aoe R starfire Fluffy_Pillow 63.6/100: 64% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(3), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power
5:19.325 aoe L starfall Fluffy_Pillow 84.8/100: 85% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(10), starfall(2), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power
5:20.236 aoe R starfire Fluffy_Pillow 51.8/100: 52% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(3), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power
5:21.599 aoe K cancel_buff Fluffy_Pillow 75.0/100: 75% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power
5:21.599 aoe L starfall Fluffy_Pillow 75.0/100: 75% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(15), starfall(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power
5:22.616 aoe O wrath Fluffy_Pillow 40.0/100: 40% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starfall(3), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power
5:23.595 aoe O wrath Fluffy_Pillow 54.0/100: 54% astral_power primordial_arcanic_pulsar(20), starfall(3), starlord, dreamstate, best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (tauren) Raid-Buffed Unbuffed Gear Amount
Strength 898 2 986 900 0
Agility 2089 -2 2173 2087 0
Stamina 3848 2 44833 42698 38825
Intellect 2089 -2 15807 14885 12090 (7538)
Spirit 0 0 0 0 0
Health 896660 853960 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 15807 14885 0
Crit 22.30% 22.30% 3114
Haste 24.78% 24.78% 4212
Versatility 9.94% 1.30% 267
Mana Regen 2560 2560 0
Attack Power 16439 15480 0
Mastery 30.74% 30.74% 8152
Armor 5324 5324 5324
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 489.00
Local Head Benevolent Embersage's Casque
ilevel: 489, stats: { 673 Armor, +3966 Sta, +704 Crit, +330 Haste, +938 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }, enchant: incandescent_essence
Local Neck Eye of the Rising Flame
ilevel: 489, stats: { +2231 Sta, +256 Haste, +1537 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Life-Bound Shoulderpads
ilevel: 486, stats: { 603 Armor, +2875 Sta, +383 Mastery, +383 Haste, +684 AgiInt }
item effects: { equip: Toxified }
Local Chest Benevolent Embersage's Robe
ilevel: 489, stats: { 897 Armor, +3966 Sta, +715 Crit, +318 Mastery, +938 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 489, stats: { 505 Armor, +2975 Sta, +535 Haste, +241 Mastery, +704 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 489, stats: { 785 Armor, +3966 Sta, +705 Haste, +328 Mastery, +938 AgiInt }, enchant: { +155 StrAgiInt, +41 Vers (lambent_armor_kit_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 486, stats: { 548 Armor, +2875 Sta, +274 Crit, +438 Haste, +684 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Thermal Bindings
ilevel: 489, stats: { 449 Armor, +2231 Sta, +191 Crit, +390 Mastery, +528 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Benevolent Embersage's Talons
ilevel: 489, stats: { 505 Armor, +2975 Sta, +226 Vers, +549 Mastery, +704 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 489, stats: { +2231 Sta, +512 Haste, +1281 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 489, stats: { +2231 Sta, +1230 Crit, +564 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 489, stats: { +892 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 489, stats: { +738 Mastery }
item effects: { use: Balefire Branch }
Local Back Drape of the Loyal Vassal
ilevel: 489, stats: { 359 Armor, +2231 Sta, +328 Haste, +253 Mastery, +528 StrAgiInt }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 489, weapon: { 606 - 781, 2.6 }, stats: { +469 Int, +2264 Int, +1983 Sta, +156 Haste, +361 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 489, stats: { +1439 Int, +1983 Sta, +174 Haste, +343 Mastery }

Profile

druid="phial_of_tepid_versatility_3"
source=default
spec=balance
level=70
race=tauren
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIRSSJJEJHgoJlIRCNAKAQA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_tepid_versatility_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:hissing_rune_3

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=489,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=489,gem_id=192961/192961/192961
shoulders=lifebound_shoulderpads,id=193406,bonus_id=8836/1576/8797/8960,ilevel=486,crafted_stats=49/36
back=drape_of_the_loyal_vassal,id=158375,bonus_id=4795,ilevel=489
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=489,enchant_id=6625
wrists=thermal_bindings,id=134461,bonus_id=4795,ilevel=489,gem_id=192961
hands=benevolent_embersages_talons,id=207255,bonus_id=4795,ilevel=489
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=489,enchant_id=6830
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=486
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=489
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=489
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=489,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=489

# Gear Summary
# gear_ilvl=488.63
# gear_stamina=38825
# gear_intellect=12090
# gear_crit_rating=3114
# gear_haste_rating=4212
# gear_mastery_rating=8152
# gear_versatility_rating=267
# gear_armor=5324
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

Simulation & Raid Information

Iterations: 9078
Threads: 32
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 299.6 )

Performance:

Total Events Processed: 848985396
Max Event Queue: 107
Sim Seconds: 2719795
CPU Seconds: 764.7008
Physical Seconds: 29.5056
Speed Up: 3557

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Base Base astral_smolder ticks -394061 38429440 128098 142.00 54127 0 351.2 710.0 0.0% 0.0% 0.0% 0.0% 0.91sec 38429440 299.58sec
Base Base augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.58sec
Base Base food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.58sec
Base Base fury_of_elune 202770 8198166 27366 152.94 6918 14737 5.1 763.6 48.8% 0.0% 0.0% 0.0% 65.18sec 8198166 299.58sec
Base Base hungering_shadowflame 424324 1105847 3691 3.42 52131 106016 17.1 17.1 23.6% 0.0% 0.0% 0.0% 17.01sec 1105847 299.58sec
Base Base hungering_shadowflame_self 424324 647289 2161 3.42 30448 62086 17.1 17.1 23.7% 0.0% 0.0% 0.0% 17.01sec 716253 299.58sec
Base Base incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.88sec 0 299.58sec
Base Base launched_thorns 379403 2053662 6855 6.85 48097 98026 34.3 34.2 24.0% 0.0% 0.0% 0.0% 8.65sec 2053662 299.58sec
Base Base moonfire 8921 61212 204 1.20 7015 14295 3.0 6.0 43.8% 0.0% 0.0% 0.0% 1.08sec 22388661 299.58sec
Base Base moonfire ticks -8921 22327449 74425 364.16 8787 18140 3.0 1820.8 37.2% 0.0% 0.0% 0.0% 1.08sec 22388661 299.58sec
Base Base moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.58sec
Base Base natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.40sec 0 299.58sec
Base Base potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 306.88sec 0 299.58sec
Base Base shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.58sec
Base Base shooting_stars_moonfire 202497 5878203 19622 47.13 16236 34862 235.9 235.3 46.9% 0.0% 0.0% 0.0% 1.47sec 5878203 299.58sec
Base Base shooting_stars_sunfire 202497 5898101 19688 47.44 16189 34739 237.5 236.9 47.0% 0.0% 0.0% 0.0% 1.47sec 5898101 299.58sec
Base Base orbit_breaker 274283 11999629 40055 18.90 82550 178071 15.8 94.4 46.7% 0.0% 0.0% 0.0% 19.20sec 11999629 299.58sec
Base Base starfall 191034 90680542 302697 353.85 34902 75367 104.7 1766.8 40.6% 0.0% 0.0% 0.0% 2.84sec 90680542 299.58sec
Base Base starfire 194153 60634606 202402 142.75 54725 118013 117.8 712.7 48.0% 0.0% 0.0% 0.0% 2.51sec 60634606 299.58sec
Base Base sunfire 93402 6783 23 0.20 5507 11231 1.0 1.0 22.3% 0.0% 0.0% 0.0% 0.00sec 18731413 299.58sec
Base Base sunfire ticks -93402 18724629 62415 366.73 7400 15834 1.0 1833.7 33.3% 0.0% 0.0% 0.0% 0.00sec 18731413 299.58sec
Base Base tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.4 0.0 0.0% 0.0% 0.0% 0.0% 31.41sec 0 299.58sec
Base Base denizen_of_the_flame 426486 1061944 3545 10.11 16859 34361 8.4 50.5 23.8% 0.0% 0.0% 0.0% 31.41sec 1061944 299.58sec
Base Base denizen_of_the_flame_secondary 426431 969861 3237 19.43 8021 16348 16.2 97.0 23.7% 0.0% 0.0% 0.0% 15.32sec 969861 299.58sec
Base Base wrath 190984 1246932 4162 5.27 34495 70629 26.4 26.3 35.8% 0.0% 0.0% 0.0% 10.32sec 1246932 299.58sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 astral_smolder ticks -394061 39883192 132944 142.02 56163 0 351.1 710.1 0.0% 0.0% 0.0% 0.0% 0.91sec 39883192 299.61sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.61sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 flask 371386 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.61sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.61sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 fury_of_elune 202770 8479925 28303 152.97 7165 15231 5.1 763.8 48.8% 0.0% 0.0% 0.0% 64.88sec 8479925 299.61sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 hungering_shadowflame 424324 1108060 3698 3.42 51984 106378 17.1 17.1 23.7% 0.0% 0.0% 0.0% 16.63sec 1108060 299.61sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 hungering_shadowflame_self 424324 648914 2166 3.42 30448 62088 17.1 17.1 23.9% 0.0% 0.0% 0.0% 16.63sec 718080 299.61sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.90sec 0 299.61sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 launched_thorns 379403 2054057 6856 6.86 48103 98015 34.3 34.2 23.8% 0.0% 0.0% 0.0% 8.55sec 2054057 299.61sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 moonfire 8921 63623 212 1.20 7312 14897 3.0 6.0 43.4% 0.0% 0.0% 0.0% 1.07sec 23258313 299.61sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 moonfire ticks -8921 23194690 77316 364.19 9128 18837 3.0 1820.9 37.2% 0.0% 0.0% 0.0% 1.07sec 23258313 299.61sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.61sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.41sec 0 299.61sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 304.75sec 0 299.61sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.61sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 shooting_stars_moonfire 202497 6095661 20345 47.09 16865 36177 235.8 235.2 46.9% 0.0% 0.0% 0.0% 1.47sec 6095661 299.61sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 shooting_stars_sunfire 202497 6121752 20433 47.42 16814 36063 237.4 236.8 46.9% 0.0% 0.0% 0.0% 1.46sec 6121752 299.61sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 orbit_breaker 274283 12446852 41544 18.89 85830 184525 15.8 94.3 46.7% 0.0% 0.0% 0.0% 19.17sec 12446852 299.61sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 starfall 191034 94148737 314239 353.86 36246 78228 104.7 1767.0 40.6% 0.0% 0.0% 0.0% 2.84sec 94148737 299.61sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 starfire 194153 62944520 210089 142.73 56837 122498 117.8 712.7 47.9% 0.0% 0.0% 0.0% 2.50sec 62944520 299.61sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 sunfire 93402 7089 24 0.20 5737 11702 1.0 1.0 22.7% 0.0% 0.0% 0.0% 0.00sec 19454039 299.61sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 sunfire ticks -93402 19446950 64823 366.76 7686 16438 1.0 1833.8 33.3% 0.0% 0.0% 0.0% 0.00sec 19454039 299.61sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.4 0.0 0.0% 0.0% 0.0% 0.0% 33.14sec 0 299.61sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 denizen_of_the_flame 426486 1058276 3532 10.08 16859 34357 8.4 50.3 23.8% 0.0% 0.0% 0.0% 33.14sec 1058276 299.61sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 denizen_of_the_flame_secondary 426431 966630 3226 19.35 8021 16346 16.1 96.6 23.8% 0.0% 0.0% 0.0% 16.16sec 966630 299.61sec
phial_of_charged_isolation_3 phial_of_charged_isolation_3 wrath 190984 1296070 4326 5.27 35888 73444 26.5 26.3 35.7% 0.0% 0.0% 0.0% 10.35sec 1296070 299.61sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 astral_smolder ticks -394061 42319243 141064 149.60 56576 0 387.6 748.0 0.0% 0.0% 0.0% 0.0% 0.83sec 42319243 299.79sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.79sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.79sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.79sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 fury_of_elune 202770 8502568 28362 153.00 6908 14726 5.1 764.5 53.9% 0.0% 0.0% 0.0% 65.10sec 8502568 299.79sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 hungering_shadowflame 424324 1154159 3850 3.42 51988 105997 17.1 17.1 28.8% 0.0% 0.0% 0.0% 16.55sec 1154159 299.79sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 hungering_shadowflame_self 424324 676587 2257 3.42 30445 62094 17.1 17.1 28.8% 0.0% 0.0% 0.0% 16.55sec 748665 299.79sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.95sec 0 299.79sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 launched_thorns 379403 2123131 7082 6.80 48097 98031 34.1 34.0 28.8% 0.0% 0.0% 0.0% 8.55sec 2123131 299.79sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 launched_thorns_heal 379407 0 0 0.00 0 0 0.2 0.0 0.0% 0.0% 0.0% 0.0% 67.82sec 0 299.79sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 moonfire 8921 63814 213 1.20 7016 14300 3.0 6.0 49.7% 0.0% 0.0% 0.0% 1.07sec 23232690 299.79sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 moonfire ticks -8921 23168876 77230 364.38 8784 18127 3.0 1821.9 42.1% 0.0% 0.0% 0.0% 1.07sec 23232690 299.79sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.79sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.43sec 0 299.79sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 overwhelming_rage ticks -374037 800095 2667 3.95 40537 0 4.1 19.7 0.0% 0.0% 0.0% 0.0% 58.89sec 884894 299.79sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 305.68sec 0 299.79sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.79sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 shooting_stars_moonfire 202497 6077376 20272 47.10 16201 34763 235.9 235.3 51.8% 0.0% 0.0% 0.0% 1.47sec 6077376 299.79sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 shooting_stars_sunfire 202497 6101400 20352 47.45 16145 34658 237.7 237.1 51.8% 0.0% 0.0% 0.0% 1.47sec 6101400 299.79sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 orbit_breaker 274283 12409738 41395 18.90 82408 177299 15.8 94.4 51.6% 0.0% 0.0% 0.0% 19.26sec 12409738 299.79sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 starfall 191034 93989222 313520 353.87 34828 75082 104.8 1768.1 45.5% 0.0% 0.0% 0.0% 2.84sec 93989222 299.79sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 starfire 194153 62765353 209367 142.72 54593 117832 117.9 713.1 52.9% 0.0% 0.0% 0.0% 2.50sec 62765353 299.79sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 sunfire 93402 7212 24 0.20 5507 11233 1.0 1.0 29.8% 0.0% 0.0% 0.0% 0.00sec 19454975 299.79sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 sunfire ticks -93402 19447763 64826 366.96 7390 15771 1.0 1834.8 38.3% 0.0% 0.0% 0.0% 0.00sec 19454975 299.79sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.4 0.0 0.0% 0.0% 0.0% 0.0% 33.33sec 0 299.79sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 denizen_of_the_flame 426486 1104063 3683 10.09 16860 34361 8.4 50.4 28.7% 0.0% 0.0% 0.0% 33.33sec 1104063 299.79sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 denizen_of_the_flame_secondary 426431 1008198 3363 19.39 8021 16351 16.1 96.9 28.6% 0.0% 0.0% 0.0% 16.27sec 1008198 299.79sec
phial_of_corrupting_rage_3 phial_of_corrupting_rage_3 wrath 190984 1294497 4318 5.27 34552 70408 26.5 26.3 40.7% 0.0% 0.0% 0.0% 10.33sec 1294497 299.79sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 astral_smolder ticks -394061 40060536 133535 143.93 55664 0 360.5 719.7 0.0% 0.0% 0.0% 0.0% 0.89sec 40060536 299.69sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.69sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.69sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.69sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 fury_of_elune 202770 8524753 28445 154.35 7008 15015 5.1 770.9 50.6% 0.0% 0.0% 0.0% 65.12sec 8524753 299.69sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 hungering_shadowflame 424324 1133250 3781 3.44 52385 107426 17.2 17.2 24.5% 0.0% 0.0% 0.0% 16.76sec 1133250 299.69sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 hungering_shadowflame_self 424324 652477 2177 3.44 30168 61879 17.2 17.2 24.5% 0.0% 0.0% 0.0% 16.76sec 733809 299.69sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.84sec 0 299.69sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 launched_thorns 379403 2102124 7014 6.91 48465 99271 34.6 34.5 24.6% 0.0% 0.0% 0.0% 8.43sec 2102124 299.69sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 moonfire 8921 62510 209 1.20 7093 14525 3.0 6.0 44.7% 0.0% 0.0% 0.0% 1.05sec 23061994 299.69sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 moonfire ticks -8921 22999484 76665 367.07 8895 18444 3.0 1835.4 38.1% 0.0% 0.0% 0.0% 1.05sec 23061994 299.69sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.69sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.43sec 0 299.69sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 306.05sec 0 299.69sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.69sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 shooting_stars_moonfire 202497 6079884 20287 47.43 16533 35622 237.5 236.9 47.8% 0.0% 0.0% 0.0% 1.45sec 6079884 299.69sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 shooting_stars_sunfire 202497 6105330 20372 47.75 16478 35522 239.1 238.5 47.9% 0.0% 0.0% 0.0% 1.46sec 6105330 299.69sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 orbit_breaker 274283 12419826 41443 19.03 84105 181716 15.9 95.1 47.7% 0.0% 0.0% 0.0% 19.11sec 12419826 299.69sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 starfall 191034 93847280 313150 353.90 35759 77485 105.5 1767.7 41.5% 0.0% 0.0% 0.0% 2.82sec 93847280 299.69sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 starfire 194153 62331000 207986 143.80 55256 119801 118.7 718.3 48.8% 0.0% 0.0% 0.0% 2.49sec 62331000 299.69sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 sunfire 93402 6927 23 0.20 5567 11408 1.0 1.0 23.3% 0.0% 0.0% 0.0% 0.00sec 19309230 299.69sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 sunfire ticks -93402 19302302 64341 369.66 7493 16092 1.0 1848.3 34.3% 0.0% 0.0% 0.0% 0.00sec 19309230 299.69sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.5 0.0 0.0% 0.0% 0.0% 0.0% 32.03sec 0 299.69sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 denizen_of_the_flame 426486 1089988 3637 10.19 16987 34798 8.5 50.9 24.8% 0.0% 0.0% 0.0% 32.03sec 1089988 299.69sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 denizen_of_the_flame_secondary 426431 994952 3320 19.59 8081 16554 16.3 97.8 24.7% 0.0% 0.0% 0.0% 15.70sec 994952 299.69sec
phial_of_elemental_chaos_3 phial_of_elemental_chaos_3 wrath 190984 1283655 4283 5.27 35158 72158 26.5 26.3 36.7% 0.0% 0.0% 0.0% 10.31sec 1283655 299.69sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 astral_smolder ticks -394061 39946490 133155 141.97 56272 0 351.0 709.9 0.0% 0.0% 0.0% 0.0% 0.91sec 39946490 299.56sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.56sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.56sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.56sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 fury_of_elune 202770 8498143 28369 152.98 7178 15264 5.1 763.8 48.8% 0.0% 0.0% 0.0% 65.02sec 8498143 299.56sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 hungering_shadowflame 424324 1110276 3706 3.42 52151 106381 17.1 17.1 23.7% 0.0% 0.0% 0.0% 16.82sec 1110276 299.56sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 hungering_shadowflame_self 424324 649168 2167 3.42 30446 62079 17.1 17.1 23.9% 0.0% 0.0% 0.0% 16.82sec 718260 299.56sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.84sec 0 299.56sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 launched_thorns 379403 2051801 6849 6.85 48103 98016 34.3 34.2 23.8% 0.0% 0.0% 0.0% 8.49sec 2051801 299.56sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 moonfire 8921 62355 208 1.20 7149 14557 3.0 6.0 43.8% 0.0% 0.0% 0.0% 1.05sec 23291045 299.56sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 moonfire ticks -8921 23228690 77429 364.11 9142 18866 3.0 1820.5 37.2% 0.0% 0.0% 0.0% 1.05sec 23291045 299.56sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.56sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.41sec 0 299.56sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 307.08sec 0 299.56sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.56sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 shooting_stars_moonfire 202497 6109606 20396 47.12 16892 36240 235.8 235.3 46.9% 0.0% 0.0% 0.0% 1.47sec 6109606 299.56sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 shooting_stars_sunfire 202497 6132038 20470 47.45 16838 36124 237.5 236.9 46.9% 0.0% 0.0% 0.0% 1.46sec 6132038 299.56sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 orbit_breaker 274283 12481452 41666 18.91 85936 185030 15.8 94.4 46.7% 0.0% 0.0% 0.0% 19.12sec 12481452 299.56sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 starfall 191034 94315535 314851 353.87 36309 78366 104.7 1766.7 40.6% 0.0% 0.0% 0.0% 2.83sec 94315535 299.56sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 starfire 194153 63053261 210489 142.72 56952 122733 117.8 712.6 47.9% 0.0% 0.0% 0.0% 2.50sec 63053261 299.56sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 sunfire 93402 6923 23 0.20 5554 11328 1.0 1.0 23.7% 0.0% 0.0% 0.0% 0.00sec 19479409 299.56sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 sunfire ticks -93402 19472487 64908 366.69 7698 16463 1.0 1833.4 33.3% 0.0% 0.0% 0.0% 0.00sec 19479409 299.56sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.4 0.0 0.0% 0.0% 0.0% 0.0% 32.77sec 0 299.56sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 denizen_of_the_flame 426486 1057907 3532 10.08 16862 34365 8.4 50.3 23.8% 0.0% 0.0% 0.0% 32.77sec 1057907 299.56sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 denizen_of_the_flame_secondary 426431 966943 3228 19.36 8022 16350 16.1 96.7 23.8% 0.0% 0.0% 0.0% 16.06sec 966943 299.56sec
phial_of_static_empowerment_3 phial_of_static_empowerment_3 wrath 190984 1296575 4328 5.27 35920 73355 26.4 26.3 35.8% 0.0% 0.0% 0.0% 10.36sec 1296575 299.56sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 astral_smolder ticks -394061 39718252 132394 141.97 55955 0 350.9 709.8 0.0% 0.0% 0.0% 0.0% 0.91sec 39718252 299.41sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.41sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 flask 371172 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.41sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.41sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 fury_of_elune 202770 8475653 28308 152.97 7151 15227 5.1 763.4 48.9% 0.0% 0.0% 0.0% 65.01sec 8475653 299.41sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 hungering_shadowflame 424324 1140014 3808 3.41 53722 109481 17.0 17.0 23.9% 0.0% 0.0% 0.0% 17.11sec 1140014 299.41sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 hungering_shadowflame_self 424324 655004 2188 3.41 30882 62969 17.0 17.0 23.8% 0.0% 0.0% 0.0% 17.11sec 738748 299.41sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.02sec 0 299.41sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 launched_thorns 379403 2123106 7091 6.86 49724 101346 34.3 34.2 23.8% 0.0% 0.0% 0.0% 8.60sec 2123106 299.41sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 moonfire 8921 63275 211 1.20 7253 14780 3.0 6.0 43.8% 0.0% 0.0% 0.0% 1.05sec 23136231 299.41sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 moonfire ticks -8921 23072956 76910 363.97 9083 18752 3.0 1819.9 37.2% 0.0% 0.0% 0.0% 1.05sec 23136231 299.41sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.41sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.43sec 0 299.41sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 306.93sec 0 299.41sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.41sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 shooting_stars_moonfire 202497 6071508 20279 47.13 16779 36031 235.8 235.2 46.9% 0.0% 0.0% 0.0% 1.47sec 6071508 299.41sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 shooting_stars_sunfire 202497 6094057 20354 47.46 16732 35913 237.4 236.8 46.9% 0.0% 0.0% 0.0% 1.46sec 6094057 299.41sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 orbit_breaker 274283 12389450 41380 18.91 85335 183727 15.8 94.4 46.7% 0.0% 0.0% 0.0% 19.19sec 12389450 299.41sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 starfall 191034 93710049 312987 353.87 36079 77940 104.7 1765.8 40.6% 0.0% 0.0% 0.0% 2.84sec 93710049 299.41sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 starfire 194153 62687869 209375 142.76 56602 122088 117.7 712.4 47.9% 0.0% 0.0% 0.0% 2.51sec 62687869 299.41sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 sunfire 93402 7037 24 0.20 5694 11612 1.0 1.0 22.7% 0.0% 0.0% 0.0% 0.00sec 19357597 299.41sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 sunfire ticks -93402 19350560 64502 366.55 7648 16369 1.0 1832.7 33.4% 0.0% 0.0% 0.0% 0.00sec 19357597 299.41sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.4 0.0 0.0% 0.0% 0.0% 0.0% 32.22sec 0 299.41sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 denizen_of_the_flame 426486 1100969 3677 10.15 17428 35515 8.4 50.7 23.8% 0.0% 0.0% 0.0% 32.22sec 1100969 299.41sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 denizen_of_the_flame_secondary 426431 1005349 3358 19.49 8291 16899 16.2 97.2 23.8% 0.0% 0.0% 0.0% 15.82sec 1005349 299.41sec
phial_of_tepid_versatility_3 phial_of_tepid_versatility_3 wrath 190984 1283556 4287 5.27 35681 72660 26.4 26.3 35.6% 0.0% 0.0% 0.0% 10.32sec 1283556 299.41sec

Fluffy_Pillow : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
158342.9 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Waning Twilight 1.0 0.0 2.2s 0.0s 297.4s 99.26% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 9.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:224.2s / 359.0s
  • uptime_min/max:90.86% / 99.74%

Stack Uptimes

  • waning_twilight_1:99.26%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 2.2s 0.0s 297.4s 99.25% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 12.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:225.4s / 359.1s
  • uptime_min/max:91.51% / 99.74%

Stack Uptimes

  • waning_twilight_1:99.25%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 3.0s 0.0s 297.4s 99.25% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 8.6s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:219.8s / 359.1s
  • uptime_min/max:90.71% / 99.74%

Stack Uptimes

  • waning_twilight_1:99.25%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 1.6s 0.0s 298.0s 99.39% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 5.5s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:231.1s / 359.1s
  • uptime_min/max:92.76% / 99.74%

Stack Uptimes

  • waning_twilight_1:99.39%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 2.9s 0.0s 297.5s 99.27% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.1s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:221.8s / 359.1s
  • uptime_min/max:90.45% / 99.75%

Stack Uptimes

  • waning_twilight_1:99.27%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 3.1s 0.0s 297.2s 99.26% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 15.8s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:219.3s / 359.1s
  • uptime_min/max:90.16% / 99.74%

Stack Uptimes

  • waning_twilight_1:99.26%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 53873
Mean 299.60
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 20.03%
Standard Deviation 34.7581
5th Percentile 245.93
95th Percentile 354.01
( 95th Percentile - 5th Percentile ) 108.09
Mean Distribution
Standard Deviation 0.1498
95.00% Confidence Interval ( 299.31 - 299.90 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 518
0.1% Error 51704
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1032
DPS
Fluffy_Pillow Damage Per Second
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 53873
Mean 169374.83
Minimum 148536.46
Maximum 193040.85
Spread ( max - min ) 44504.39
Range [ ( max - min ) / 2 * 100% ] 13.14%
Standard Deviation 5913.9827
5th Percentile 159700.76
95th Percentile 179231.19
( 95th Percentile - 5th Percentile ) 19530.43
Mean Distribution
Standard Deviation 25.4797
95.00% Confidence Interval ( 169324.89 - 169424.77 )
Normalized 95.00% Confidence Interval ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4684
0.1 Scale Factor Error with Delta=300 298569
0.05 Scale Factor Error with Delta=300 1194274
0.01 Scale Factor Error with Delta=300 29856835
HPS
Fluffy_Pillow Healing Per Second
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 1913
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 50267411 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy2 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
142036.1 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Waning Twilight 1.0 0.0 3.7s 0.0s 295.3s 98.55% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 11.8s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:223.2s / 358.9s
  • uptime_min/max:90.47% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.55%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.1s 0.0s 295.3s 98.57% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.7s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:227.6s / 359.1s
  • uptime_min/max:91.48% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.57%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 3.7s 0.0s 295.3s 98.54% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 11.3s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:219.5s / 358.9s
  • uptime_min/max:90.59% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.54%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.1s 0.0s 296.0s 98.72% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 10.1s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:219.2s / 359.0s
  • uptime_min/max:88.77% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.72%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.8s 0.0s 295.6s 98.61% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 15.5s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:226.0s / 359.0s
  • uptime_min/max:90.67% / 99.75%

Stack Uptimes

  • waning_twilight_1:98.61%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.9s 0.0s 295.1s 98.54% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 11.3s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:225.0s / 359.1s
  • uptime_min/max:90.29% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.54%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy2 Fight Length
Count 53873
Mean 299.60
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 20.03%
Standard Deviation 34.7581
5th Percentile 245.93
95th Percentile 354.01
( 95th Percentile - 5th Percentile ) 108.09
Mean Distribution
Standard Deviation 0.1498
95.00% Confidence Interval ( 299.31 - 299.90 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 518
0.1% Error 51704
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1032
DPS
enemy2 Damage Per Second
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy2 Priority Target Damage Per Second
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy2 Damage Per Second (Effective)
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy2 Damage
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy2 Damage Taken Per Second
Count 53873
Mean 151914.54
Minimum 129437.14
Maximum 175429.42
Spread ( max - min ) 45992.28
Range [ ( max - min ) / 2 * 100% ] 15.14%
Standard Deviation 5600.9320
5th Percentile 142885.01
95th Percentile 161286.75
( 95th Percentile - 5th Percentile ) 18401.74
Mean Distribution
Standard Deviation 24.1310
95.00% Confidence Interval ( 151867.25 - 151961.84 )
Normalized 95.00% Confidence Interval ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5222
0.1 Scale Factor Error with Delta=300 267797
0.05 Scale Factor Error with Delta=300 1071185
0.01 Scale Factor Error with Delta=300 26779611
HPS
enemy2 Healing Per Second
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy2 Healing Per Second (Effective)
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy2 Heal
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy2 Healing Taken Per Second
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy2 Theck-Meloree Index
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy2Theck-Meloree Index (Effective)
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy2 Max Spike Value
Count 1913
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 46014667 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="enemy2"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy3 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
141765.4 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Waning Twilight 1.0 0.0 4.8s 0.0s 295.1s 98.47% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 17.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:224.5s / 358.9s
  • uptime_min/max:91.61% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.47%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 5.9s 0.0s 295.0s 98.47% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 15.7s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:216.3s / 358.8s
  • uptime_min/max:89.76% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.47%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 5.3s 0.0s 295.1s 98.47% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 14.6s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:216.7s / 359.0s
  • uptime_min/max:89.49% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.47%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.0s 0.0s 295.7s 98.61% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 10.1s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:227.4s / 358.9s
  • uptime_min/max:89.77% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.61%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 5.0s 0.0s 295.3s 98.50% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 17.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:221.6s / 359.0s
  • uptime_min/max:89.20% / 99.75%

Stack Uptimes

  • waning_twilight_1:98.50%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 5.0s 0.0s 295.0s 98.49% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.9s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:215.2s / 358.8s
  • uptime_min/max:84.82% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.49%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy3 Fight Length
Count 53873
Mean 299.60
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 20.03%
Standard Deviation 34.7581
5th Percentile 245.93
95th Percentile 354.01
( 95th Percentile - 5th Percentile ) 108.09
Mean Distribution
Standard Deviation 0.1498
95.00% Confidence Interval ( 299.31 - 299.90 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 518
0.1% Error 51704
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1032
DPS
enemy3 Damage Per Second
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy3 Priority Target Damage Per Second
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy3 Damage Per Second (Effective)
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy3 Damage
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy3 Damage Taken Per Second
Count 53873
Mean 151737.06
Minimum 129309.97
Maximum 180016.77
Spread ( max - min ) 50706.79
Range [ ( max - min ) / 2 * 100% ] 16.71%
Standard Deviation 5619.5664
5th Percentile 142628.91
95th Percentile 161163.60
( 95th Percentile - 5th Percentile ) 18534.69
Mean Distribution
Standard Deviation 24.2113
95.00% Confidence Interval ( 151689.60 - 151784.51 )
Normalized 95.00% Confidence Interval ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5269
0.1 Scale Factor Error with Delta=300 269581
0.05 Scale Factor Error with Delta=300 1078324
0.01 Scale Factor Error with Delta=300 26958100
HPS
enemy3 Healing Per Second
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy3 Healing Per Second (Effective)
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy3 Heal
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy3 Healing Taken Per Second
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy3 Theck-Meloree Index
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy3Theck-Meloree Index (Effective)
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy3 Max Spike Value
Count 1913
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 52666643 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="enemy3"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy4 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
141710.6 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Waning Twilight 1.0 0.0 4.0s 0.0s 295.0s 98.46% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:225.4s / 358.9s
  • uptime_min/max:91.25% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.46%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 5.0s 0.0s 294.9s 98.42% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 10.1s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:214.6s / 359.0s
  • uptime_min/max:86.50% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.42%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.6s 0.0s 295.1s 98.46% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 8.6s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:224.2s / 358.9s
  • uptime_min/max:91.88% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.46%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.4s 0.0s 295.6s 98.59% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 9.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:227.5s / 358.9s
  • uptime_min/max:90.88% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.59%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 5.7s 0.0s 295.2s 98.48% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 15.8s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:222.5s / 359.1s
  • uptime_min/max:90.45% / 99.75%

Stack Uptimes

  • waning_twilight_1:98.48%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 5.0s 0.0s 294.9s 98.46% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 15.7s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:220.7s / 358.8s
  • uptime_min/max:91.13% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.46%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy4 Fight Length
Count 53873
Mean 299.60
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 20.03%
Standard Deviation 34.7581
5th Percentile 245.93
95th Percentile 354.01
( 95th Percentile - 5th Percentile ) 108.09
Mean Distribution
Standard Deviation 0.1498
95.00% Confidence Interval ( 299.31 - 299.90 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 518
0.1% Error 51704
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1032
DPS
enemy4 Damage Per Second
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy4 Priority Target Damage Per Second
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy4 Damage Per Second (Effective)
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy4 Damage
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy4 Damage Taken Per Second
Count 53873
Mean 151622.13
Minimum 129887.81
Maximum 176231.56
Spread ( max - min ) 46343.75
Range [ ( max - min ) / 2 * 100% ] 15.28%
Standard Deviation 5557.6165
5th Percentile 142600.05
95th Percentile 160960.72
( 95th Percentile - 5th Percentile ) 18360.67
Mean Distribution
Standard Deviation 23.9443
95.00% Confidence Interval ( 151575.20 - 151669.06 )
Normalized 95.00% Confidence Interval ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5162
0.1 Scale Factor Error with Delta=300 263671
0.05 Scale Factor Error with Delta=300 1054681
0.01 Scale Factor Error with Delta=300 26367007
HPS
enemy4 Healing Per Second
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy4 Healing Per Second (Effective)
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy4 Heal
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy4 Healing Taken Per Second
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy4 Theck-Meloree Index
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy4Theck-Meloree Index (Effective)
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy4 Max Spike Value
Count 1913
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 39475037 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="enemy4"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy5 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
141722.9 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Waning Twilight 1.0 0.0 5.3s 0.0s 295.0s 98.44% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 18.1s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:220.5s / 359.0s
  • uptime_min/max:87.74% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.44%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.2s 0.0s 295.0s 98.45% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 9.3s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:221.5s / 359.0s
  • uptime_min/max:88.73% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.45%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.0s 0.0s 295.0s 98.43% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 12.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:223.8s / 358.9s
  • uptime_min/max:89.69% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.43%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 3.9s 0.0s 295.7s 98.60% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 10.5s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:216.7s / 359.1s
  • uptime_min/max:90.19% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.60%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.2s 0.0s 295.2s 98.50% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 11.3s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:229.4s / 358.8s
  • uptime_min/max:90.12% / 99.75%

Stack Uptimes

  • waning_twilight_1:98.50%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 4.3s 0.0s 294.9s 98.46% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 10.1s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:219.7s / 359.0s
  • uptime_min/max:89.80% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.46%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy5 Fight Length
Count 53873
Mean 299.60
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 20.03%
Standard Deviation 34.7581
5th Percentile 245.93
95th Percentile 354.01
( 95th Percentile - 5th Percentile ) 108.09
Mean Distribution
Standard Deviation 0.1498
95.00% Confidence Interval ( 299.31 - 299.90 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 518
0.1% Error 51704
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1032
DPS
enemy5 Damage Per Second
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy5 Priority Target Damage Per Second
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy5 Damage Per Second (Effective)
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy5 Damage
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy5 Damage Taken Per Second
Count 53873
Mean 151584.83
Minimum 131102.93
Maximum 176911.53
Spread ( max - min ) 45808.60
Range [ ( max - min ) / 2 * 100% ] 15.11%
Standard Deviation 5580.1282
5th Percentile 142632.29
95th Percentile 160969.39
( 95th Percentile - 5th Percentile ) 18337.11
Mean Distribution
Standard Deviation 24.0413
95.00% Confidence Interval ( 151537.71 - 151631.95 )
Normalized 95.00% Confidence Interval ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5206
0.1 Scale Factor Error with Delta=300 265811
0.05 Scale Factor Error with Delta=300 1063242
0.01 Scale Factor Error with Delta=300 26581044
HPS
enemy5 Healing Per Second
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy5 Healing Per Second (Effective)
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy5 Heal
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy5 Healing Taken Per Second
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy5 Theck-Meloree Index
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy5Theck-Meloree Index (Effective)
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy5 Max Spike Value
Count 1913
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 50974608 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="enemy5"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy6 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
142289.2 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Waning Twilight 1.0 0.0 4.1s 0.0s 295.0s 98.46% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 11.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:225.5s / 359.0s
  • uptime_min/max:91.40% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.46%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 5.0s 0.0s 295.0s 98.45% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_static_empowerment_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 10.1s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:220.9s / 359.0s
  • uptime_min/max:90.60% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.45%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 5.1s 0.0s 295.0s 98.46% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_charged_isolation_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 10.5s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:225.3s / 359.1s
  • uptime_min/max:90.48% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.46%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 3.6s 0.0s 295.6s 98.60% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_corrupting_rage_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 9.3s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:228.3s / 358.9s
  • uptime_min/max:93.09% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.60%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 6.0s 0.0s 295.2s 98.49% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_elemental_chaos_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 22.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:221.9s / 359.0s
  • uptime_min/max:88.23% / 99.75%

Stack Uptimes

  • waning_twilight_1:98.49%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 1.0 0.0 5.7s 0.0s 294.8s 98.45% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:phial_of_tepid_versatility_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 15.8s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:219.3s / 358.9s
  • uptime_min/max:87.51% / 99.74%

Stack Uptimes

  • waning_twilight_1:98.45%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy6
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy6
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy6
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy6
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy6 Fight Length
Count 53873
Mean 299.60
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 20.03%
Standard Deviation 34.7581
5th Percentile 245.93
95th Percentile 354.01
( 95th Percentile - 5th Percentile ) 108.09
Mean Distribution
Standard Deviation 0.1498
95.00% Confidence Interval ( 299.31 - 299.90 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 518
0.1% Error 51704
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1032
DPS
enemy6 Damage Per Second
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy6 Priority Target Damage Per Second
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy6 Damage Per Second (Effective)
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy6 Damage
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy6 Damage Taken Per Second
Count 53873
Mean 152424.68
Minimum 130056.77
Maximum 177300.39
Spread ( max - min ) 47243.62
Range [ ( max - min ) / 2 * 100% ] 15.50%
Standard Deviation 5602.8584
5th Percentile 143355.85
95th Percentile 161788.37
( 95th Percentile - 5th Percentile ) 18432.51
Mean Distribution
Standard Deviation 24.1393
95.00% Confidence Interval ( 152377.37 - 152471.99 )
Normalized 95.00% Confidence Interval ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5191
0.1 Scale Factor Error with Delta=300 267981
0.05 Scale Factor Error with Delta=300 1071922
0.01 Scale Factor Error with Delta=300 26798036
HPS
enemy6 Healing Per Second
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy6 Healing Per Second (Effective)
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy6 Heal
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy6 Healing Taken Per Second
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy6 Theck-Meloree Index
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy6Theck-Meloree Index (Effective)
Count 53873
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy6 Max Spike Value
Count 1913
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 37574491 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="enemy6"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.